CLUSTAL format seed alignment for MF_01451

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ADDA_LEUMM      -----------------------------------MATKFTKNQQRAIEE-KGHNILVAA
ADDA_OENOB      -------------------------------------MNFSKNQRAVIAHIPDHNLLVAA
ADDA_DESHD      -----------------------------------MNNPKWTPAQQAAIDLKG-QLLVAA
ADDA_LACP7      -----------------------------------MAKTSWTPGQQKVIDTRDCNLLVSA
ADDA_BACAH      ---------------------------MIENWPKKPEGSQWTDDQWKAVVANGRDILVAA
ADDA_BACAN      ---------------------------MMENWPKKPEGSQWTDDQWKAVVATGRDILVAA
ADDA_BACC7      ---------------------------MIENWPKKPEGSQWTDDQWKAVVANGRDILVAA
ADDA_BACC4      ---------------------------MIENWPKKPEGSQWTDDQWKAVVANGRDILVAA
ADDA_BACMK      ---------------------------MIENWPQKPEGSQWTDDQWKAVVANGRDILVAA
ADDA_BACCN      --------------------------MMVENWPAKPEGSQWTDDQWKAVVAHGRDILVAA
ADDA_BACSU      ------------------------------MNIPKPADSTWTDDQWNAIVSTGQDILVAA
ADDA_BACLD      ------------------------------MEISKPKGSTWTDDQWKAIVSSGRDILVAA
ADDA_BACP2      ------------------------------MQIPKPNNSTWTDDQWEAIVSEGQDILVAA
ADDA_GEOTN      ---------------------------MNATFRPKPAGSRWTDEQWKAIAAGGRDILVAA
ADDA_LISMH      ---------------------------MSLNIPPKPEESLWTDDQWKAIQAKGNNVLVAA
ADDA_LISMO      ---------------------------MSLNIPPKPEESLWTDDQWKAIQAKGNNVLVAA
ADDA_LISMF      ---------------------------MGLNIPPKPESSLWTDDQWKAIQAEGNNVLVAA
ADDA_LISW6      ---------------------------MGLNIPEKPVNTLWTDDQWKAIQANGNNILVAA
ADDA_ANOFW      ------------------------------MIPPKPRESQWTDEQWQAIYATGQHTLVAA
ADDA_OCEIH      -------------------------------------MVNWTKEQEEAIYTSGSDILVAA
ADDA_PELTS      ------------------MEQTGPDVPERVGAMSG----GWTAEQLEAISARGGDVLVAA
ADDA_DESAP      -------------------------------MSSR----NWTGPQEAAIGCREKNLLVAA
ADDA_HELMI      -------------MNREALCHDDPIGHDRLRPDSIPRDPKWTDEQWQAITARNSDILVAA
ADDA_THEP3      ------------------------------------MGTKWTEEQKQAITTRGSNLLVAA
ADDA_THEPX      ------------------------------------MGTKWTEEQKQAITTRGSNLLVAA
ADDA_CALS4      ------------------------------------MEVKWTEEQREAITTRGKNVLVAA
ADDA_CLOBH      -----------------------------------MSGTKWTDEQRQAIFTKDCNLLVAA
ADDA_CLOB1      -----------------------------------MSGTKWTDEQRQAIFTKDCNLLVAA
ADDA_CLOBL      -----------------------------------MSGTKWTDEQRQAIFTKNCNLLVVA
ADDA_CLOBM      -----------------------------------MSSTKWTDEQRQAVFTKNCNLLVAA
ADDA_CLONN      -----------------------------------MGEVKWTKEQQQAIDVHGCNLLVSA
ADDA_CLOD6      -----------------------------------MSSPKWTKEQLEVIESRECNLLVAA
ADDA_CLOB8      -----------------------------------MGNTKWTDEQLSAIETRNCNLLVAA
ADDA_CLOBB      -----------------------------------MSGTKWTEEQLSAITTRDCNLLVAA
ADDA_CLOPE      ------------------------------------MGTKWTEEQELAINTRKCNLLVAA
ADDA_CLOPS      ------------------------------------MGTKWTEEQELAINTRKCNLLVAA
ADDA_ACET2      ----------------------------------MSERTKWTDEQWEAITGNEKSLLVSA
