CLUSTAL format seed alignment for MF_01444

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

C0ZGT0_BREBN          MMYSIVIFPSSKVQEVANSYRKRYDPGYALVPPYIRLKEAFELDEAKLPELVSHLEQVAS
H0U6K4_BRELA          MKYSIVLFPSKEVQEVANSYRKRYDPAYALVQPYIRLKEAFEADDMQIAALSAQLEDIAK
F2F871_SOLSS          MKYGIVAFPSKKLQDLANTYRKRYDPHYALITPHITLKDAFDADEAEIGEISKHLQEVAS
R7ZHB2_LYSSH          MKYGIVAFPSKKLQDLANMYRKRYDPHYAKITPHMTLKDSFDATEEDIQSIVKQLDEIAA
Y715_STAES            MILGLALVPSKSFQDEVNAYRKRYDNHYAQIMPHITIKPQFEIDDHDFNLIKNEVKNRIS
Y604_STAEQ            MILGLALVPSKSFQDEVNAYRKRYDNHYAQIMPHITIKPQFEIDDHDFNLIKNEVKNRIS
Y1020_STAAC           MILGLALIPSKSFQEAVDSYRKRYDKQYSRIKPHVTIKAPFEIKDGDLDSVIEQVRARIN
Y951_STAA8            MILGLALIPSKSFQEAVDSYRKRYDKQYSRIKPHVTIKAPFEIKDGDLDSVIEQVRARIN
Y873_STAAN            MILGLALIPSKSFQEAVDSYRKRYDKQYSRIKPHVTIKAPFEIEDGDLDSVIEQVRARIN
Y1944_STAHJ           MNIGLALIPSKSFQDEVNGYRKRYDTEYARIMPHITIKSHFEINDDELDSVKEEVKKRLE
Y1770_STAS1           MILGLALIPSKAFQDEVNAYRKRYDAHYATIMPHITIKGQFKINDGDLESVKETIKSKIE
Y1284_BACLD           MKYGIVLFPSKKLQDIANSYRKRYDPNYALIPPHLTLRTPFEVSEDEISGVVRHLRELSK
Y1117_BACP2           MKYGVVLFPSKKLQDIANSYRKRYDPNYALIPPHLTLRTPFELTDLEAAEVVSTLREYAK
S6FE88_9BACI          MKYGIVLFPSKKLQDLANSYRKRYDPSYALIPPHLTLRDPFEATEQEIEQVVSQLRQTAK
A0A5C8IU19_BACAM      MKYGIVLFPSKKLQDLANSYRKRYDPSYALIPPHLTVRDPFEATEQEIEQVVSQLRQTAK
E0TZM8_BACPZ          MKYGIVLFPSKKLQDLANSYRKRYDPSYSLIPPHLTLRASFECEEEKADQLVSHLRNIAK
YJCG_BACSU            MKYGIVLFPSKKLQDLANSYRKRYDPSYSLIPPHLTLRASFECAEEKADQLVSHLRNIAK
F7Z3A9_BACC6          MKYALVVFPSKKLQDLVNSYRKRYDPKYALIPPHITLKAAFEASEEEAEVFRGQLKEIAQ
Y1087_BACAH           MKLGIVIFPSKMIQDKANGLRKRYDPHYALVPPHITLKTPFETQDEQLESIVNELHTIAS
Y1241_BACAN           MKLGIVIFPSKMIQDKANGLRKRYDPHYALVPPHITLKTPFETQDEQLESIVNKLHTIAS
Y1309_BACC0           MKLGIVIFPSKMIQDKANGLRKRYDPHYALVPPHITLKTPFETQDEQLESIVNELHTIAS
Y1348_BACC1           MKLGIVIFPSKMIQDKANGLRKRYDPHYALVPPHITLKTPFETQDEQLESIVNELHTIAS
Y1225_BACCR           MKLGIVIFPSKMIQDKANGLRKRYDPHYALVPPHITLKTPFEAQDEQLESIVNELHTIAS
Y4061_BACC2           MKLGIVIFPSKMIQDKANGLRKRYDPHYALVPPHITLKTPFETQDEQLESIVNELHTIAG
Y1135_BACMK           MKLGIVIFPSKMIQDKANGLRKRYDPHYALVPPHITLKTPFETQDEQLESIVNELHTIAN
