CLUSTAL format seed alignment for MF_01446

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

KAE1_ASHGO            -----------------------------MVNLNKVQPRSGGDHYLALGIEGSANKLGVG
KAE1_YEAST            -----------------------------MVNLNTIPPKNGRDYYIALGLEGSANKLGVG
KAE1_CANAL            -----------------------------MVVDLDKYLKPGKDHYLALGLEGSANKLGVG
KAE1_YARLI            -----------------------------------------MTTYLSLGLEGSANKLGVG
KAE1_EMENI            --------------------------------------------MIAIGLEGSANKLGVG
KAE1_ASPFU            --------------------------------------------MIAIGLEGSANKLGVG
KAE1_COCIM            --------------------------------------------MIAIGLEGSANKLGVG
KAE1_PHANO            --------------------------------------------MIAIGLEGSANKIGIG
KAE1_GIBZE            ------------------------------------MAFTNKSSYIALGCEGSANKLGIG
KAE1_NEUCR            -------------------------------------MPDAKGRRIALGCEGSANKLGIG
KAE1_CRYNJ            MLVLLIVFFNSYYTHCSHHSLYSFHCTPPDPAMKQSPLHRPSRPLLALGIEGSANKLGCG
KAE1_SCHPO            ----------------------------------------MGKPLIALGLEGSANKLGVG
B8BU23_THAPS          -----MSSSSTATDPPCPIAPLHNLPLPPPSHLSHLYTPNAFSKTVILGIEGSANKVGVG
OSGEP_BOVIN           -------------------------------------------MPAVLGFEGSANKIGVG
OSGEP_HUMAN           -------------------------------------------MPAVLGFEGSANKIGVG
OSGEP_MOUSE           -------------------------------------------MPAVLGFEGSANKIGVG
OSGEP_RAT             -------------------------------------------MPAVLGFEGSANKIGVG
OSGEP_NEMVE           -------------------------------------------MPTVIGFEGSANKLGIG
B5FXN3_TAEGU          -------------------------------------------MPTVLGLEGSANKVGAG
OSGEP_DICDI           -------------------------------------------MVYIMGFEGSANKLGIG
O49653_ARATH          ----------------------------------------MKKKMIAIGFEGSANKIGVG
OSGEP_DROME           -------------------------------------------MVCALGIEGSANKIGIG
KAE1_ENCCU            --------------------------------------------MIAMGLEGSANKLGVG
A2D8I5_TRIVA          --------------------------------------------MLILGIESSANKIGIG
A8BDD4_GIAIC          ---------------------------------------------MILGLEGSANKLGVG
Q4N2Q3_THEPA          ---------------------------------MNEYSEDFLKKFHVVGIEGSANKLGIG
Q4UA14_THEAN          ---------------------------------MKEYSEDYLKKFHALGIEGSANKLGIA
A7ATJ4_BABBO          ------------------------------------MSGKSLEDFFVLGIEGSANKLGIA
A0A509ALE1_PLABA      ---------------------------------ME---SISKKKMYILGMEGSANKLGIS
Q7RS40_PLAYO          ---------------------------------MG---EISKKKMYILGMEGSANKLGIS
Q8IJ99_PLAF7          ---------------------------MFDNMEVD---KKNGKKKYILGIEGSANKLGIS
B3L268_PLAKH          ---------------------------MMNDANGGGAVTLPEAPKYILGLEGSANKLGVS
A5KDZ1_PLAVS          ---------------------------MVSDCISGGGTTLAQPPKYILGLEGSANKLGVS
KAE1_AERPE            --------------------------MP---PK-------RDGEVLVLGIESTAHTFGVG
KAE1_HYPBU            ---------------MVSVDTPSSLGKPRGDPRQLYRVGGWDEEIYVLGIESTAHTFGVG
KAE1_STAMF            -----------------------------------------------MGIESTSHTFGVG
KAE1_SACS2            --------------------------------------------MFVLGIESTAHTFGVG
KAE1_THEPD            -------------------------------------MLFGMRALKVLGIESTAHTFGVG
KAE1_PYRAE            --------------------------------------------MLVLGVESTAHTFSLG
KAE1_PYRAR            --------------------------------------------MLVLGVESTAHTISLG
A9A4X5_NITMS          --------------------------------------------MLGLGIESTAHTFSCA
KAE1_NANEQ            --------------------------------------------MKVLGIECTAHTFGVG
KAE1_METAR            -----------------------------------------MQCSRVLGIEGTAWSLSAA
KAE1B_METAC           -----------------------------------------MKNTFILGIEGTAWNLSAA
KAE1B_METHJ           -----------------------------------------MKIGPVLGIEGTAWNLSAA
KAE1B_HALSA           --------------------------------------------MRVLGVEGTAWCASAA
KAE1_ARCFU            --------------------------------------------MIALGIEGTAWSLSIG
KAE1_PYRAB            --------------------------------------------MLALGIEGTAHTLGIG
KAE1_PYRFU            --------------------------------------------MIALGIEGTAHTLGIG
KAE1_THEKO            --------------------------------------------MIALGIEGTAHTLGIG
KAE1B_METTH           --------------------------------------------MLCLGIEGTAEKTGVG
KAE1B_METJA           --------------------------------------------MICLGLEGTAEKTGVG
KAE1_METKA            --------------------------------------------MICVGIESTAEKLGVG
KAE1B_THEAC           --------------------------------------------MIVLGLEGTAHTISCG
B1L6Z1_KORCO          -------------------------------------------------MDGRG------
                                                                        :  .      

KAE1_ASHGO            ILKHPMLSQHKQGSLSHDCQAEILSNIRDTYITPPGEGFLPRDTARHHRNWVVRLVRRAL
KAE1_YEAST            IVKHPLLPKHANSDLSYDCEAEMLSNIRDTYVTPPGEGFLPRDTARHHRNWCIRLIKQAL
KAE1_CANAL            VIKHNKGPLSSTN------RAEVLSNIRDTYITPPGEGFLPRDTARHHRNWVVRIIKQAL
KAE1_YARLI            VIKHTVTDANAENGF----STDILSNIRDTYITPPGEGFLPRDTARHHRNWVVRIIKRAL
KAE1_EMENI            IMLHPKDGS----------TPQVLANIRHTYVSPPGEGFLPKDTARHHRSWVVSLVKKAL
KAE1_ASPFU            IMLHPEDGS----------TPRVLANIRHTYVSPPGEGFLPKDTARHHRSWVVKLVKRAL
KAE1_COCIM            IILHPDNGG----------EPRVLANIRHTYVSPPGEGFLPKDTAKHHRKWVVSLVKAAL
KAE1_PHANO            VISHPGPNK----------TPIILSNLRHTYISPPGEGFLPKDTAIHHRAWVVRLIKQAV
KAE1_GIBZE            VILHTPT------------ETKILSNLRDTFVSPPGTGFLPKDTAAHHRAHFVRLAREAL
KAE1_NEUCR            IIAHDPITG----------EALVLSNVRDTFVSPPGTGFLPKDTARHHRAYFVRVAKKAL
KAE1_CRYNJ            IISHSPSPTGGP------TLVMVLSNVRHTYITPPGEGFLPSDTARHHREWVVKVIEEAV
KAE1_SCHPO            IILHDTN-----------GSAKILANVRHTYITPPGQGFLPSDTAKHHRAWIIPLIKQAF
B8BU23_THAPS          ILQYDPSSE----------TYQTLSNPRKTYVSPVGCGFLPKETSWHHQGHVVGLVRAAL
OSGEP_BOVIN           VVR----------------DGKVLANPRRTYVTPPGTGFLPGDTARHHRAVILDLLQEAL
OSGEP_HUMAN           VVR----------------DGKVLANPRRTYVTPPGTGFLPGDTARHHRAVILDLLQEAL
OSGEP_MOUSE           VVR----------------DGTVLANPRRTYVTAPGTGFLPGDTARHHRAVILDLLQEAL
OSGEP_RAT             VVR----------------DGTVLANPRRTYVTAPGTGFLPGDTARHHRAVILDLLQEAL
OSGEP_NEMVE           IIR----------------DGVVLSNPRHTYITPPGQGFMPRDTAKHHQEHAIDILRRAL
B5FXN3_TAEGU          VVR----------------DGAVLSNRRATYVTPPGHGFAPGPTGRHHRAAVLGLVRDAL
OSGEP_DICDI           IVKD---------------DGTILSNIRHTFITPPGEGFLPKDTAKHHRSFILSLVEKSL
O49653_ARATH          IVTL---------------DGTILANPRHTYITPPGHGFLPRETAHHHLDHVLPLVKSAL
OSGEP_DROME           IIR----------------DGKVLANVRRTYITPPGEGFLPKETAKHHREAILGLVESSL
KAE1_ENCCU            IMR----------------DDEILANERLTYAPPPGEGFIPVKTAEHHRSRILGLVAVSL
A2D8I5_TRIVA          IVKP---------------DGTILANVRHTFFGQPGEGFRPSETADHHRKWAIPLIKQAF
A8BDD4_GIAIC          IVDA---------------SGVVHANLRSTYNAPPGQGFQPNDVAAHHRQHIIGLIERAL
Q4N2Q3_THEPA          IIRG---------------DGEILSNVRRTYSPPDGEGFLPRQVSKHHRENMASLLNESL
Q4UA14_THEAN          VIRG---------------DGEILSNVRRTYSPPDGEGFLPRQVSKHHRENMASLLMEAL
A7ATJ4_BABBO          VVRG---------------DGVLLSNVRKTYSAPDGEGFLPRHVARHHRENLSAVLREAL
A0A509ALE1_PLABA      IIDE---------------EMNILVNMRRTYVSEIGCGFIPREINAHHKYYIIDMIKDCL
Q7RS40_PLAYO          IIDE---------------EMKILVNMRRTYVSEIGCGFIPREINAHHKYYIIDMIKDCL