ADDA_RUMCH      -----------------------------------MSETKWTKEQYAAITQKDCNLLVAA
ADDA_ALKOO      -------------------------------------MRQWTKEQQAAIDARGSNLLVAA
ADDA_ALKMQ      -------------------------------------MKNWTTEQQAAIDARGSNLLISA
ADDA_SYNWW      -------------------------------------MAHWTIEQEEAINARNSNLLVAA
ADDA_STAEQ      ------------------------------MIPTKPHDVIWTDAQWQSIYAKGQDILVAA
ADDA_STAES      ------------------------MKVVKDMIPTKPHDVIWTDAQWQSIYAKGQDILVAA
ADDA_STAAN      -----------------------------MTIPEKPQGVIWTDAQWQSIYATGQDVLVAA
ADDA_STAA8      -----------------------------MTIPEKPQGVIWTDAQWQSIYATGQDVLVAA
ADDA_STAAB      -----------------------------MTIPEKPQGVIWTDAQWQSIYATGQDVLVAA
ADDA_STAS1      ---------------------------MMNAIPVKPTGTRWTDNQWKSIYAKGQDILVAA
ADDA_STAHJ      ----------------------------MNNIPIKPKDAQWTDAQWKSIYANGQDVLVAA
ADDA_LEVBA      ----------------------------------MSTKFSFTPSQDQAIHQTGNNLLVSA
ADDA_LACPL      ----------------------------------MSEGTNYTPSQQAVIAQQGNNLLVSA
ADDA_LACS1      ----------------------------------MANGFKFTPAQQKAIEDTGKNILVAA
ADDA_PEDPA      -----------------------------------MADREYTLSQKQAINSSGHNILVSA
ADDA_ENTFA      ---------------------------MSKTIPLRPANEQFTDSQWQAVFDGDENILVSA
ADDA_LACCB      -------------------------------------MTQFTTSQQAAITHDGHDVLVSA
ADDA_LACH4      -------------------------------------MPQFTKEQEKAINDRGHDILVSA
ADDA_LACAC      -------------------------------------MPQFTKEQQQAIDDRGHDILVSA
ADDA_LACJO      -------------------------------------MTKFTKEQNQAINDYGKDILVSA
ADDA_LACDA      ------------------------------------MAVKYTPDQARAIESRGQDLLVSA
ADDA_LACDB      ------------------------------------MAVKYTPDQARAIESRGQDLLVSA
ADDA_STRMU      -------------MTFKPFLTDQEIASLQIQEAQSDKKQKRTPEQIEAIYTSGTNILVSA
ADDA_STRA3      -------------MTFKPFLNPEDIAVIQTEEKNSDKKQKRTPEQIEAIYTFGNNVLVSA
ADDA_STRP3      MLFNINEKGEPLVISFAPFLSPEAIKHLQENERYSDQSQKRTAQQIEAIYTSGQNILVSA
ADDA_STRPF      MLFNINEKGEPLVISFAPFLSPEAIKHLQENERCSDQSQKRTAQQIEAIYTSGQNILVSA
ADDA_STRPM      MLFNINEKGEPLVISFAPFLSPEAIKHLQENERCSDQSQKRTAQQIEAIYTSGQNILVSA
ADDA_STRP8      MLFNINEKGEPLVISFAPFLSPEAIKYLQENERCSDQSQKRTAQQIEAIYTSGQNILVSA
ADDA_STRP1      MLFNINEKGEPLVISFAPFLSPEAIKHLQENERCRDQSQKRTAQQIEAIYTSGQNILVSA
ADDA_STRPZ      MLFNINEKGEPLVISFAPFLSPEAIKHLQENERCSDQSQKRTAQQIEAIYTSGQNILVSA
ADDA_STRS7      --MRIDEG----------FLTPEAIARLQQEEALSDKTHKRTAQQIEAIYSSGQNILVSA
ADDA_STRU0      -------------MRFEPFLNQEEIRQLQEFEKNGSKAQKRTPEQIEAIYTNGQNILVSA
ADDA_STRT2      -------------MLTKAFLSPAEIEERIAQEAASDKDRKLTPEQIEAIYSNGTNILVSA
ADDA_STRSY      --MDGTNERRSGLMAFEQFLSAEEIKAVQLAEAHSDKQQKRTAEQIEAIYTHGQNVLVSA
ADDA_STRPI      -------------MKLIPFLSEEEIQKLQEAEANSSKEQKKTAEQIEAIYTSGQNILVSA
ADDA_STRR6      -------------MKLIPFLSEEEIQKLQEAEANSSKEQKKTAEQIEAIYTSAQNILVSA
ADDA_STRP4      -------------MKLIPFLSEEEIQKLQEAEANSSKEQKKTAEQIEAIYTSGQNILVSA