Y945_BACCN            MKLGIVIFPSKMIQDKANGLRKRYDPHYALVPPHITLKAPFEAPEEQLETIVKELRTIAN
Y864_GEOKA            MKYGIVIFPPKRIQDFANSYRKRYDSHYALIPPHITLKYPFEADEEQIKKMAKELRRIAA
Y743_GEOTN            MKYGIVLFPSKCIQDFANSYRKRYDSHYALIPPHITLKYPFEANEGQLKEMTKELHRIAA
Y799_GEOSW            MKYGIALFPSKRIQDFANSYRKRYDSHYALIPPHLTLKEPFEADDQKIKEIVKELRKIAA
Y1230_OCEIH           MKYGIAIFPSKTIQDQANALRKRYDPRYSLIPPHLTLKESFEADEETLSETVEELRKIAK
A0A135L4N5_9BACI      MKYGIVIYPQKEIQDWANSLRKRYDSHYTLIPPHITIKEAFEI--ENINEAIQYIENITS
Y1439_BACHD           MNYGVALFPSKPLQDLANSYRMRYDPHYTLIPPHVTLKEPFELEEQELPSVVKRVREIAK
D3FYL4_BACPE          MKYGIALFPTKKLQDLANSFRMRYDSHYALIPPHITVKEPFEISDDNLPYITSKLRDIAK
Y1741_BACSK           MNYSIVMFPSKPFQDTANGYRRRYDAHYANIPPHITLKERFSIAEEERSKIIKALRTIGQ
K0AEM3_EXIAB          MNIGVVLFPSKQIQDFANSYRKRYDSKYALITPHITMRERISVDDAELETIVAALNRVAA
C6D517_PAESJ          MLYGIAVFPSKAVQDFANSWRIRHDPHYSIIPPHMTVREKEELSDAQLPTITEHLEAIAS
E0I3J5_9BACL          MEYGLALFPSKVIQQFANSWRKRLDPKYEHISPHMTIRESESWNTEQLTAVRAHLGQCTS
F8FBG5_PAEMK          MFYGIAVFPSQEIAEIAAPLRKRYDPRDFLIRPHLTVYEKQEWTHEQLNDAIAVLHSIAG
                      *  .:.  * . . : .   * * *     : *:: :    .            :     

C0ZGT0_BREBN          STDSFSAHFHRVSSFHPTTNVIYLAVQNKEPFNELHQKIANQ-CVNEK-ETYAYVPHLTI
H0U6K4_BRELA          STSSFSINFHRASTFHPTTNVIFLSFQNKEAVENLHASIMRY-FGDHQ-EEFAFVPHLTI
F2F871_SOLSS          RFAPLQIHASRISSFYPTTNAIYFRVEPTPQLENIQKSIQEK-INFGA-PKHVFVPHITI
R7ZHB2_LYSSH          KYAPLNIYASRISSFFPTTNAIYFRIEPTEQLVTFHNVLEEK-ISFGD-TKHVFVPHITI
Y715_STAES            SIKPVEVHATKASNFAPVSNVIYFKVAKTESLEQLFNQFNTE-DFYGI-AEHPFVPHFTI
Y604_STAEQ            SIKPVEVHATKASNFAPISNVIYFKVAKTESLDQLFNQFNTE-DFYGT-AEHPFVPHFTI
Y1020_STAAC           GIPAVEVHATKASSFKPTNNVIYFKVAKTDDLEELFNRFNGE-DFYGE-AEHVFVPHFTI
Y951_STAA8            GIPAVEVHATKASSFKPTNNVIYFKVAKTDDLEELFNRFNGE-DFYGE-AEHVFVPHFTI
Y873_STAAN            GIPAVEVHATKASSFKPTNNVIYFKVAKTDDLEELFNRFNGE-DFYGE-AEHVFVPHFTI
Y1944_STAHJ           GFGPVDVHATKASSFKPTNNVIYFKVAKTDELEQLFNLFNTE-DFHGE-AEHPFVPHFTI
Y1770_STAS1           GIPTIDIHATKASNFAPITNVIYFKVEKTETLERLFNQFNNG-DFYGV-ADHTFVPHFTI
Y1284_BACLD           ELKPVTLKITKFSSFAPVNNVIYMKAEPTEELMQLHEKMYSG-VLEDK-PEYAFVPHVTV