Q8IJ99_PLAF7          IINE---------------DMNILVNMRRTYISEIGCGFIPREISAHHKYYIIDMIKSCL
B3L268_PLAKH          IINS---------------DMQILVNMRRTYVSEIGCGFIPRQINAHHKYYIIEMIKDCL
A5KDZ1_PLAVS          IINS---------------NFEILVNMRRTYISEIGCGFIPRQINAHHKYYIIEMIKDCL
KAE1_AERPE            IV--------------STRPPIVRADVRRRWTPREG-GILPREVAEFFSLHAGEAVAEAL
KAE1_HYPBU            IA--------------STKPPYILVSVRDTYHPPKG-GIHPREAASHHARVASEVILDAL
KAE1_STAMF            IVKYVS----------SINETRILANTYDKYIPEKG-GIHPREAALHHARVAAKVLSDAL
KAE1_SACS2            IVR--------------DSPPYILANERDTFIPKEG-GMKPGDLLKHHAEVSATILRRAL
KAE1_THEPD            IA---------------TSSGDILVNVNHTYVPRHG-GIKPTEAAEHHSRVAPKVLSEAL
KAE1_PYRAE            LVL----------------DGKILGQLGKTYLPPSGEGIHPREAADHHSKVAPVIFRQLL
KAE1_PYRAR            LVK----------------DGDVLGQVGKTYVPPSGLGIHPREAADHHSQMAPQLLSHLL
A9A4X5_NITMS          VIEMK------------GKKGKILSDVRKIYRPADGEGIHPREASRHHIENSSLVLSECL
KAE1_NANEQ            IFD---------------SEKGVLANEKVTYK---GYGIHPREAAELHLKEFDKVLLKAL
KAE1_METAR            IVG-------------WDKV---YAEASHPYVPETG-GIHPMAAAQHHASHVSQIVRQVL
KAE1B_METAC           IVT-------------ETEI---IAEVTETYKPEVG-GIHPREAAQHHAKYAASVIKRLL
KAE1B_METHJ           LFD-------------DDL----IKLVSHPYKPVQG-GIHPREAAQHHASVITSVIEEVL
KAE1B_HALSA           LYD-------------ADAAADSVVIESDAYQPDSG-GIHPREAAEHMREAIPAVIETVL
KAE1_ARCFU            VVD-------------EEGV---IALENDPYIPKEG-GIHPREASQHHSERLPSLLSRVF
KAE1_PYRAB            IVS-------------EDKV---LANVFDTLTTEKG-GIHPKEAAEHHARLMKPLLRKAL
KAE1_PYRFU            IVT-------------ENKV---LANVFDTLKTEKG-GIHPKEAAEHHAKLLKPLLRKAL
KAE1_THEKO            IVT-------------EKSV---LANVFDTLTTEKG-GIHPKEAAEHHARLLKPLLRKAL
KAE1B_METTH           IVD-------------EAGN--VLSLRGKPLIPEKG-GIHPREAAEHHAKWIPRLIAEAC
KAE1B_METJA           IVT-------------SDGE--VLFNKTIMYKPPKQ-GINPREAADHHAETFPKLIKEAF
KAE1_METKA            VVT-------------DDGE--ILVNVKAQYIPPPGSGILPREAAEHHSRELPELLERAL
KAE1B_THEAC           II----------------DESRILAMESSMYRPKTG-GIRPLDAAVHHSEVIDTVISRAL
B1L6Z1_KORCO          ---------------------RILANKWHTYSSESG-GMRPHDIAEHHFNVALDVLEEAL
                                                           *: *                   

KAE1_ASHGO            VEAGIEDPR--L-LDVICFTKGPGMGAPLHSVVVAARTMSMLWDVPLVAVNHCIGHIEMG
KAE1_YEAST            AEADIKSPT--LDIDVICFTKGPGMGAPLHSVVIAARTCSLLWDVPLVGVNHCIGHIEMG
KAE1_CANAL            ATAKIAG----KDIDVICFTQGPGMGAPLQSVVIAARTLAQLWNIPIVGVNHCVGHIEMG
KAE1_YARLI            DEAKISDP---TKLHCISFTQGPGMGAPLQSVVIAARTIAQMWGVPLVGVNHCVGHIEMG
KAE1_EMENI            KEARISVD----DVDCICYTKGPGMGAPLQSVAVAARTLSLLWGKELVGVNHCVGHIEMG
KAE1_ASPFU            REARISVR----DVDCICFTKGPGMGAPLQSVAVAARMLSLLWGKELVGVNHCVGHIEMG
KAE1_COCIM            KEAEIGVS----DVDCICYTKGPGMGPPLQSVALAARTLSLLWGKQLVGVNHCVGHIEMG
KAE1_PHANO            QQAGVKIE----DIECICYTKGPGMGAPLQSVALAARTISLLWGKPVVGVNHCVGHIEMG
KAE1_GIBZE            AEAKITPA----DVDCICYTKGPGMGAPLNSVAVAARALSLLWDRPLVGVNHCVGHIEMG
KAE1_NEUCR            ALSGVSIS----EIDCICYTKGPGMGGPLTSVAVGARTLALLWGKELVGVNHCVGHIEMG
KAE1_CRYNJ            RKAGVRMG----DLDCIAFTKGPGMGTPLQVGALVARTLSLLHNIPLVGVNHCVGHIEMG
KAE1_SCHPO            AEAKISFK----DIDCICFTKGPGIGAPLNSVALCARMLSLIHKKPLVAVNHCIGHIEMG
B8BU23_THAPS          SEAYPGDKRPQRHLSAIAFTLGPGMGGPLRSCAMAARTLSLMWNIPLVAVNHCIAHIEMG
OSGEP_BOVIN           TEAGLTSE----DIDCIAYTKGPGMGAPLVSVAVVARTVAQLWNKPLLGVNHCIGHIEMG
OSGEP_HUMAN           TESGLTSQ----DIDCIAYTKGPGMGAPLVSVAVVARTVAQLWNKPLVGVNHCIGHIEMG
OSGEP_MOUSE           AEAGLTSK----DIDCIAFTKGPGMGAPLASVAVVARTVAQLWNKPLLGVNHCIGHIEMG
OSGEP_RAT             TEAGLTPK----DIDCIAYTKGPGMGAPLASVAVVARTVAQLWNKPLLGVNHCIGHIEMG
OSGEP_NEMVE           DEAQIRPQ----DIDCICYTKGPGMGAPLVAVAVVARTVAQLWKKPIIGVNHCIGHIEMG
B5FXN3_TAEGU          RDAGVEPR----ELDGVAFTRGPGMGAPLAVVAAVARTLAQLWGRPXATVNHRVGHIEMG
OSGEP_DICDI           EESKLKPS----DIDCLAYTKGPGMGPPLRSVAVTVRMLSQLWDRPIVAVNHCIAHIEMG
O49653_ARATH          ETSQVTPE----EIDCICYTKGPGMGAPLQVSAIVVRVLSQLWKKPIVAVNHCVAHIEMG
OSGEP_DROME           KEAQLKSS----DLDVICYTKGPGMAPPLLVGAIVARTLSLLWNIPLLGVNHCIGHIEMG
KAE1_ENCCU            EKAGVDLD----DVDIFCYTKGPGMGLPLSVVATVARTLSLYCNKPLVPVNHCIAHIEMG
A2D8I5_TRIVA          EVAKVSKK----DITTIAYTMGPGMGSPLEVGAIVARTLAQLWKLPLIPVNHCVAHIEMG
A8BDD4_GIAIC          LEAEISSD----KITHIAYTRGPGLGAPLAAVAVVARTLSQLWKVPLLAVNHCVAHIEMG
Q4N2Q3_THEPA          EVAGITLS----DLSLICYTKGPGMGSGLHVGALAAKTLHFITGKPIVGVNHCVAHVEMG
Q4UA14_THEAN          EKAGITLS----DLSLICYTKGPGIGSGLHVGALAAKTIHFITGKPIVGVNHCVAHVEMG
A7ATJ4_BABBO          STAGIKLS----QISLICYTRGPGMGSGLHVGSIAAKTVHFLTGAPIVPVNHCVGHVEMG
A0A509ALE1_PLABA      NKLKIKIT----DIGLICYTKGPGIGSALYVAYNISKLFSLLFNISVIGVNHCIAHIEMG
Q7RS40_PLAYO          NKLKIKIT----NIGLICYTKGPGIGSALYVAYNISKLFSLLFNIPVIGVNHCIAHIEMG
Q8IJ99_PLAF7          KKVNIKIS----DITLICYTKGPGIGSALYIGYNIAKILYSYFNIPVVGVNHCIAHIEMG
B3L268_PLAKH          NKLKIRMT----DIYLICYTKGPGIGSALYIAYNISKFFSLLFNIPVIGVNHCIAHIEMG
A5KDZ1_PLAVS          TKLKIKIT----DVHLICYTKGPGIGSALYIAYNISKFFSLLFNIPVIGVNHCIAHIEMG
KAE1_AERPE            GEAGVS----IADVDAVAVALGPGMGPALRVGATVARALSAKYGKPLVPVNHAVAHVEAA
KAE1_HYPBU            RTVGLS----IRDIDAVAVALGPGLGPALRVGATIARGLAAYYGKPLVPVNHAVAHIEIA
KAE1_STAMF            QKANIS----MRDVSAIAVALGPGLGPCLRVGASLARFLSSYYNIPLIPVNHAVAHIEIG
KAE1_SACS2            EKAKIS----INDINYIAVALGPGIGPALRVGATLARAIALKYNKKLVPVNHGIGHIEIG
KAE1_THEPD            QKAGIS----VEEVDAVAVALGPGMGPCLRVGATLARYLALKFGKPLVPVNHAIAHLEIS
KAE1_PYRAE            NAHGIT----ASDIDVIAYAAGPGLGPALRIGAVFARALAIKLGVPLVPVHHGIAHIEVA
KAE1_PYRAR            YRHGVR----LSDVDVVAYAAGPGLGPALRVGAVLARAIAIKLGVPIVPVHHGIAHIEIA
A9A4X5_NITMS          DEANIK----VNDLDIVSYAGGPGLGPCLRVGAVVARSLASFYKIPIYPVNHALGHIELG
KAE1_NANEQ            EKANIS----LKDIDLIAVSSGPGLLPTLKLGNYIAVYLGKKLNKPVIGVNHIVAHNEFA
KAE1_METAR            DSG--------YDFDGVAFSRGPGLGPCLRTVATAARALALAYDVPLMGVNHCVAHIEVG
KAE1B_METAC           AEAKEKGVE-PSDLDGIAFSQGPGLGPCLRTIATAARMLSLSLDIPLIGVNHCIAHIEIG
KAE1B_METHJ           KGN-------PTPV-AVAFSQGPGLGPCLRIVGTAARALALSFDVPLIGVNHCVAHVEIG
KAE1B_HALSA           GAA-------DGDIDAVAFSRGPGLGPCLRIVGSAARALAQALDVPLVGVNHMVAHLEIG
KAE1_ARCFU            EKVD------KNSIDVVAFSQGPGMGPCLRVVATAARLLAIKLEKPLVGVNHCLAHVEVG
KAE1_PYRAB            SEAG---VS-LDDIDVIAFSQGPGLGPALRVVATAARALAVKYRKPIVGVNHCIAHVEIT
KAE1_PYRFU            EEAG---VS-MEDIDVIAFSQGPGLGPALRVVATAARALAIKYNKPIVGVNHCIAHVEIT
KAE1_THEKO            ETAG---VT-MEDVDLIAFSQGPGLGPALRVVATAARALAIKYNKPIVGVNHCIAHVEIT
KAE1B_METTH           RDAGVE----LGEIGLISFSRGPGLGPALRTVATAARTLALSLDVPIVGVNHCIGHIEIG
KAE1B_METJA           --EVVD----KNEIDLIAFSQGPGLGPSLRVTATVARTLSLTLKKPIIGVNHCIAHIEIG
KAE1_METKA            KNAGVE----PEDIDLVAYSQGPGLGPCLRVGATAARTLALTLEVPLAPVNHCVAHVEIG
KAE1B_THEAC           EKAKIS----IHDIDLIGFSMGPGLAPSLRVTATAARTISVLTGKPIIGVNHPLGHIEIG
B1L6Z1_KORCO          SSAGVS----PKDISIIGFSRGPGIGQALTVGAFIARSLSLKIERPLFGVNHPIAHIEIG
                                   .  .  : ***:   *                    *:* :.* *  

KAE1_ASHGO            REITKAE-----NPVVLYVSGGNTQVIAYS--ENRYRIFGETLDIAIGNCLDRFARTLKI
KAE1_YEAST            REITKAQ-----NPVVLYVSGGNTQVIAYS--EKRYRIFGETLDIAIGNCLDRFARTLKI
KAE1_CANAL            REITGAE-----NPVVLYVSGGNTQVIAYS--KQRYRIFGETLDIAIGNCLDRFARTLKI
KAE1_YARLI            RTITGAT-----NPVVLYVSGGNTQVIAYS--KQRYRIFGETLDIAVGNCLDRFARVLKI
KAE1_EMENI            RLITGAS-----NPVVLYVSGGNTQVIAYS--SQRYRIFGETLDIAVGNCLDRFARTLHI
KAE1_ASPFU            RLITGST-----NPVVLYVSGGNTQVIAYS--SQRYRIFGETLDIAVGNCLDRFARTLHI