ADDA_STRSV      -------------MKRIPFLTAEEIALKQAQEAASDKPQKKTAEQIEAIYSSGRNILVSA
ADDA_LACLS      -----------------------------------MSEVKLTPEQNEAIHSSGKNILVSA
ADDA_LACLA      -----------------------------------MSEVKLTPEQNEAIHSSGKNILVSA
ADDA_CARHZ      -------------------------------------MKNWTAEQMRAITSRGNALLVSA
ADDA_LACF3      ------------------------------------MVFTPSKEQEPAINDRQKDILVSA
                                                         .  :           *: *

ADDA_LEUMM      SAGSGKTTVLIERLIQKILSGV----------SVEKFLIVTFTNAAAKEMRERLEVAIEK
ADDA_OENOB      SAGSGKTTVLIEHVYQQLLSGK----------SIDRFLISTFTDAAALEMKNRLEKRIRA
ADDA_DESHD      AAGSGKTAVLVQRLFKQITDVDEQ-------VDVDRFLVVTFTKAAAAEMRERIGKALDE
ADDA_LACP7      AAGSGKTAVLVERIINRITSENSP-------INIDQLLIVTFTKAAAGEMRERIGAAIEK
ADDA_BACAH      AAGSGKTAVLVERIIKKIINEENP-------VDVDRLLVVTFTNAAAQEMKNRIGEALEK
ADDA_BACAN      AAGSGKTAVLVERIIKKIINEENP-------VDVDRLLVVTFTNAAAQEMKNRIGEALEK
ADDA_BACC7      AAGSGKTAVLVERIIKKIINEENP-------VDVDRLLVVTFTNAAAQEMKNRIGEALEK
ADDA_BACC4      AAGSGKTAVLVERIIKKIINEENP-------VDVDRLLVVTFTNAAAQEMKNRIGEALEK
ADDA_BACMK      AAGSGKTAVLVERIIKKIIREENP-------VDVDRLLVVTFTNAAAQEMKNRIGEALEK
ADDA_BACCN      AAGSGKTAVLVERIIKKIINEENP-------VDVDRLLVVTFTNAAAQEMKNRIGEALEK
ADDA_BACSU      AAGSGKTAVLVERMIRKITAEENP-------IDVDRLLVVTFTNASAAEMKHRIAEALEK
ADDA_BACLD      AAGSGKTAVLVERIIRKITDQERP-------VDVDRLLVVTFTNASAAEMKHRIGEALEK
ADDA_BACP2      AAGSGKTAVLVERLIRKMTRPEHP-------VDVDRLLVVTFTNASAAEMKHRITEALEK
ADDA_GEOTN      AAGSGKTAVLVERIIQKVTAEEGA-------VDIDRLLVVTFTNAAAAEMKARIGEALER
ADDA_LISMH      AAGSGKTAVLVTRIIKKLIDESAN-------LNVDELLIVTFTNASAAEMKFRIGKGLEE
ADDA_LISMO      AAGSGKTAVLVTRIIEKLIDESAN-------LNVDELLIVTFTNASAAEMKFRIGKGLEE
ADDA_LISMF      AAGSGKTAVLVTRIIEKLINESAN-------LNVDELLIVTFTNASAAEMKFRIGKGLEE
ADDA_LISW6      AAGSGKTAVLVTRIIEKLVDETGN-------LNVDELLIVTFTNASAAEMKYRIGKSLEE
ADDA_ANOFW      AAGSGKTAVLVERIIQKILHKERP-------IDVDRLLVVTFTNAAAAEMRQRIGEALER
ADDA_OCEIH      AAGSGKTAVLVERIIQKLLAEHNP-------TNIDALLVVTFTNAAAQEMRNRVGAALEQ
ADDA_PELTS      SAGTGKTAVLAERIIRRITDPIKP-------VDVDRLLVVTFTSAAAAEMRERIRLALAR
ADDA_DESAP      GAGSGKTAVLVERVIRRISDPAAP-------VDVDRLLVVTFTNAAAAEMRKRVAEALER
ADDA_HELMI      AAGAGKTAVLVERLIGIIKEG----------VDVDRLLVVTFTNAAAAEMRERIRTALTK
ADDA_THEP3      AAGSGKTAVLVERIINLITDEENP-------VDIDRLLVVTFTNAAASEMRERIAEALIA
ADDA_THEPX      AAGSGKTAVLVERIINLITDEENP-------VDIDRLLVVTFTNAAASEMRERIAEALIA
ADDA_CALS4      AAGSGKTAVLVERIINIVTDPEKP-------VDIDRLLVVTFTNAAASEMRERIAERLIS
ADDA_CLOBH      GAGAGKTAVLVQRIIEKILDKGEP-------IDIDKLLVVTFTNAAAAEMRERIGDAISK
ADDA_CLOB1      GAGAGKTAVLVQRIIEKILDKGEP-------IDIDKLLVVTFTNAAAAEMRERIGDAISK
ADDA_CLOBL      GAGAGKTAVLVQRIIEKILDKEEP-------IDIDKLLVVTFTNAAAAEMRERIGDAISK
ADDA_CLOBM      GAGAGKTAVLVQRIIEKILDKEEP-------IDIDKLLVVTFTNAAAAEMRERIGDAISK
ADDA_CLONN      AAGSGKTAVLVERIIKMITDIKNP-------VDIDRLLVVTFTNAAASEMKERIGKAIGK
ADDA_CLOD6      AAGSGKTAVLVERIIQMITSRENP-------IDIDKLLVVTFTNAAASEMRERIGDAIGK