Y1117_BACP2           NASPITLRIKKFSSFAPVNNVIYMKVEPNEEIMALNERLYAD-PLEGT-PEYAFVPHVTV
S6FE88_9BACI          ESHPLVLKITKYSSFSPVNNVIYMKAEPTEELKSLSEKCYSG-ALSGE-PEYSFVPHVTV
A0A5C8IU19_BACAM      ESHPLVLKITKYSSFSPVNNVIYMKAEPTEELKTLSEKCYSG-ALSGE-PEYSFVPHVTV
E0TZM8_BACPZ          ESHPVVLKMTKYSSFAPVNNVIYIKAEPTEELKTLNEKLYTG-VLAGE-QEYNFVPHVTV
YJCG_BACSU            ESHPLVLKMTKYSSFAPVNNVIYIKAEPTEELKTLNEKLYTG-VLAGE-QEYNFVPHVTV
F7Z3A9_BACC6          KYNPFLLKVTKVKSFEPVSNTIYFKVEPTPELEGLFADFRDR-LPGGP-PPYPFVPHITI
Y1087_BACAH           KTNPFTLHVGKVGSFAPVNNVIYFKVEKTPELTFLNEEMHSG-FFTQE-REYAFVPHLTI
Y1241_BACAN           KTNPFTLHVGKVGSFAPVNNVIYFKVEKTPELTFLNEEMHSG-FFTQE-REYAFVPHLTI
Y1309_BACC0           KTNPFTLHVGKVGSFAPVNNVIYFKVEKTPELTFLNEEMHNG-FFTQE-REYAFVPHLTI
Y1348_BACC1           KTNPFALHVGKVGSFAPVNNVLYFKVEKTPELTFLNEEMHSG-FFTQE-REYAFVPHLTI
Y1225_BACCR           KTNPFTLHVGKVGSFAPVNNVLYFKVEKTPELTFLNEEMHSG-LFTQE-REYAFVPHLTI
Y4061_BACC2           KTNPFTLHVGKVGSFAPVNNVLYFKVEKTPELTFLNEEMHGG-LFTQE-REYAFVPHLTI
Y1135_BACMK           KTNPFTLHVGKVGSFAPVNNVLYFKVEKTPELTFLNEEMHNG-FFTQE-REYSFVPHLTI
Y945_BACCN            KTNPFTLHVGKVGSFAPVNNVIYFKVEKTPELTFLNEEMHKG-FLTQE-REYAFVPHLTI
Y864_GEOKA            ETPPIPIKVTKFSSFYPTSNIIYLKVEPNDVLERLHEQLHSG-LFAGK-PEFVFVPHITI
Y743_GEOTN            ETPPIPIKVTKFSSFYPTSNIIYLKVEQNDVLKHLHEQLHSG-LFAGK-PEFAFVPHITI
Y799_GEOSW            ETDVIPLKVTKFSSFYPTSNVIYLKVEPNETLERLHERLHSG-ILADK-SEYVFVPHITI
Y1230_OCEIH           ETEPFHIQINKVSTFEPVTNTIYFKVEPIQQLNDLHTKLHEG-KFDDN-QTHPFVPHITI
A0A135L4N5_9BACI      QIPPFTLKLSKVGTFLPISPVVYVGFEKNPVIYELQEKLNAD-ILKRP-LKHQFIPHMTI
Y1439_BACHD           GVDPFPLEVYKVDTFYPVSNTLFFKIREHSALTELYEQLHTS-PFKRN-EKYSFVPHLTI
D3FYL4_BACPE          SSSPVEIDVYKVDTFSPQSNTIFFKIKEHETLSELYAKLHQE-PFEEN-TKYKFIPHVTI
Y1741_BACSK           THKPIAIDVYKVDTFYPQSTTIYYKIKENDRLLALYEALHRD-PFPRKRAHPVFVPHITI
K0AEM3_EXIAB          QTKPVSLHIQGARSFHPTNNVLFLKVMPTDELEQLHRALHAG-DLAHT-PKYDFLPHITI
C6D517_PAESJ          QTKPFQVRFNRVSSFYPASHVLYLALEDPTPMIRLHEAVCSGPLHVPSPN-FVYTPHVTI
E0I3J5_9BACL          QLAPVTVRINRVSTFFPASNVIYLALEKPEPVIALRHAVCTGPLALPSPTPYTFTPHITL
F8FBG5_PAEMK          AWKPFPLHFNRFSSFYPASNVIYMALSDPEPMRRLHEAIAQG-LPRPVPKTYTYTPHLTV