KAE1_COCIM            RYITGAQ-----NPIVLYVSGGNTQVIAYS--SQRYRIFGETLDIAVGNCLDRFARTLHI
KAE1_PHANO            RAITKAD-----NPVVLYVSGGNTQVIAYS--AQRYRIFGETLDIAIGNCIDRFARTLMI
KAE1_GIBZE            RYITGAE-----NPVVLYVSGGNSQVIAYA--EQRYRIFGETLDIAVGNCLDRFARTLEI
KAE1_NEUCR            RAITGAS-----NPVVLYVSGGNTQVIAYA--EQRYRIFGETLDIAVGNCLDRFARTLEI
KAE1_CRYNJ            RQITSSH-----NPIVLYVSGGNTQVIAYS--QQRYRIFGETLDIAIGNCLDRFARVIGL
KAE1_SCHPO            REITGAQ-----NPVVLYVSGGNTQVIAYS--EKKYRIFGETLDIAIGNCLDRFARIIGL
B8BU23_THAPS          RVATSAA-----DPVVLYVSGGNTQVIAYS--DGRYRIFGETIDIAVGNCLDRFARVVGL
OSGEP_BOVIN           RLITGAT-----NPTVLYVSGGNTQVIAYS--EHRYRIFGETIDIAVGNCLDRFARVLKI
OSGEP_HUMAN           RLITGAT-----SPTVLYVSGGNTQVIAYS--EHRYRIFGETIDIAVGNCLDRFARVLKI
OSGEP_MOUSE           RLITGAV-----NPTVLYVSGGNTQVISYS--EHRYRIFGETIDIAVGNCLDRFARVLKI
OSGEP_RAT             RLITGAV-----NPTVLYVSGGNTQVISYS--EHRYRIFGETIDIAVGNCLDRFARVLKI
OSGEP_NEMVE           RLITGAN-----NPTVLYVSGGNTQVIAYL--QKRYRIFGETIDIAVGNCLDRFARVLKL
B5FXN3_TAEGU          RQQGAAP-----DPLVLYVSGGNTQVIAYA--RRRYRILGETLDVALGNCIDRLARLLQI
OSGEP_DICDI           RLITGAV-----DPTILYVSGGNTQVISYS--LKKYRIFGETIDIAVGNCLDRFARVIQI
O49653_ARATH          RVVTGAD-----DPVVLYVSGGNTQVIAYS--EGRYRIFGETIDIAVGNCLDRFARVLKL
OSGEP_DROME           RLITGAQ-----NPTVLYVSGGNTQVIAYS--NKRYRIFGETIDIAVGNCLDRFARIIKL
KAE1_ENCCU            RFITKAS-----NPVILYASGGNTQIIAYH--NRRYKIFGETLDIAVGNCIDRFARALKL
A2D8I5_TRIVA          RVVTHAK-----HPVILYVSGGNTQIIARS--GNRYNIFGETLDIAAGNCIDRFARLVNL
A8BDD4_GIAIC          RLVTQLP-----NPVVLYASGGNTQVIAYS--QGRYRVFGEALDIAVGNALDRIARYLLI
Q4N2Q3_THEPA          RFLSGYK-----KPAILYVSGGNTQVLSYDEKRKVYSVLGETLDIAIGNVLDRIARLLYL
Q4UA14_THEAN          RFLSGYK-----KPAILYVSGGNTQVLSYDEKRKVYSVLGETLDIAIGNVLDRIARLLHL
A7ATJ4_BABBO          RHLSGYR-----LPVVLYVSGGNTQVISYDHVRCVYGVLGETLDVAAGNVLDRLARLLGL
A0A509ALE1_PLABA      IFITKLY-----HPIILYVSGSNTQIIYYNNYKKKYEIIGETLDIAIGNVIDRSARILKI
Q7RS40_PLAYO          IFITKLY-----HPIILYVSGSNTQIIYYNNYKKKYEIIGETLDIAIGNVIDRSARILQI
Q8IJ99_PLAF7          IFITKLY-----NPIVLYVSGSNTQIIYYNDHKKKYEIIGETLDIAIGNVIDRSARILKI
B3L268_PLAKH          IFITKLY-----HPIILYVSGSNTQIIYFNNHKKRYEIIGETLDIAIGNVIDRSARILRI
A5KDZ1_PLAVS          IFITKLY-----HPIILYVSGSNTQIIYFNDHKKRYEIIGETLDIAIGNVIDRSARILRI
KAE1_AERPE            RFTTGLR-----DPVALYVAGGNTTVVSFV--AGRYRTFGETLDIALGNLLDTFAREAGI
KAE1_HYPBU            RLYTGLG-----DPVVLYVSGGNTVVAAYA--KARYRVFGETLDIALGNLLDTFARDAGI
KAE1_STAMF            KFLFGFK-----DPLIIYVSGGNTLIAIQR--KKRYRILGETLDIPIGNLLDTFAREIGL
KAE1_SACS2            YLTTEAR-----DPLILYLSGGNTIITTFY--KGRFRVFGETLDIALGNMMDVFVREVSL
KAE1_THEPD            RLTTGLE-----DPVFVYVAGGNTMVTTFN--EGRYRVFGETLDIPLGNCLDTFAREVGL
KAE1_PYRAE            RYTTASC-----DPLVLLISGGHTLIAGFS--EGRYRIFGETLDVAIGNAIDMFAREVGL
KAE1_PYRAR            RYATKSC-----DPLVVLISGGHTVIAGYS--DRRYRIFGETLDVAIGNAIDMFAREAGL
A9A4X5_NITMS          KLLTGAT-----NPLVLLVSGGHTMLLAFL--NKQWRVFGETLDITLGQLLDQFGRSIGF
KAE1_NANEQ            RYLAKAK-----DPLFVYVSGANTQFLAIV--NNSWFLVGETLDMGVGNLIDKVARDLGL
KAE1_METAR            RWQTGCH-----DPVVLYVSGANSQVIAFR--RGRYRVFGETLDIGIGNALDKFGRHLGL
KAE1B_METAC           IWRTPAR-----DPVVLYVSGANSQVISFM--EGRYRVFGETLDIGLGNALDKFARRAGL
KAE1B_METHJ           RFASGFD-----DPVVLYASGANTQVLGYL--QGRYRIFGETLDIGIGNAIDKFARSKGL
KAE1B_HALSA           RHQSGFQ-----QPVCLNASGANAHVLAYR--NGRYRVLGETMDTGVGNAIDKFTRHVGW
KAE1_ARCFU            RWQTGAR-----KPVSLYVSGGNSQVIARR--GNRYRVFGETLDIGIGNALDKLARHMGL
KAE1_PYRAB            K-MFGVK-----DPVGLYVSGGNTQVLALE--GGRYRVFGETLDIGIGNAIDVFARELGL
KAE1_PYRFU            K-MFGVK-----DPVGLYVSGGNTQVLALE--GGRYRVFGETLDIGIGNALDVFARELGL
KAE1_THEKO            K-MFGVK-----DPVGLYVSGGNTQVLALE--GGRYRVFGETLDIGIGNAIDTFARELGI
KAE1B_METTH           RLTTGAS-----DPVSLYVSGGNTQVIAFN--EGRYRVFGETLDIAVGNMLDQFARESGL
KAE1B_METJA           KLTTEAE-----DPLTLYVSGGNTQVIAYV--SKKYRVFGETLDIAVGNCLDQFARYVNL
KAE1_METKA            KLAARQDGFDFDEPVTLYVSGGNTQVLALK--AGRYRVFGETLDLPVGNMLDTFARKVGL
KAE1B_THEAC           RRVTGAI-----DPVMLYVSGGNTQVIAHV--NGRYRVLGETLDIGIGNMIDKFAREAGI
B1L6Z1_KORCO          RAVTGSR-----DPVILYVSGGNTQVISHN--GRRYVVLGETLDIGLGNAQDRLGREVGL
                                   *  :  :*.:: .         :  .**::*   *:  *   *    

KAE1_ASHGO            PNDP--SPGYNIEQLAKQCKNKD-------------------------------------
KAE1_YEAST            PNEP--SPGYNIEQLAKKAPHKE-------------------------------------
KAE1_CANAL            PNEP--APGYNIEQMAKKGKH---------------------------------------
KAE1_YARLI            PNAP--SPGYNIEQLAKKGKK---------------------------------------
KAE1_EMENI            SNDP--APGYNIEQLAKKGKQ---------------------------------------
KAE1_ASPFU            SNDP--APGYNIEQLAKKGKQ---------------------------------------
KAE1_COCIM            SNDP--APGYNIEQLAKKGKR---------------------------------------
KAE1_PHANO            PNNP--FPGYNVEQLAKKGKN---------------------------------------
KAE1_GIBZE            SNDP--APGYNIEQLAKKGSK---------------------------------------
KAE1_NEUCR            SNDP--APGYNIEQLAKQGGRV--------------------------------------
KAE1_CRYNJ            RNDP--SPGYNIEKEAKKGKR---------------------------------------
KAE1_SCHPO            SNAP--SPGYNIMQEAKKGKR---------------------------------------
B8BU23_THAPS          SNDP--SPGYNIELEARKHTKDTP------------------------------------
OSGEP_BOVIN           SNDP--SPGYNIEQMAKRGKK---------------------------------------
OSGEP_HUMAN           SNDP--SPGYNIEQMAKRGKK---------------------------------------
OSGEP_MOUSE           SNDP--SPGYNIEQMAKRGKK---------------------------------------
OSGEP_RAT             SNDP--SPGYNIEQMAKRGKK---------------------------------------
OSGEP_NEMVE           SNDP--SPGYNIEQMAKKGKK---------------------------------------
B5FXN3_TAEGU          PNAP--SPGYNVEQLAKRGRR---------------------------------------
OSGEP_DICDI           PNDP--SPGYNIEQLAKKGKN---------------------------------------
O49653_ARATH          SNDP--SPGYNIEQLAKKGEN---------------------------------------
OSGEP_DROME           SNDP--SPGYNIEQLAKSSNR---------------------------------------
KAE1_ENCCU            PNFP--APGLSVERYAKLGKN---------------------------------------
A2D8I5_TRIVA          PNDP--APGLNVELQARKSTN---------------------------------------
A8BDD4_GIAIC          SNTP--APGLNIERLAAEWAAIFREEDCVHLDPDIVPRYTTLPRSKELLKEQLELYSANH
Q4N2Q3_THEPA          PNKP--APGLSIELQARK------------------------------------------
Q4UA14_THEAN          PNKP--APGLSIELQARK------------------------------------------
A7ATJ4_BABBO          PNKP--APGYSIEVAAR-------------------------------------------
A0A509ALE1_PLABA      SNSP--SPGYNVELWARKKKLLRLLQKIEEKEQLEIYTEKEKQTFIKHDNEHCNENYQNH
Q7RS40_PLAYO          SNSP--SPGYNVELWARKKKLLRLLQKIEAKEGGTCVKQANGKTYQHGQHGQHSNDVGG-
Q8IJ99_PLAF7          SNAP--SPGYNVELLARKKYLLNIMKRNNNKNKNNITKEQEMKDNDFNPNELNDEQIND-
B3L268_PLAKH          SNSP--SPGYNVEILARKKYLLNLEKKKKKKKKKNGSIVVSVVGEDATTGELHSGLVPEK
A5KDZ1_PLAVS          SNSP--SPGYNVEILARKKYLLNLEKKKKKKN--------APIGGSFAGGEPHGGSA---
KAE1_AERPE            APPYVAGGLHAVDRCAEGGGF---------------------------------------
KAE1_HYPBU            APPYIVSGLHIVDRCAEAASK---------------------------------------
KAE1_STAMF            APPYIVNGKHQVDICAEWGSE---------------------------------------
KAE1_SACS2            APPYIINGIHVIDICAEKGNK---------------------------------------