ADDA_CLOB8      AAGSGKTAVLVERIIRIITNEENP-------VDIDKLLVVTFTNAAAAEMRERIADAISK
ADDA_CLOBB      AAGSGKTAVLVERIIKIITNEENP-------IDIDKLLVVTFTSAAAAEMRERIANAISK
ADDA_CLOPE      AAGSGKTAVLVERIIKMITEGENP-------VDIDKLLVVTFTNAAASEMRERIGDAISK
ADDA_CLOPS      AAGSGKTAVLVERIIKMITEGENP-------VDIDKLLVVTFTNAAASEMRERIGDAISK
ADDA_ACET2      AAGAGKTAVLVERIIRKITDEENP-------VDIDRLLVVTFTNAAATEMRERIAQAISE
ADDA_RUMCH      AAGAGKTAVLVERIIRKITDKENP-------VDIDSLLVVTFTNAAATEMRERIGAAISD
ADDA_ALKOO      AAGSGKTAVLVERIIQIIL--KDR-------IDIDRLLIVTFTNAAAGEMRERIAGAIMT
ADDA_ALKMQ      AAGSGKTAVLVERIIQIIL--KDK-------IDIDRLLIVTFTNAAAGEMRERIAGAIME
ADDA_SYNWW      AAGSGKTTVLVERIIQLVL--RDR-------IDIDRLLIVTFTQAAAGEMRERINAAFFK
ADDA_STAEQ      AAGSGKTAVLVERIIQRIL--RDD-------VDVDRLLVVTFTNLSAREMKHRVDKRIQE
ADDA_STAES      AAGSGKTAVLVERIIQRIL--RDD-------VDVDRLLVVTFTNLSAREMKHRVDKRIQE
ADDA_STAAN      AAGSGKTAVLVERIIQKIL--RDG-------IDVDRLLVVTFTNLSAREMKHRVDQRIQE
ADDA_STAA8      AAGSGKTAVLVERIIQKIL--RDG-------IDVDRLLVVTFTNLSAREMKHRVDQRIQE
ADDA_STAAB      AAGSGKTAVLVERIIQKIL--RDG-------IDVDRLLVVTFTNLSAREMKHRVDQRIQE
ADDA_STAS1      AAGSGKTAVLVERIIQRII--RDE-------IDVDKLLVVTFTNASAREMKQRVDQRIQE
ADDA_STAHJ      AAGSGKTAVLVERIIQKII--RDE-------IDVDKLLVVTFTNLSAREMKHRVDQRIQQ
ADDA_LEVBA      SAGSGKTRVLVQRVIERLKTG----------VGIDQILIVTFTKAAAAEMRERIQTALRQ
ADDA_LACPL      SAGSGKTTVLIERIMRKILAG----------TNIDQLLVVTFTNLAAKHMKQKLESQINK
ADDA_LACS1      SAGSGKTRVLVERVINKIKQG----------VSIDELLVVTFTEAAAKEMKERIQIALRK
ADDA_PEDPA      SAGSGKTSVLVERVIQKIING----------EDVDRLLVVTFTEAAASEMKERIRAAIVK
ADDA_ENTFA      SAGSGKTTVLVRRVIEKVKSG----------VDIDRLLIVTYTEAAAREMKERIQVALQK
ADDA_LACCB      SAGSGKTTVLVERIIQKILKQH---------ADITRMLIVTFTRAATAEMRTKIQTALKK
ADDA_LACH4      SAGSGKTTVLVERVLKEILAGT----------QVDELLVVTFTKAAAEEMKTRIKAALTK
ADDA_LACAC      SAGSGKTTVLVERVLKEIISGT----------QVSELLVVTFTKAAAEEMKTRIKTALTK
ADDA_LACJO      SAGSGKTTVLVERVLKRILSGT----------PVSSLLIITFTKAAAREMKERIKQKISD
ADDA_LACDA      SAGSGKTSVLVERVIREIMDDH---------LEVNQLLVITFTRAAASEMKQRIKQRLQD
ADDA_LACDB      SAGSGKTSVLVERVIREIMDDH---------LEVNQLLVITFTRAAASEMKQRIKQRLQD
ADDA_STRMU      SAGSGKTFVMIERIMDKILRG----------VTIDQLFISTFTVKAAGELKERLEKKITE
ADDA_STRA3      SAGSGKTFVMVERILDKLLRG----------VPIDSLFISTFTVKAAGELKERLEKKINE
ADDA_STRP3      SAGSGKTFVMVERILDKILRG----------VSIDRLFISTFTVKAATELRERIENKLYS
ADDA_STRPF      SAGSGKTFVMVERILDKILRG----------VSIDRLFISTFTVKAATELRERIENKLYS
ADDA_STRPM      SAGSGKTFVMVERILDKILRG----------VSIDRLFISTFTVKAATELRERIENKLYS
ADDA_STRP8      SAGSGKTFVMVERILDKILRG----------VSIDRLFISTFTVKAATELRERIENKLYS
ADDA_STRP1      SAGSGKTFVMVERILDKILRG----------VSIDRLFISTFTVKAATELRERIENKLYS
ADDA_STRPZ      SAGSGKTFVMVERILDKILRG----------VSIDRLFISTFTVKAATELRERIENKLYS
ADDA_STRS7      SAGSGKTFVMVERILDKILRG----------IPVDRLFISTFTVKAATELIERIEKKLHT
ADDA_STRU0      SAGSGKTFVMVERIIDKVLRG----------ISIENMFISTFTVKAANELKERLEKKLRE
ADDA_STRT2      SAGSGKTFVMVERILDMIGRG----------VGIDQLFISTFTVKAAGELKERLEKRLTK