                          .        .* * .  ::        .  :                  : **.*:

C0ZGT0_BREBN          GRDLSDDELRDVTGQLSMAKIDLNSEIDRFHLV-YQLEDGIWSVYQTFLLKK--------
H0U6K4_BRELA          GRDLSESELKDVVDQLGMMKFDLPSEITALHVL-KEEVDGKWSIVRSFPLA---------
F2F871_SOLSS          AQKMSASEHDDIHGQLRMVGVDEKDSIDRFHLL-YQLEDGSWTTYETYKLTGAE------
R7ZHB2_LYSSH          AQKMTDSEHDDIFGQLRMIGVDEKDTIDRFHLL-YQLEDGSWTTYETFRLTGAE------
Y715_STAES            AQGLTSQEFEDIYGQVKLAGVDHREIIEELSLLQYSEEEDKWTIIETFTLG---------
Y604_STAEQ            AQGLTSQEFEDIYGQVKLAGVDHREIIEELSLLQYSEEEDKWTIIETFTLG---------
Y1020_STAAC           AQGLSSQEFEDIFGQVALAGVDHKEIIDELTLLRFDDDEDKWKVIETFKLA---------
Y951_STAA8            AQGLSSQEFEDIFGQVALAGVDHKEIIDELTLLRFDDDEDKWKVIETFKLA---------
Y873_STAAN            AQGLSSQEFEDIFGQVALAGVDHKEIIDELTLLRFDDDEDKWKVIETFKLA---------
Y1944_STAHJ           AQGLTSQEFEDIFGQVELVGVDLKEKIEELSLLRYDEEEDKWKVIDTFKLA---------
Y1770_STAS1           AQGLTSQEFEDIYGQLKLAGIDYKETIEQLSLVYYDEKEEKWKVLENYNLA---------
Y1284_BACLD           AQKLSDDEHSDVLGTLKMRDASHEEVIDRFHLL-YQLDNGSWTVYETFILGA--------
Y1117_BACP2           AQKLSDDEHSDVLGTLKLRKIDHEETVDRFHLL-YQLENGSWTVYETFILGEEG------
S6FE88_9BACI          GQKLSSDEHSDVLGQLKMLDISHEEVIDRFHLL-YQLDNGSWTVYETFLLGGGE------
A0A5C8IU19_BACAM      GQKLSSDEHSDVLGQLKMLDISHEEVIDRFHLL-YQLDNGSWTVYETFLLGKGE------
E0TZM8_BACPZ          GQNLSDDEHSDVLGQLKMQEVSHEEIVDRFHLL-YQLENGSWTVYETFLLGGGE------
YJCG_BACSU            GQNLSDDEHSDVLGQLKMQEVSHEEIVDRFHLL-YQLENGSWTVYETFLLGRGE------
F7Z3A9_BACC6          GQELSKEEHADVFRQLEMVGIDHEEKVNRFHLL-YQLENGVWTVYETYHLGKD-------
Y1087_BACAH           GQGLSDAEHADVLGRLRMKDFYYEQPIDRFHLL-YQLENGTWTVHETFRLGKGNN-----
Y1241_BACAN           GQGLSDAEHADVLGRLRMKDFYYEQPIDRFHLL-YQLENGTWTVHETFRLGKGNN-----
Y1309_BACC0           GQGLSDAEHADVLGRLRMKDFYYEQPIDRFHLL-YQLENGTWTVHETFRLGKGNN-----
Y1348_BACC1           GQGLSDAEHADVLGRLRMKDFYYEQPIDRFHLL-YQLENGTWTVHETFRLGKGNN-----
Y1225_BACCR           GQGLSDAEHADVLGRLRMKDFYYEQPIDRFHLL-YQLENGTWTVHETFRLGKGNN-----
Y4061_BACC2           GQGLSDAEHADVLGRLRMKDFYYEQPIDRFHLL-YQLENGTWTVHETFHLGKGNN-----
Y1135_BACMK           GQDLSDAEHADVLGRLRMKDFYYEQPIDRFHLL-YQLENGTWTVHETFHLGKENN-----