KAE1_THEPD            GFP----GVPRVEELALKGRE---------------------------------------
KAE1_PYRAE            GFP----GVPAVEKCAESADR---------------------------------------
KAE1_PYRAR            GFP----GVPAVERCGESADR---------------------------------------
A9A4X5_NITMS          ASP----CGKNIEELATTSSN---------------------------------------
KAE1_NANEQ            EFP----GGPKIEELAKKGKN---------------------------------------
KAE1_METAR            QHP----GGPKIEALAREGKN---------------------------------------
KAE1B_METAC           PHP----GGPKIEACAKDAKR---------------------------------------
KAE1B_METHJ           PHP----GGPEIERIAKNGS----------------------------------------
KAE1B_HALSA           QHP----GGPKVETHARDGE----------------------------------------
KAE1_ARCFU            KHP----GGPKIEELAKKGQK---------------------------------------
KAE1_PYRAB            GFP----GGPKVEKLAEKGEK---------------------------------------
KAE1_PYRFU            GFP----GGPKIEKLALKGEK---------------------------------------
KAE1_THEKO            GFP----GGPKIEKLALKGEK---------------------------------------
KAE1B_METTH           GHP----GGPVIEQLALKASE---------------------------------------
KAE1B_METJA           PHP----GGPYIEELARKGKK---------------------------------------
KAE1_METKA            PHP----GGPEIERLAEEG-E---------------------------------------
KAE1B_THEAC           PFP----GGPEIEKLAMKGTK---------------------------------------
B1L6Z1_KORCO          PFP----PGPIMDKIE---GN---------------------------------------
                                 :                                                

KAE1_ASHGO            -----------------------------------RLVELPYTVKGMDLSMSGILAHIDS
KAE1_YEAST            -----------------------------------NLVELPYTVKGMDLSMSGILASIDL
KAE1_CANAL            ------------------------------------LVPLPYTVKGMDLSMSGILAAIDS
KAE1_YARLI            ------------------------------------YVPLPYTVKGMDLSMSGVLQFVES
KAE1_EMENI            ------------------------------------LVDLPYTVKGMDCSMSGILAAIDA
KAE1_ASPFU            ------------------------------------LVDLPYTVKGMDCSFSGILAAIDG
KAE1_COCIM            ------------------------------------LVELPYTVKGMDCSFSGILAAIDA
KAE1_PHANO            ------------------------------------LVDLPYGVKGMDASFSGILAAADL
KAE1_GIBZE            ------------------------------------LLDIPYAVKGMDCSFSGILASADA
KAE1_NEUCR            ------------------------------------LLDLPYAVKGMDCSFSGILGRADD
KAE1_CRYNJ            ------------------------------------LVQLPYGTKGMDVSLAGILHSVEA
KAE1_SCHPO            ------------------------------------FIELPYTVKGMDCSFSGLLSGVEA
B8BU23_THAPS          ----------------------------------LKFMELPYVVKGMDVSFSGLLTFIED
OSGEP_BOVIN           ------------------------------------LVELPYTVKGMDVSFSGILSFIED
OSGEP_HUMAN           ------------------------------------LVELPYTVKGMDVSFSGILSFIED
OSGEP_MOUSE           ------------------------------------LVELPYTVKGMDVSFSGILSFIED
OSGEP_RAT             ------------------------------------LVELPYTVKGMDVSFSGILSFIED
OSGEP_NEMVE           ------------------------------------LIELPYTVKGMDVSFSGILSYIEC
B5FXN3_TAEGU          ------------------------------------LLPLPYVVKGLDVSFSGLLSHLQA
OSGEP_DICDI           ------------------------------------LIELPYITKGMDVSFSGILSSIEG
O49653_ARATH          ------------------------------------FIDLPYAVKGMDVSFSGILSYIET
OSGEP_DROME           ------------------------------------YIKLPYVVKGMDVSFSGILSYIED
KAE1_ENCCU            ------------------------------------YIELPYVVKGMDVSFSGILSNIKR
A2D8I5_TRIVA          ------------------------------------YIQLPYVVKGMDVSFSGILTDIEE
A8BDD4_GIAIC          P-----------------------EAGIDTSYDIPIITTIPVPIKGMDISCSGISTYLKT
Q4N2Q3_THEPA          --------------------------------SSKNLIPLPFVVKGMDCSLSGLLTKCEN
Q4UA14_THEAN          --------------------------------SSKNLIPLPFVVKGMDCSLSGLLTKCED
A7ATJ4_BABBO          --------------------------------SGERLISLPFAVKGMDCSLSGLLTYCEQ
A0A509ALE1_PLABA      IYNNNDDVLVSNTKDDSSLKFNKKENYLQSS-YYNELLQFPYTIKGMDISFSGYDFYINK
Q7RS40_PLAYO          --DGGGDALASSPKDGSSVKFSKKENQLQSAIYYNELLQFPYTIKGMDISFSGYDFYISK
Q8IJ99_PLAF7          ---------------------NKK------MEDFTELLFFPYTIKGMDISFSGYDFYITK
B3L268_PLAKH          E-QKDTIPPANNQTNNSNGTSRSNAPMRGDPCDYTELLFFPYTIKGMDISFSGYDYYVSK
A5KDZ1_PLAVS          -------------ANEPNTPRTHDKPVRADPCDYTELLFFPYTIKGMDISFSGYDYYVSK
KAE1_AERPE            ------------------------------------VEGIPYVVKGQDVSFSGILTAALR
KAE1_HYPBU            ------------------------------------PADLPYVVKGMDVSFSGLLTAALR
KAE1_STAMF            ------------------------------------FISLPYTVKGSDLSFSGLLTAALS
KAE1_SACS2            ------------------------------------LLKLPYVVKGQDMSFSGLLTAALR
KAE1_THEPD            ------------------------------------YIPLPYTVKGQDVSYSGLLTHALS
KAE1_PYRAE            ------------------------------------LVPFPMTIIGQDLSYAGLTTYALK
KAE1_PYRAR            ------------------------------------LVEFPMPIVGQDMSYAGLTTYALK
A9A4X5_NITMS          ------------------------------------YVTLPYSVKGNDVSFSGLLSATKS
KAE1_NANEQ            ------------------------------------LIELPYTIKGLNLQLGGIYTYIKR
KAE1_METAR            ------------------------------------YIHLPYVVKGMDLSYSGMMSAAKE
KAE1B_METAC           ------------------------------------YIPLPYVIKGMDLSFSGLSTASSE
KAE1B_METHJ           ------------------------------------YIPLPYTVKGMDLAFSGLVSAAKD
KAE1B_HALSA           ------------------------------------YTALPYVVKGMDFSFSGIMSAAKD
KAE1_ARCFU            ------------------------------------YHFLPYVVKGMDFSFSGMVTAAQR
KAE1_PYRAB            ------------------------------------YIELPYAVKGMDLSFSGLLTEAIR
KAE1_PYRFU            ------------------------------------YIELPYAVKGMDLSFSGLLTEAIR
KAE1_THEKO            ------------------------------------YIELPYAVKGMDLSFSGVLTEAVR
KAE1B_METTH           ------------------------------------YIELPYSVKGMDISFSGLLTAALR
KAE1B_METJA           ------------------------------------LVDLPYTVKGMDIAFSGLLTAAMR
KAE1_METKA            ------------------------------------PVELPYTVRGTDVSFSGLLTAALR
KAE1B_THEAC           ------------------------------------LLDLPYSVKGMDTAFSGILTAALQ
B1L6Z1_KORCO          ------------------------------------WVELPYTVKGMDLSFSGLLTESLR
                                                             :*    * :   .*       

KAE1_ASHGO            LAKDLFRRNTKNYK----------------L-----------------------------
KAE1_YEAST            LAKDLFKGNKKNKI----------------L-----------------------------
KAE1_CANAL            IAKEMF--GKQQKK----------------L-----------------------------
KAE1_YARLI            LAKRF-----QAGD----------------L-----------------------------
KAE1_EMENI            LAATYGLNGEQ-------PDEEEDVTDVTPV-----------------------------
KAE1_ASPFU            LAASYGLNGEE-------KEEE--------------------------------------
KAE1_COCIM            LAAAYGLSGDQQAKENIGLTEDALKLKVDSV-----------------------------
KAE1_PHANO            LAKGLDESLPL---------EKRLKTE---------------------------------
KAE1_GIBZE            LAAQMKAGAD--------------------------------------------------
KAE1_NEUCR            LAAQMKAGEPG-------------------------------------------------
KAE1_CRYNJ            YTKDKRYRSWD-------------------------------------------------
KAE1_SCHPO            AATE--------------------------------------------------------