ADDA_STRSY      SAGSGKTFVMVQRILDKLKRG----------IGIDQLFISTFTVKAAGELKERIEKKLNE
ADDA_STRPI      SAGSGKTFVMAERILDQLARG----------VEISQLFISTFTVKAANELKERLEKKISK
ADDA_STRR6      SAGSGKTFVMAERILDQLARG----------VEISQLFISTFTVKAATELKERLEKKISK
ADDA_STRP4      SAGSGKTFVMVERILDQLARG----------VEISQLFISTFTVKAATELKERLEKKISK
ADDA_STRSV      SAGSGKTFVMVQRIIDQILRG----------VAVSQLFISTFTVKAAGELKERLEKELGQ
ADDA_LACLS      SAGSGKTFVMAQRIVEKVKQG----------IEIDRLFISTFTKKAASELRMRLERDLKK
ADDA_LACLA      SAGSGKTFVMAQRIVEKVKQG----------IEIDRLFISTFTKKAASELRMRLERDLKK
ADDA_CARHZ      AAGAGKTSVLVERVLSRVLTDTPP-------VDIDRLLVVTFTEAAAGEMKERLGTELLK
ADDA_LACF3      SAGSGKTAVLVERVIQLMETGLSKDAKPSERPNIDDILMVTFTTDAAKNMRDRIRRRLVG
                .**:*** *:  ::   :               :  ::: *:*  :: .:  ::   :  

ADDA_LEUMM      RLKVADES---------QKRFLQEQLLILPAANISTIDAYALRIIEMYYHIIGLDPQFRL
ADDA_OENOB      GITEEEGQ---------LKRHLQEQLLLLNSAAIGTLDSFSLRIIERYYSVIGLDPRYRM
ADDA_DESHD      ALFGAAEPAQ--------VEHLLQQRALLYRASITTLHSFCMELIRQYFYLIELDPAFRV
ADDA_LACP7      KVLEQPDN-----------VHLQKQLTLLYSAQITTIDSFCLSVIRNHFHTIDLDPSFRI
ADDA_BACAH      VLIDEPG-----------SQHVRKQLSLLNKASISTIHSFCLQVIRGYYYMLDVDPRFRI
ADDA_BACAN      VLIDEPG-----------SQHVRKQLSLLNKASISTIHSFCLQVIRGYYYMLDVDPRFRI
ADDA_BACC7      VLIDEPG-----------SQHIRKQLSLLNKASISTIHSFCLQVIRGYYYMLDVDPRFRI
ADDA_BACC4      VLIDEPG-----------SQHVRKQLSLLNKASISTIHSFCLQVIRGYYYMLDVDPRFRI
ADDA_BACMK      VLIDGPG-----------SQHIRKQLSLLNKASISTIHSFCLQVIRGYYYMLDVDPRFRI
ADDA_BACCN      VLIEEPS-----------SRHIRKQLSLLNKASISTIHSFCLQVIRSYYYMLDIDPRFRI
ADDA_BACSU      ELVQRPG-----------SLHIRRQLSLLNRASISTLHSFCLQVLKKYYYLIDLDPGFRI
ADDA_BACLD      ELAENPG-----------SLHLRRQLALLNKASISTLHSFCLQVIRKYYYLIDVDPAFRI
ADDA_BACP2      ELAKNPG-----------SLHMRRQLSLMNRANISTLHSFCLQVLRTFYYEIDLDPGFRL
ADDA_GEOTN      ELANRPH-----------SLHLRRQLSLLNRASISTLHSFCLDVIRKYYYLLDLDPSFRI
ADDA_LISMH      ALGQNPD-----------SAHLKRQVALLNYASISTLHSFCLEIIRKYYFEADIDPSFRL
ADDA_LISMO      ALGQNPD-----------SAHLKRQVALLNYASISTLHSFCLEIIRKYYFEADIDPSFRL
ADDA_LISMF      ALAQNPD-----------STHLKRQVALLNYASISTLHSFCLEIIRKYYFDADIDPNFRL
ADDA_LISW6      ALSQNPD-----------SSHLKKQVALLNYASISTLHSFCLEIIRKHYFEADIDPNFRL
ADDA_ANOFW      ALEKEPH-----------SLHLRRQLSLLQKASISTIHSFCLDVIRKYYYVIGIDPVFRI
ADDA_OCEIH      ALAANPS-----------SIHLKKQLSLLQRASISTLHSFCLDIVKKNAYILDIDPSFRI
ADDA_PELTS      EISRRPE-----------SGHLQRQAALLGRACISTVHSFCLDLLRQHFYRIGLDPSFRV
ADDA_DESAP      ELEKHPG-----------MPLLEHQLRLLPQADITTIHSFCAELLRRYHYLIDLDPEFRV
ADDA_HELMI      ELARHPH-----------QTWLRQQLVLLNRATITTLHSFCLDLVRKYYYRLDLDPAFRV
ADDA_THEP3      ILDQNPE-----------DKRLANQLTLLNKATITTIHSFCLEVVRNNFFLLDLDPNFRI
ADDA_THEPX      ILDQNPE-----------DKRLANQLTLLNKATITTIHSFCLEVVRNNFFLLDLDPNFRI
ADDA_CALS4      LLDQHPE-----------DKRLADQLTLLNKATITTIHSFCLDVVRKHFFLLDLDPSFRV
ADDA_CLOBH      GLDEDPE-----------SKVLRKQLTLLNKSNIMTIHSFCLQVIKNNFHTMEIDPNFRI
ADDA_CLOB1      GLDEDPE-----------SKVLRKQLTLLNKSNIMTIHSFCLQVIKNNFHTMEIDPNFRI