Y945_BACCN            AQKLSDAEHADILGRLRMKDFYYEQTIDRFHLL-YQLENETWNVHETFHLGKGSK-----
Y864_GEOKA            GRDLPGAEYADVYSQLKLQDVHFEETVDRFHLL-YQLENGSWTVYETFIVGGKETV----
Y743_GEOTN            GRDLPGAEYADVYSQVKLQHVHFEETIDRFHLL-YQLENGSWTVYDTFVVGGKETV----
Y799_GEOSW            GRDLPNAEYADVYGQLRMQNVHFEETVDRFHLL-YQLENGSWTVYETFLVGGKEQE----
Y1230_OCEIH           AQDLEHDEFSDILGRLQMEGFNLEDYVDRFQLL-YQLDNESWTVYQTFVLGRD-------
A0A135L4N5_9BACI      AQDLHEQEIHDVYGRLKLENLNKSILVDRIHLC-YQIENQSWTVYQTFLLTGK-------
Y1439_BACHD           GQNLSYDELSDNLGRLKMKQIQHEEIVDRIQLL-YQLDNGSWTVYETFKLGKEE------
D3FYL4_BACPE          GQDLSNDEVADVVGRLKMKKIEHHEVIDRMQLL-YQLENGSWTVYETYRLGE--------
Y1741_BACSK           AQGLPQSEHADIVGQLKMIDVSHQETIDRFQLL-KQLDNGSWAVYETFLLEGD-------
K0AEM3_EXIAB          GQDLSDVELFDVLERLKMEDIRFQEDVTKMALL-YELDNGSWSVYETFRFTSQ-------
C6D517_PAESJ          GQNMPPDELHDLYGNLRMSSVDLAAMIDQLHLL-RKTASGVWHIDKSFDLQG--------
E0I3J5_9BACL          GQNMTPDELHDAYGGLRMHTLDFPMEIRAIHLL-QRTDHGIWTLYESFPLLGGQPAATNE
F8FBG5_PAEMK          AQELGDDELHDVLSSLKNQTLDLQCTVDRFTLL-RQEQNGVWKTISEFVLS---------
                      .: :   *  *    :          :  : :         *     : .          

C0ZGT0_BREBN          --
H0U6K4_BRELA          --
F2F871_SOLSS          --
R7ZHB2_LYSSH          --
Y715_STAES            --
Y604_STAEQ            --
Y1020_STAAC           --
Y951_STAA8            --
Y873_STAAN            --
Y1944_STAHJ           --
Y1770_STAS1           --
Y1284_BACLD           --
Y1117_BACP2           --
S6FE88_9BACI          --
A0A5C8IU19_BACAM      --
E0TZM8_BACPZ          --
YJCG_BACSU            --
F7Z3A9_BACC6          --
Y1087_BACAH           --
Y1241_BACAN           --
Y1309_BACC0           --
Y1348_BACC1           --
Y1225_BACCR           --
Y4061_BACC2           --
Y1135_BACMK           --
Y945_BACCN            --
Y864_GEOKA            --
Y743_GEOTN            --
Y799_GEOSW            --
Y1230_OCEIH           --
A0A135L4N5_9BACI      --
Y1439_BACHD           --
D3FYL4_BACPE          --
Y1741_BACSK           --
K0AEM3_EXIAB          --
C6D517_PAESJ          --
E0I3J5_9BACL          DD
F8FBG5_PAEMK          --