B8BU23_THAPS          LTKTKEFVKEG-------------------------------------------------
OSGEP_BOVIN           VAQ-----RMLAT-----------------------------------------------
OSGEP_HUMAN           VAH-----RMLAT-----------------------------------------------
OSGEP_MOUSE           AAQ-----RMLAT-----------------------------------------------
OSGEP_RAT             AAQ-----RMLAT-----------------------------------------------
OSGEP_NEMVE           MAH-----KLLSS-----------------------------------------------
B5FXN3_TAEGU          VTP-----KLLQS-----------------------------------------------
OSGEP_DICDI           MVK-----NKQNK-----------------------------------------------
O49653_ARATH          TAE-----EKLKN-----------------------------------------------
OSGEP_DROME           LAEPGKRQNKRKKP----------------------------------------------
KAE1_ENCCU            KIAE--------------------------------------------------------
A2D8I5_TRIVA          KVG---------------------------------------------------------
A8BDD4_GIAIC          YVETH-------------------------------------------------------
Q4N2Q3_THEPA          LIEQFKLKLMLS------------------------------------------------
Q4UA14_THEAN          LIEHFKTKLIMS------------------------------------------------
A7ATJ4_BABBO          LIERERNLLSSG------------------------------------------------
A0A509ALE1_PLABA      YFSKYINKNSKKGNPQYKHNKKKGTNKINKD-------EDNKKKQKINENISPKNYNDQN
Q7RS40_PLAYO          YFSKYINKNSKKGNPQYKNNKKKGTNQINKD-------EDNKKKQKINENMSPQNYNNQN
Q8IJ99_PLAF7          YFSKYMNKKSKTLNKLEKQTTNQGCNEKRKDNQYDNKIKCNQKKQQQEKEKDTYSNINKK
B3L268_PLAKH          YFSKYITKRGKKGKGGDGGKAPLDDKNAPKR----------KKRQGREDANDLKEEKDDD
A5KDZ1_PLAVS          YFSRYLTKRGKKGKGGE---------NAPKR----------KKRHEGGEANGGGRSDADS
KAE1_AERPE            LLKRGA------------------------------------------------------
KAE1_HYPBU            LWTKAG------------------------------------------------------
KAE1_STAMF            LAEKYID-----------------------------------------------------
KAE1_SACS2            VVGKEK------------------------------------------------------
KAE1_THEPD            LYRSGR------------------------------------------------------
KAE1_PYRAE            LWKSGT------------------------------------------------------
KAE1_PYRAR            LLKEGV------------------------------------------------------
A9A4X5_NITMS          VAKKSK------------------------------------------------------
KAE1_NANEQ            IKDQYS------------------------------------------------------
KAE1_METAR            AAA--K------------------------------------------------------
KAE1B_METAC           ALK--K------------------------------------------------------
KAE1B_METHJ           A----S------------------------------------------------------
KAE1B_HALSA           AVDD-G------------------------------------------------------
KAE1_ARCFU            LFDS-G------------------------------------------------------
KAE1_PYRAB            KYRSGK------------------------------------------------------
KAE1_PYRFU            KYKSGK------------------------------------------------------
KAE1_THEKO            KYRTGK------------------------------------------------------
KAE1B_METTH           KMEA-G------------------------------------------------------
KAE1B_METJA           AYDA-G------------------------------------------------------
KAE1_METKA            RYEQ-G------------------------------------------------------
KAE1B_THEAC           YLKT-G------------------------------------------------------
B1L6Z1_KORCO          KLRA-G------------------------------------------------------
                                                                                  

KAE1_ASHGO            ------------------------------------------------------------
KAE1_YEAST            ------------------------------------------------------------
KAE1_CANAL            ------------------------------------------------------------
KAE1_YARLI            ------------------------------------------------------------
KAE1_EMENI            ------------------------------------------------------------
KAE1_ASPFU            ------------------------------------------------------------
KAE1_COCIM            ------------------------------------------------------------
KAE1_PHANO            ------------------------------------------------------------
KAE1_GIBZE            ------------------------------------------------------------
KAE1_NEUCR            ------------------------------------------------------------
KAE1_CRYNJ            ------------------------------------------------------------
KAE1_SCHPO            ------------------------------------------------------------
B8BU23_THAPS          ------------------------------------------------------------
OSGEP_BOVIN           ------------------------------------------------------------
OSGEP_HUMAN           ------------------------------------------------------------
OSGEP_MOUSE           ------------------------------------------------------------
OSGEP_RAT             ------------------------------------------------------------
OSGEP_NEMVE           ------------------------------------------------------------
B5FXN3_TAEGU          ------------------------------------------------------------
OSGEP_DICDI           ------------------------------------------------------------
O49653_ARATH          ------------------------------------------------------------
OSGEP_DROME           ------------------------------------------------------------
KAE1_ENCCU            ------------------------------------------------------------
A2D8I5_TRIVA          ------------------------------------------------------------
A8BDD4_GIAIC          ------------------------------------------------------------
Q4N2Q3_THEPA          ------------------------------------------------------------
Q4UA14_THEAN          ------------------------------------------------------------
A7ATJ4_BABBO          ------------------------------------------------------------
A0A509ALE1_PLABA      SNIINDDNLTLEEDLYQD-SKN-------------DFNKLIQNNEKNNNK----------
Q7RS40_PLAYO          ATIVNDDTLTLEEELCQD-YKNGDKAGTNPNHGQEDPNKSSDKPGTNPNHGQEDPNKSSD
Q8IJ99_PLAF7          CKIENVSQQTIESNQNNNNMYNQNKLGKETFKNIEPLKDNYKNDYVKVKEDIRDNHNGTV
B3L268_PLAKH          GEGDSDGGCASGGGANDS-----------------NGNDGPPNDGT--------------
A5KDZ1_PLAVS          VNGEEDD--HADDAANRG-----------------NPIAGAAND----------------
KAE1_AERPE            ------------------------------------------------------------
KAE1_HYPBU            ------------------------------------------------------------
KAE1_STAMF            ------------------------------------------------------------
KAE1_SACS2            ------------------------------------------------------------
KAE1_THEPD            ------------------------------------------------------------
KAE1_PYRAE            ------------------------------------------------------------
KAE1_PYRAR            ------------------------------------------------------------
A9A4X5_NITMS          ------------------------------------------------------------
KAE1_NANEQ            ------------------------------------------------------------
KAE1_METAR            ------------------------------------------------------------
KAE1B_METAC           ------------------------------------------------------------