ADDA_CLOBL      GLDEDPE-----------SKVLRKQLTLLNKSNIMTIHSFCLQVIKNNFHTMEIDPNFRI
ADDA_CLOBM      GLDENPE-----------SKALRKQLTLLNKSNIMTIHSFCLQIIKNNFHTIEIDPNFRI
ADDA_CLONN      ELTKHPK-----------SKQLQRQLTLLNRASITTIHSFCLETIRNNFHYIDLDPNFRI
ADDA_CLOD6      ALDENPE-----------NKHLQNQLVLLNKSSITTIHSFCLDVIKSNFHRINLDPNFRI
ADDA_CLOB8      ELENNPR-----------SKNLQRQLTLLNRANITTMHSFCLDVIKNNYHRIDLDPSFRI
ADDA_CLOBB      KLDETPT-----------SKNLQKQLTLLNRSNIMTIHSFCLGVIKNNFHKIDLDPSFRI
ADDA_CLOPE      ALEKDPS-----------SKVLQRQLALLNRASITTMHSFCLEVIKNNFHLIDLDPGFRI
ADDA_CLOPS      ALEKDPS-----------SEVLQRQLALLNRASITTMHSFCLEVIKNNFHLIDLDPGFRI
ADDA_ACET2      KLEENPG-----------SANIQRQLTLLGKACITTIHSFCLEVIRSNFQQINIDPGFRI
ADDA_RUMCH      TIEKNQG-----------SKNISRQLILLNKASITTIHSFCLEVIRSNFQSIEIDPGFKI
ADDA_ALKOO      EMEKKTGG----------EEHLRRQLSLLNRASITTVHSFCIDVVRRHFHMIDVDPGFRI
ADDA_ALKMQ      EMERKTEQ----------EAHLRRQINLLNRASITTIHSFCIDVVRRHFHIIDVDPGFRI
ADDA_SYNWW      ELEKGRE-----------DGHLRRQLYLLNRSSISTIHAFCSDVVRQHFHLVNIDPHFRI
ADDA_STAEQ      ASFKDPN-----------NEHLKNQRIKIHQAQISTLHSFCLKLIQQHYDVLDIDPHFRT
ADDA_STAES      ASFKDPN-----------NEHLKNQRIKIHQAQISTLHSFCLKLIQQHYDVLDIDPHFRT
ADDA_STAAN      ASIADPA-----------NAHLKNQRIKIHQAQISTLHSFCLKLIQQHYDVLNIDPNFRT
ADDA_STAA8      ASIADPA-----------NAHLKNQRIKIHQAQISTLHSFCLKLIQQHYDVLNIDPNFRT
ADDA_STAAB      ASIADPA-----------NAHLKNQRIKIHQAQISTLHSFCLKLIQQHYDVLNIDPNFRT
ADDA_STAS1      ASIENPD-----------NAHLKNQRVKIHQAQISTLHSFCLKLIQQHYDVLDIDPNFRT
ADDA_STAHJ      ASIEDPR-----------NEHLKNQRIKIHQAQISTLHSFCLKIIQQHYDVIDLDPNFRT
ADDA_LEVBA      ELAVSQGD-------SAQQQFYLRQLNQLPVADISTLDAFCLRLLQRYYYVIDLDPVFRL
ADDA_LACPL      RISQLMTDNPAQTTASPAIRQLRQQLNLLGVANISTLDAFCLRVIQRYYYVIDLDPVFRL
ADDA_LACS1      ELSTADSE--------EEKRRYLTQLSKLNVANISTLHAFCLQIIKQYYYVINLDPMFRM
ADDA_PEDPA      KINEVSDI--------ELQNHFSMQLNKLNNANISTLHAFCMSIIRNYYYIIDLDPTFRI
ADDA_ENTFA      AMNEEQDP--------ERRRHFSRQIALLPTANISTLHAFCLTVIRRFYYLIDIDPVFRM
ADDA_LACCB      ALTERRHELS-----GEDRRHLANQIAMVNAAKISTLDAFSLQIVQTYYYVIDLDPGFRL
ADDA_LACH4      EMAKPG----------VDYRYLREQLNQIDTANISTIDAFCLDVIHRFYYSIELDPSFTI
ADDA_LACAC      ELAKPG----------VNRKYLREQLNQVDTANISTIDAFCLEVIRRFYYSVNLNPSFKI
ADDA_LACJO      QIEKE-----------PNNQFLRSQLLDVDTANISTIDSFCLDVIRRFYYVIDLDPQFSV
ADDA_LACDA      RLQEETDA--------SQADFLRRQLAEIDTAIISTIDSFCLDVIRRFYFAIDIDPDFSI
ADDA_LACDB      RLQEETDA--------SQADFLRRQLAEIDTAIISTIDSFCLDVIRRFYFAIDIDPDFSI
ADDA_STRMU      QLRLTNDTAL--------KQFLSEQLLGLQTADIGTMDAFTQKLVTQYGYTLGISPNFRI
ADDA_STRA3      SLKSAESDDL--------KQFLTQQLVGIQTADIGTMDAFTQKIVNQYGYTLGISPIFRI
ADDA_STRP3      QIAQTTDFQM--------KVYLTEQLQSLCQADIGTMDAFAQKVVSRYGYSIGISSQFRI
ADDA_STRPF      QIAQTTDFQM--------KVYLTEQLQSLCQADIGTMDAFAQKVVSRYGYSIGISSQFRI
ADDA_STRPM      QIAQTTDFQM--------KVYLTEQLQSLGQADIGTMDAFAQKVVSRYGYSIGISSQFRI
ADDA_STRP8      QIAQTTDFQM--------KVYLTEQLQSLCQADIGTMDAFAQKVVSRYGYSIGISSQFRI
ADDA_STRP1      QIAQTTDFQM--------KVYLTEQLQSLCQADIGTMDAFAQKVVSRYGYSIGISSQFRI
ADDA_STRPZ      QIAQTTDFQM--------KVYLTEQLQSLCQADIGTMDAFAQKVVSRYGYSIGISSQFRI
ADDA_STRS7      AIAETQDYQL--------KAYLNDQLQALSQADIGTMDAFAQKLVHQHGYVLGISPHFRI
ADDA_STRU0      GILMTDDPEM--------KAYLNDQMQAIALADIGTMDAFTQKLLNEHGYLLGIPPKFRI
ADDA_STRT2      HLGQAETDEE--------RAFLSDQIAKIGTADIGTMDAFTQKLVNQYGYLLGVSPTFRI
ADDA_STRSY      TIAETTDMEL--------RRHLSAQLADLTKADIGTMDSFTQKLVTTYGYSLGISPQFRI
ADDA_STRPI      KIQETDDVDL--------KQHLGRQLADLPNAAIGTMDSFTQKFLGKHGYLLDIAPNFRI
ADDA_STRR6      KIQETDDVDL--------KQHLGRQLADLPNAAIGTMDSFTQKFLGKHGYLLDIAPNFRI
ADDA_STRP4      KIQETDDVDL--------KQHLGRQLADLPNAAIGTMDSFTQKFLGKHGYLLDIAPNFRI
ADDA_STRSV      ALKEAESPEL--------KQHLAQQLADLPNADIGTMDSFTQKVLSRYGYLLGLAPNFRI
ADDA_LACLS      ARQESSDDEE--------AHRLTLALHNLSNADIGTMDSFTQKLTKANFNRVNIDPNFRI
ADDA_LACLA      ARQESSDENQ--------ACRLTLALQNLSNADIGTMDSFTQKLTKTNFNRVNIDPNFRI
ADDA_CARHZ      RLNEDPG-----------NSRILEQLELLPVADISTLHSFCHKIIRKYGRVCGYETKFAI
ADDA_LACF3      A----------------TDEHMKAQVARLALANISTIHSFCEQLIKRYYYVIDLDPQFRL
                                            :  : * *:.::               . :  

ADDA_LEUMM      LSDTAERKLLQQDVLTDVLADFYDENNI------HHEQFLTLVNNFGNPNQD-DQLQKII
ADDA_OENOB      LADQTEKNLLVKDVLDDTFDEMY-----------HDEKFLRLLNNFSSASHD-QDLKNLV
ADDA_DESHD      A-DEAEADLLRQDTLEDLFEAYYGEET---------PAFQSLVDAFGTDRDD-QPLMASI
ADDA_LACP7      A-EEAELMLLKSDVLATLLEEKYEEGA---------EDFLEFVECYSASKSD-EPIENFI
ADDA_BACAH      A-NQTENELLKEEVLDDILEEEYGIED--------NTIFFELVDRYTSDRSD-DDLQRMI
ADDA_BACAN      A-NQTENELLKEEVLDDILEEEYGIED--------NTIFFELVDRYTSDRSD-DDLQRMI
ADDA_BACC7      A-NQTENELLKEEVLDDILEEEYGIED--------NTIFFELVDRYTSDRSD-DDLQRMI
ADDA_BACC4      A-NQTENELLKEEVLDDILEEEYGIED--------NTIFFELVDRYTSDRSD-DDLQRMI
ADDA_BACMK      A-NQTENELLKEEVLDDILEEEYGIED--------NSIFFELVDRYTSDRSD-DDLQRMI
ADDA_BACCN      A-NQTENELLKEEVLDDILEEEYGMEE--------NQLFFELVDRYTSDRND-DDLQRMI
ADDA_BACSU      A-DQTEGELIGDEVLDELFEDEYAKG---------EKAFFELVDRYTTDRHD-LDLQFLV
ADDA_BACLD      A-DQTEGELLGDEVLDELFEEEYKKG---------NPAFFELVDRYTTDRHD-LDLQHLV
ADDA_BACP2      A-DQTEGELLGDEVLDELFEDEYKAG---------KPSFFELVDRYTSDRHD-LDLQWLV
ADDA_GEOTN      A-DETEIELLKEDVLEELLEEEYGKAD--------NERFFAVVDAYTGDRSD-AELQEMI
ADDA_LISMH      I-EPIESSMIRDEVLEGLLEQEYGIEN--------NEAFFHLVESFTGDRSD-AELHSLI
ADDA_LISMO      I-EPIESSMIRDEVLEGLLEQEYGIEN--------NEAFFHLVESFTGDRSD-AELHSLI
ADDA_LISMF      I-EPIESSMIRDEVLENLLEQEYSIEN--------NEPFFHLVESFTGDRSD-AELHALI
ADDA_LISW6      I-EPIESSMIRDEVLEELLEKEYSIAN--------NEAFFHLVESFTGDRTD-AELHMLI
ADDA_ANOFW      A-DEGEMALLKEEVLETLFEQYYAEN---------DEPFLTVVDRYTSDRTD-ADLQTLI
ADDA_OCEIH      A-DDMEMDLLKQEVLDDLLEEWYGDSNP------NQDSFFEVVNRFTSDRSD-AEMEELI
ADDA_PELTS      A-DETEAALIQTGALEEVFERRYA---------AEDNIFAALVDCYGGRHDD-ALLQELV
ADDA_DESAP      A-DETEAAILRQETLEEFFEEQYRVI-------TGDPDLEFLVEAYGGERDD-LKLQNLV
ADDA_HELMI      A-DETEIALLRQDVLDEVFERFYERAGAKEGTESKGEYFTALVDAYGGDRDD-SPLQDIV