KAE1B_METHJ           ------------------------------------------------------------
KAE1B_HALSA           ------------------------------------------------------------
KAE1_ARCFU            ------------------------------------------------------------
KAE1_PYRAB            ------------------------------------------------------------
KAE1_PYRFU            ------------------------------------------------------------
KAE1_THEKO            ------------------------------------------------------------
KAE1B_METTH           ------------------------------------------------------------
KAE1B_METJA           ------------------------------------------------------------
KAE1_METKA            ------------------------------------------------------------
KAE1B_THEAC           ------------------------------------------------------------
B1L6Z1_KORCO          ------------------------------------------------------------
                                                                                  

KAE1_ASHGO            ------------------------------------------------------------
KAE1_YEAST            ------------------------------------------------------------
KAE1_CANAL            ------------------------------------------------------------
KAE1_YARLI            ------------------------------------------------------------
KAE1_EMENI            ------------------------------------------------------------
KAE1_ASPFU            ------------------------------------------------------------
KAE1_COCIM            ------------------------------------------------------------
KAE1_PHANO            ------------------------------------------------------------
KAE1_GIBZE            ------------------------------------------------------------
KAE1_NEUCR            ------------------------------------------------------------
KAE1_CRYNJ            ------------------------------------------------------------
KAE1_SCHPO            ------------------------------------------------------------
B8BU23_THAPS          ------------------------------------------------------------
OSGEP_BOVIN           ------------------------------------------------------------
OSGEP_HUMAN           ------------------------------------------------------------
OSGEP_MOUSE           ------------------------------------------------------------
OSGEP_RAT             ------------------------------------------------------------
OSGEP_NEMVE           ------------------------------------------------------------
B5FXN3_TAEGU          ------------------------------------------------------------
OSGEP_DICDI           ------------------------------------------------------------
O49653_ARATH          ------------------------------------------------------------
OSGEP_DROME           ------------------------------------------------------------
KAE1_ENCCU            ------------------------------------------------------------
A2D8I5_TRIVA          ------------------------------------------------------------
A8BDD4_GIAIC          ------------------------------------------------------------
Q4N2Q3_THEPA          ------------------------------------------------------------
Q4UA14_THEAN          ------------------------------------------------------------
A7ATJ4_BABBO          ------------------------------------------------------------
A0A509ALE1_PLABA      QTKINTNHILPNYS------FLHGMKGSSYYEDNIIYKNENKQNYGQNNEYYD-DNCSIE
Q7RS40_PLAYO          KAVTNPNHVSPNYS------FLHGMKGSSYYEENIVYKNENKQNYGQNSEYSD-DNCSIE
Q8IJ99_PLAF7          QNINDDNNSSNNYQKSNKLFYVAGLKGNSYYEDNIIFESEHKENYGENDEYID-DNCSIE
B3L268_PLAKH          APGGTQHFPQPNLS------IHTGVQGSSYYEENVICSISGKKNYGEGDHYAEEEDGAIE
A5KDZ1_PLAVS          --GSTQQFPQPNLS------IRAGVQGSSYYEENVVCSSGGKRNYGEGEHYAEEDDCAIE
KAE1_AERPE            ------------------------------------------------------------
KAE1_HYPBU            ------------------------------------------------------------
KAE1_STAMF            ------------------------------------------------------------
KAE1_SACS2            ------------------------------------------------------------
KAE1_THEPD            ------------------------------------------------------------
KAE1_PYRAE            ------------------------------------------------------------
KAE1_PYRAR            ------------------------------------------------------------
A9A4X5_NITMS          ------------------------------------------------------------
KAE1_NANEQ            ------------------------------------------------------------
KAE1_METAR            ------------------------------------------------------------
KAE1B_METAC           ------------------------------------------------------------
KAE1B_METHJ           ------------------------------------------------------------
KAE1B_HALSA           ------------------------------------------------------------
KAE1_ARCFU            ------------------------------------------------------------
KAE1_PYRAB            ------------------------------------------------------------
KAE1_PYRFU            ------------------------------------------------------------
KAE1_THEKO            ------------------------------------------------------------
KAE1B_METTH           ------------------------------------------------------------
KAE1B_METJA           ------------------------------------------------------------
KAE1_METKA            ------------------------------------------------------------
KAE1B_THEAC           ------------------------------------------------------------
B1L6Z1_KORCO          ------------------------------------------------------------
                                                                                  

KAE1_ASHGO            --------------------------------------------------FDRETGKQLV
KAE1_YEAST            --------------------------------------------------FDKTTGEQKV
KAE1_CANAL            --------------------------------------------------IDEESGEP-I
KAE1_YARLI            --------------------------------------------------VVD--GHQ-V
KAE1_EMENI            --------------------------------------------------SDGALESRKP
KAE1_ASPFU            ----------------------------------------------------GAGDDSKP
KAE1_COCIM            --------------------------------------------------DKYNNEGGIP
KAE1_PHANO            -------------------------------------------------------EGELV
KAE1_GIBZE            -----------------------------------------------------------F
KAE1_NEUCR            ------------------------------------------------------PDGEPF
KAE1_CRYNJ            --------------------------------------------------QVNDVEEDII
KAE1_SCHPO            --------------------------------------------------LLDPKNPSSV
B8BU23_THAPS          ----------------------------------------------------LAETEEQF
OSGEP_BOVIN           ---------------------------------------------------------GEC
OSGEP_HUMAN           ---------------------------------------------------------GEC
OSGEP_MOUSE           ---------------------------------------------------------GEC
OSGEP_RAT             ---------------------------------------------------------GEC
OSGEP_NEMVE           ---------------------------------------------------------EEC
B5FXN3_TAEGU          ---------------------------------------------------------GEA
OSGEP_DICDI           ---------------------------------------------------------TQH
O49653_ARATH          ---------------------------------------------------------NEC
OSGEP_DROME           ----------------------------------------------------QEEEVNNY
KAE1_ENCCU            ---------------------------------------------------------DEQ
A2D8I5_TRIVA          ----------------------------------------------------------KY
A8BDD4_GIAIC          ---------------------------------------------------------TSL
Q4N2Q3_THEPA          ------EDS---------------------------------------------AFEYEQ
Q4UA14_THEAN          ------EDS---------------------------------------------AFEYEQ
A7ATJ4_BABBO          ------EIT---------------------------------------------ESDFSR
A0A509ALE1_PLABA      TSSDFYEKD------------------------------LQELIYEEAE--AIKLTEEEK
Q7RS40_PLAYO          TSSDYYEKE------------------------------LEENISEEVE--ALKLSDEEK
Q8IJ99_PLAF7          TASDFYEKS------------------------------VNEEGEGEGEEDVIDLTEEEK
B3L268_PLAKH          TESDFFDSS----------------SDEGAAEGGKNEGDLRNPPSQTQPHNGTHLTDEEK
A5KDZ1_PLAVS          TESDFFDSSEEQPSSGSSEEQPRSRSSEEKARSRSTEEQPRNESSEEKPPSGGSLTDEEK
KAE1_AERPE            ---------------------------------------------------------RLS
KAE1_HYPBU            ---------------------------------------------------------SED
KAE1_STAMF            ---------------------------------------------------------NKK
KAE1_SACS2            ------------------------------------------------------------
KAE1_THEPD            -----------------------------------------------------------A
KAE1_PYRAE            ------------------------------------------------------------
KAE1_PYRAR            ------------------------------------------------------------
A9A4X5_NITMS          ------------------------------------------------------------
KAE1_NANEQ            ------------------------------------------------------------
KAE1_METAR            -----------------------------------------------------------Y
KAE1B_METAC           -----------------------------------------------------------A
KAE1B_METHJ           -----------------------------------------------------------A
KAE1B_HALSA           -----------------------------------------------------------V
KAE1_ARCFU            -----------------------------------------------------------V
KAE1_PYRAB            -----------------------------------------------------------Y
KAE1_PYRFU            -----------------------------------------------------------Y
KAE1_THEKO            -----------------------------------------------------------Y
KAE1B_METTH           -----------------------------------------------------------A
KAE1B_METJA           -----------------------------------------------------------E
KAE1_METKA            -----------------------------------------------------------D
KAE1B_THEAC           -----------------------------------------------------------Q
B1L6Z1_KORCO          -----------------------------------------------------------F
                                                                                  

KAE1_ASHGO            TVEDLCYSLQEHLFAMLVEITERAMAHVNSNQVLIVGGVGCNVRLQQMMASMCQSRADGQ
KAE1_YEAST            TVEDLCYSLQENLFAMLVEITERAMAHVNSNQVLIVGGVGCNVRLQEMMAQMCKDRANGQ
KAE1_CANAL            TAEDLCFSLQETLFSMLVEITERALAHVDSNQVLIVGGVGSNQRLQEMMKLMIQDRKNGQ
KAE1_YARLI            TAEDLCFSLQETLFAMLVEITERAMAHVNSQQVLIVGGVGCNERLQEMMGIMARDR-NGS
KAE1_EMENI            TRADLCFSLQETVFSMLVEITERAMAHVGSKEVLIVGGVGCNERLQEMMGIMARDR-GGS
KAE1_ASPFU            TRADLCFSLQETVFSMLVEITERAMAHVGSKEVLIVGGVGCNERLQEMMGIMARDR-GGS
KAE1_COCIM            TREDLCFSLQETVFSMLVEITERAMAHVGSREVLIVGGVGCNERLQEMMGIMARDR-GGN
KAE1_PHANO            TREDLCFSLQETIYAMLVEITERAMAHVGSQQVLVVGGVGSNERLQQMMGMMARDR-GGS
KAE1_GIBZE            TPEDLCFSLQETVFAMLVEITERAMAHVGSSQVLIVGGVGCNERLQEMMGHMARER-GGS
KAE1_NEUCR            TPADLCFSLQETVFAMLVEITERAMAHVGSNQVLIVGGVGCNERLQEMMGAMAAER-GGS
KAE1_CRYNJ            TPYDLCFSLQETTFAMLVEITERAMAHVGAKDVLIVGGVGCNLRLQEMMGIMASER-GGR
KAE1_SCHPO            TKQDLCYSLQETGFAMLVEITERAMAHIRADSVLIVGGVGCNERLQQMMAEMSSDR-GAD
B8BU23_THAPS          TTADLCYSLQETIFAMLIEITERTMAHCGQNSVLIVGGVGCNKRLQDMMGLMVSDR-GGT
OSGEP_BOVIN           TPEDLCFSLQETVFAMLVEITERAMAHCGSQEALIVGGVGCNVRLQEMMETMCQER-GAR
OSGEP_HUMAN           TPEDLCFSLQETVFAMLVEITERAMAHCGSQEALIVGGVGCNVRLQEMMATMCQER-GAR
OSGEP_MOUSE           TPEDLCFSLQETVFAMLVEITERAMAHCGSKEALIVGGVGCNLRLQEMMGTMCQER-GAQ
OSGEP_RAT             TPEDLCFSLQETVFAMLVEITERAMAHCGSKEALIVGGVGCNVRLQEMMATMCQER-GAQ
OSGEP_NEMVE           TPEDLCFSLQETVFAMLVETTERAMAHCGSNEVLIVGGVGCNKRLQEMMDVMAKER-GAK
B5FXN3_TAEGU          TPEDLCFSLQETAFAALAEVTERALALTRARHLLLVGGVACNHRLQEMLRVMCHAR-GAE
OSGEP_DICDI           SVEDLCYSLQEHLFSMLVETAERALAHCGQNEVLAVGGVGCNQRLQEMIQQMISQR-NGK
O49653_ARATH          TPADLCYSLQETVFAMLVEITERAMAHCDKKDVLIVGGVGCNERLQEMMRTMCSER-DGK
OSGEP_DROME           SQADLCYSLQETIFAMLVEITERAMAHCGSNEVLIVGGVGCNERLQEMMRIMCEER-GGK
KAE1_ENCCU            VKRDLCYSLQETVFSALVEVTERAMAFSSSKEVLIVGGVGCNLRLQEMMGIMARER-GGV
A2D8I5_TRIVA          PVEDLCYSVQETVFAMLTEITERCLAHCESSEVLIVGGVACNERLQKMIGDMCAAR-GAT
A8BDD4_GIAIC          DPRLICYSLQETLFGSLVEITERAAAHVGAADILAVGGVGCNLRLQEMLQIMAAER-NGR
Q4N2Q3_THEPA          FKVDLCFSIQEHTFAMLLEMLERAMAFTGSDEILLVGGVGCNLRLQEMANLMAQER-NAK
Q4UA14_THEAN          FKVDLCFSVQEHTFAMLIEMLERAMSFTDSDEILLVGGVGCNLRLQEMANLMAKER-NAK
A7ATJ4_BABBO          FTCDLCFSVQEHMFAMLIEMTERAMSFVGANELLVVGGVGCNLRLQSMASAMAESR-GAR
A0A509ALE1_PLABA      RKIQICYSLQHHIFSMLIEITERAISFTNSKEVIIVGGVGCNIFLQNMMKKMAKQK-NIK
Q7RS40_PLAYO          RKIQICYSLQHHIFSMLIEITERAIAFTNSKEVIIVGGVGCNVFLQNMMKKMAKQK-NIK
Q8IJ99_PLAF7          RKIQICYSLQHHIFSMLIEITERAIAFTNSKEVIIVGGVGCNLFLQNMMKKMAKQK-NIK
B3L268_PLAKH          RKIQICYSLQHHIFSMLIEITERAIAFTNSKEVIIVGGVGCNVFLQNMMKKMAKQK-NIK
A5KDZ1_PLAVS          RKIQICYSLQHHIFSMLIEITERAIAFTNSKEVIIVGGVGCNVFLQNMMKKMAKQK-NIK
KAE1_AERPE            D---VCYTLREVAFSSVVEVTERCLAHTGKRQATLTGGVAANRVLNEKMSLMAGLH-GAV
KAE1_HYPBU            EKAAVCLGLREVAYGSVVEVTERALAHTRKKSVMLTGGVAASPILRNKVRSMASYH-GAV
KAE1_STAMF            KLGNVCLSLRETAFNMLVEVAERSLVLAGKKEVLLVGGVASNKVLRKKLELMASLH-GAK
KAE1_SACS2            -LEDICYSVREIAFDMLLEATERALALTSKKELMIVGGVAASVSLRKKLEELGKEW-NVQ
KAE1_THEPD            RLEDVCYSLVETAYSMLVEVAERALAHTGKSQLVLTGGVARSRILLEKLRRMVEDR-GGV
KAE1_PYRAE            PLPVVCKSLVEAAYYMLAEVTERALAFTKKRELVVAGGVARSKRLRGILEHVGREY-GVA
KAE1_PYRAR            PLSVICKSLVEAAYYMLAEVTERALAFTRKSELVVAGGVARSRRLREILSQVGAYH-GAE
A9A4X5_NITMS          --VDACYSLQETAFAMIAEAVERALSFTRKKELMIVGGVAANKRLSEMLQDVCKRH-GAK
KAE1_NANEQ            -KEDIAYSLQEWVFALILEIAERAMHMLDKKELILTGGVACNNRLNDMAEQMAKEN-NFK
KAE1_METAR            LKEDVCFSLQENAFAMLVEVTERALAHTGKNEVLIGGGVGANMRLQSMLDTMCRDR-GAK
KAE1B_METAC           SLEDVCYSYQETAFAMVVEVAERALAHTGKNEVLLAGGVGANTRLREMLNEMCEAR-GAK
KAE1B_METHJ           PLEDVCYSLQETAFAMCTEVTERALSQTGKEQLILVGGVGMNKRLQEMLSCMCEDR-DAA
KAE1B_HALSA           PVADVCRGLEETMFAMLTEVAERALALTGRDELVLGGGVGQNDRLRGMLEAMCAAR-GAS
KAE1_ARCFU            RMEDVAFSFQETAFAMLTEVTERALAYLDLNEVLLVGGVAANKRLQEMLRIMCEDR-GAK
KAE1_PYRAB            RVEDLAYSFQETAFAALVEVTERAVAHTEKDEVVLVGGVAANNRLREMLRIMTEDR-GIK
KAE1_PYRFU            RVEDLAYSFQETAFAALVEVTERALAHTEKEEVVLVGGVAANNRLREMLRIMAEDR-GVK
KAE1_THEKO            RIEDLAYSFQETAFAALVEVTERAVAHTGKEEVVLVGGVAANNRLREMLKIMAEDR-GIK
KAE1B_METTH           SLEDLAYSIQETAFSMLVEVTERALAYTEKNQVLLCGGVAVNRRLRDMLREMCQEH-HVE
KAE1B_METJA           RLEDICYSLQEYAFSMLTEITERALAHTNKGEVMLVGGVAANNRLREMLKAMCEGQ-NVD
KAE1_METKA            RLEDVCAGLQETAFAMLVEITERAAAQLGRDEILLTGGVAANRRLSEMMHEMAEDR-GAE
KAE1B_THEAC           AIEDISYSIQETAFAMLVEVLERALYVSGKDEILMAGGVALNRRLRDMVTNMAREA-GIR
B1L6Z1_KORCO          KKEDIVWSFMEVAFSMTVEVAERALALTGKEELLLVGGVAASPRFREKVRKMCEER-GAK
                                .  :    *  **             ***. .  :      :        

KAE1_ASHGO            VHATDERFCIDNGVMIAQAGLLQYRMGD-------IVKDFSETVVTQRFRTDEVYVSWRD
KAE1_YEAST            VHATDNRFCIDNGVMIAQAGLLEYRMGG-------IVKDFSETVVTQKFRTDEVYAAWRD
KAE1_CANAL            IYATDERFCIDNGIMIAHAGLLSYRTG--------QTNQLNNTVCTQRFRTDEVFVKWRD
KAE1_YARLI            VYATDERFCIDNGIMIAHAGLLAWRQG--------FETKMEKTQCTQRFRTDEVLVDWRV
KAE1_EMENI            VHATDERFCIDNGIMIAQAGMLAYKTG--------FRTPLKESTCTQRFRTDDVFVQWRD
KAE1_ASPFU            VHATDERFCIDNGIMIAQAGLLAYKTG--------FRTPLKESTCTQRFRTDDVFVKWRD
KAE1_COCIM            VFATDERFCIDNGIMIAQAGILAYKTG--------FTTKLEDSTCTQRFRTDEVFVQWRD
KAE1_PHANO            VFATDERFCIDNGIMIAHAGLLEYCTG--------VVTKMEDTTCTQRFRTDEVFVGWRD
KAE1_GIBZE            VYATDERFCIDNGIMIAHAGLLAYETG--------FRTSLEESTCTQRFRTDEVFIKWRD
KAE1_NEUCR            VYATDERFCIDNGIMIAHAGLLAYETG--------FRTPLDESTCTQRFRTDEVFVKWRD
KAE1_CRYNJ            VFATDESFCIDNGIMIAQAGLLAFRMG--------NTMPLEKTGVTQRYRTDAVHVAWRA
KAE1_SCHPO            VFSTDERFCIDNGIMIAQAGLLAYKTG--------DRCAVAESTITQRYRTDDVYISWRD
B8BU23_THAPS          LCAMDHRYCIDNGAMIAQAGMFGLQYGSES----MCVKGVEGTECRQRFRTDQVEVVWRP
OSGEP_BOVIN           LFATDERFCIDNGAMIAQAGWEMFQAG--------HRTPLSESGITQRYRTDEVEVTWRD
OSGEP_HUMAN           LFATDERFCIDNGAMIAQAGWEMFRAG--------HRTPLSDSGVTQRYRTDEVEVTWRD
OSGEP_MOUSE           LFATDERFCVDNGAMIAQAGWEMFQAG--------HRTPLKDSAITQRYRTDEVEVTWRD
OSGEP_RAT             LFATDERFCIDNGAMIAQAGWEMFQAG--------HRTPLQDSGITQRYRTDEVEVTWRD
OSGEP_NEMVE           LYATDERFCIDNGAMIAQAGWEMFQTG--------SVTPLEQTTCTQRFRTDEVEVTWRD
B5FXN3_TAEGU          LCPVDDRYCIDNGAMIAQAGCEMPRAG--------QVTELSQSGITQRYRTDEVEVTWRD
OSGEP_DICDI           SFAIDERYCIDNGAMIAWAGYLIFKNG--------TTTPLSQTTTTQRFRTDQVDVTWRD
O49653_ARATH          LFATDDRYCIDNGAMIAYTGLLAFVNG--------IETPIEDSTFTQRFRTDEVHAVWRE
OSGEP_DROME           LFATDERYCIDNGLMIAHAGAEMFRSG--------TRMPFEESYVTQRFRTDEVLVSWRD
KAE1_ENCCU            CYATDERFCIDNGVMIAYVGMLMAKSG--------AAFKLGECFVTQRYRTDSVEVTWRD
A2D8I5_TRIVA          VCAMDERYCIDNGAMIAYTASLMKTPI-----------EPSKANIIQRYRTDEVVVDWD-
A8BDD4_GIAIC          LGAMDDSYCVDNGAMIAWCGACMLQAPLSM-DLLIPYTEVNCATVTQRYRTDSVDVPWHS
Q4N2Q3_THEPA          LFPMDDRYCIDNGAMIGYTGMIDYLYGL----KEKSVLDPKEVTVSQRYRTDQAPVHWIG
Q4UA14_THEAN          LFPMDERYCIDNGAMIGYTGMIDYLYGL----KEKCVLEPKEVTVSQRYRTDQAPVHWIE
A7ATJ4_BABBO          LYPMDERYCIDNGAMIAFAGLMDYLHGK----GSEAAVPADKVSICQRYRTDQCVVTWI-
A0A509ALE1_PLABA      IGFMDHSYCVDNGAMIAYTGYLEYLNS-----KNKNDFNFENISIHQRYRTDDVFVTWR-
Q7RS40_PLAYO          IGFMDHSYCVDNGAMIAYTGYIEYLNS-----KNKNNFNFDNISIHQRYRTDDVYVTWR-
Q8IJ99_PLAF7          IGFMDHSYCVDNGAMIAYTGYLEYLHA-----KNKDIYNFNNITIHQRYRTDDVFVTWK-
B3L268_PLAKH          IGFMDHSYCVDNGAMIAYTGYLEYLNS-----KNREIYNFNNISIHQRYRTDDVLVTWR-
A5KDZ1_PLAVS          IGFMDHSYCVDNGAMIAYTGYLEFANT-----KNREIYGFDNISIHQRYRTDDVLVTWR-
KAE1_AERPE            YRPVDVRLSGDNGVMIALTGLAAYLHGVII--------DPGEAYIRQRWRIDEVDIPWYP
KAE1_HYPBU            ADWPPPQLAGDNGAMIAWTGLLNYLAGITV--------DVEESVVKQRWRLDVVEIPWR-
KAE1_STAMF            YAGTPPEYSGDNGAMIAYTGLLGYLHNVIV--------EPRKAFVRQRWRLDEVELPWIQ
KAE1_SACS2            IKIVPPEFAGDNGAMIAYAGMLAASKGVFI--------DVDKSYIRPRWRVDEVDIPWRN
KAE1_THEPD            LGVVPPEYAGDNGAMIAYTGALAFSHGVRV--------PVEESRIQPYWRVDEVVIPWRS
KAE1_PYRAE            VKIVPDEYAGDNGAMIALTGYYAYRRGIRT--------TPEESFVKQRWRLDSVDIPWFY
KAE1_PYRAR            VKVVPDEYAGDNGAMIALTGYYAYKRGVYT--------TPEESFVRQRWRLDAVDVPWFW
A9A4X5_NITMS          FFVVPLKYAGDCGSQICWTGLLESQIKKGV--------SLKDTFVTQSWRLDTVKVNY--
KAE1_NANEQ            FYRLPCQYLTDNGAMIAYLGYYWYSQGIYY--------EPKP---RPYWRIWI-------
KAE1_METAR            FYAPPRKFFGDNGSMIAYTGLLQLKYDQTI--------PVEDSAVNPIYRTDEVEIPWL-
KAE1B_METAC           FYVPEKRFMGDNGTMIAYTGLLMYKSGNTL--------TLEDSRVNPNFRTDDVNVTWIK
KAE1B_METHJ           FSVPNPQYLGDNGAMIAYTGRVMLESGSVL--------PVEESRVNPSYRADQVLVTWRE
KAE1B_HALSA           FHAPEPRFLRDNAGMIAVLGAKMAAAGATI--------PVADSAINSQFRPDEVSVTWRD
KAE1_ARCFU            FYVPPKELAGDNGAMIAYTGLLMYKHGHQT--------PVEKSYVRPDFRIEDVEVNWD-
KAE1_PYRAB            FFVPPYDLCRDNGAMIAYTGLRMYKAGISF--------RLEETIVKQKFRTDEVEIVW--
KAE1_PYRFU            FFVPPYDLCRDNGAMIAYTGLRMYKAGIKF--------KLEETIVKQKFRTDEVEVVW--
KAE1_THEKO            FFVPPYDLCRDNGAMIAYTGLRMYRGGVRF--------KIEDTVVKQKFRTDEVEVVWD-
KAE1B_METTH           FHMPPPEYCGDNGAMIAWLGQLVYKYRGPD--------ALEDTTVVQRYRTDEVDVPWMR
KAE1B_METJA           FYVPPKEFCGDNGAMIAWLGLLMHKNGRWM--------SLDETKIIPNYRTDMVEVNWIK
KAE1_METKA            AYTVPPELAGDNGAMIAWTGILVHEHGLSIP----PDEIPEKAIVKQRYRVDEAPVPWAA
KAE1B_THEAC           SYLTDREYCMDNGIMIAQAALLMYKSGVRM------SVE--ETAVNPRFRIDEVDAPWIT
B1L6Z1_KORCO          LKVPPPDLARDNGAMIAWTAFLCYKYNILP------PDDPMGSNILPEWRADDLPWPLV-
                                * .  *   .                            :*          

KAE1_ASHGO            ----------------
KAE1_YEAST            ----------------
KAE1_CANAL            D---------------
KAE1_YARLI            ----------------
KAE1_EMENI            ----------------
KAE1_ASPFU            ----------------
KAE1_COCIM            D---------------
KAE1_PHANO            ----------------
KAE1_GIBZE            ----------------
KAE1_NEUCR            ----------------
KAE1_CRYNJ            ----------------
KAE1_SCHPO            ----------------
B8BU23_THAPS          KTKRKHA---------
OSGEP_BOVIN           ----------------
OSGEP_HUMAN           ----------------
OSGEP_MOUSE           ----------------
OSGEP_RAT             ----------------
OSGEP_NEMVE           ----------------
B5FXN3_TAEGU          ----------------
OSGEP_DICDI           ----------------
O49653_ARATH          KEAVLLGDKKVAAN--
OSGEP_DROME           D---------------
KAE1_ENCCU            Y---------------
A2D8I5_TRIVA          ----------------
A8BDD4_GIAIC          KWPLTQ----------
Q4N2Q3_THEPA          ----------------
Q4UA14_THEAN          ----------------
A7ATJ4_BABBO          ----------------
A0A509ALE1_PLABA      ----------------
Q7RS40_PLAYO          ----------------
Q8IJ99_PLAF7          ----------------
B3L268_PLAKH          ----------------
A5KDZ1_PLAVS          ----------------
KAE1_AERPE            WLPGDPPPG-------
KAE1_HYPBU            ----------------
KAE1_STAMF            D---------------
KAE1_SACS2            ----------------
KAE1_THEPD            R---------------
KAE1_PYRAE            DLCEEVVLNTSTKRRP
KAE1_PYRAR            DLCNR-----------
A9A4X5_NITMS          ----------------
KAE1_NANEQ            ----------------
KAE1_METAR            ----------------
KAE1B_METAC           E>--------------
KAE1B_METHJ           E>--------------
KAE1B_HALSA           >---------------
KAE1_ARCFU            ----------------
KAE1_PYRAB            ----------------
KAE1_PYRFU            ----------------
KAE1_THEKO            ----------------
KAE1B_METTH           E>--------------
KAE1B_METJA           E>--------------
KAE1_METKA            RPSRSADSQG------
KAE1B_THEAC           DAS>------------
B1L6Z1_KORCO          ----------------