ADDA_THEP3      G-DDTETLLLQLEASEELFEEMYAKEDK------DKEGFLTLVESYGGTKDD-QDLQDIL
ADDA_THEPX      G-DDTETLLLQLEASEELFEEMYAKEDK------DKEGFLTLVESYGGTKDD-QDLQDIL
ADDA_CALS4      G-DDTETLLLKLEAMEELFEELYEKND---------EGFLLLVESYGGTKGD-QYLQDVL
ADDA_CLOBH      C-DETEGILMKQEAIDELFDELYEIEN---------EDFINLVESYASRKD--TRLQEVV
ADDA_CLOB1      C-DETEGILMKQEAIDELFDELYEIEN---------EDFINLVESYASRKD--TRLQEVV
ADDA_CLOBL      C-DETEGILMKQEAIDELFDELYEIEN---------EDFINLVESYASRKD--TRLQEVV
ADDA_CLOBM      C-DETEGILMKQEAMDELFDELYEIEN---------KDFINLVESYASRKD--TRLQEVV
ADDA_CLONN      G-DETETVLLKGEIIEGIFEDLYEPENC------T-QEFLNLVEFYSSNKDD-VALQNIV
ADDA_CLOD6      G-DQTECAILKQEAIEEVFEDLYEERD---------EGFLNLVESYAERGGD-KEVQDII
ADDA_CLOB8      G-DQTEGILIKSEVIEELFEDKYEEED---------IGFTNLVEIFSSYKND-NNLKNLV
ADDA_CLOBB      C-DQTEGILLKMEIIDELFDDKYDEEN---------QEFIKFIEAFSSYKSD-NALKELV
ADDA_CLOPE      G-DQTECELIKQDILADLFEDMYAKDD---------ECFKDLVEAYGGSKSD-DNLNSII
ADDA_CLOPS      G-DQTECELIKQDILADLFEDMYAKDD---------ECFKDLVEAYGGSKSD-DNLNSII
ADDA_ACET2      A-DETESRLMKLEALDEVFEEQYEN---------ENEDFFELLECYGGNRDD-RALQDMV
ADDA_RUMCH      L-DETEATLLKSETLSDLFEEIYEDAE-------ENEDFFELLESYGGNRDD-LKIQDMV
ADDA_ALKOO      G-DVTETSIMKLEALEELFEDEYEKGN---------EEFFNLVEAFGGTRED-RPLQDLV
ADDA_ALKMQ      G-DITETSIMRLEALEELFEEEYQGAH---------ETFFRLVEAFGGTKED-RPLQDLV
ADDA_SYNWW      A-DSTETELIKMEVLEELLDGEYEKGN---------DGFLDLVEAFGSNKDD-KPLEALI
ADDA_STAEQ      S-SEAENILLLEQTIDDVLEQHYDKLD---------PHFIELTEQLSSDRND-DQFRSII
ADDA_STAES      S-SEAENILLLEQTIDDVLEQHYDKLD---------PHFIELTEQLSSDRND-DQFRSII
ADDA_STAAN      S-SEAENILLLEQTIDEVIEQHYDILD---------PAFIELTEQLSSDRSD-DQFRMII
ADDA_STAA8      S-SEAENILLLEQTIDEVIEQHYDILD---------PAFIELTEQLSSDRSD-DQFRMII
ADDA_STAAB      S-SEAENILLLEQTIDEVIEQHYDILD---------PAFIELTEQLSSDRSD-DQFRMII
ADDA_STAS1      S-SEAENILLLEQTIDEVLERHYDILD---------PHFIDLTEQLSSDRND-DQLRNTI
ADDA_STAHJ      I-SDVENVLLLEQSIDEVLEKHYDTPD---------IEFLTLVEQLSSDRND-DNFRDLL
ADDA_LEVBA      LADETENGLLRDEVWADLREDLYANDDSGL--------FARLTENFSGDRND-QGLADLV
ADDA_LACPL      LTDNTEGLLIRDQVWDSVREQLYD-EDGTL--------FDLLTANFSNDRSD-DGLSRLI
ADDA_LACS1      LTEDTEVALLQENVWDDLREKWYS-KKSPE--------FENLVVNFSSDRND-DGLSELV
ADDA_PEDPA      M-DPTESELLKESVWADLREELYERDEDGK--------FALLTRNFSSDRSD-EGLQDLI
ADDA_ENTFA      LTDETETLLLKEDVWDALREQFYA-ENQEA--------FYQLTANFSNDRSD-DGLTNLI
ADDA_LACCB      LTDETERYMLQERVWDDLREQLYASDEAPA--------FEQLTANFSGDRDD-SGLQDLM
ADDA_LACH4      LTDDTQATLLKERALREIEGEMLTSKDKA---------FRHFYDNFAGDRDA-DSPRDLL
ADDA_LACAC      LTDETQAALIKERALREIEAESLTDENSG---------IRYFYDNFAGDRDA-NSPRDLL
ADDA_LACJO      LTDETQAELLKERALHEIEIEYLEKNDQD---------FQDFYDNFSGDRDA-EGARNLL
ADDA_LACDA      LTDATQIELLKERALRDVENGYLQNEDQAKK-----DRFLALYDAFAGDSNA-NSARDLL
ADDA_LACDB      LTDATQIELLKERALRDVENGYLQNEDQAKK-----DRFLALYDAFAGDSNA-NSARDLL
ADDA_STRMU      LQDKSEQDLLKNDVFDDLFTDYRTGDQ--------AELFTKLVRNFAGNRKDSSNFRQII
ADDA_STRA3      LQDKNEQDVIKNEVYADLFSDYMTGKN--------AASFIKLVKNFSGNRKDSKAFREMV
ADDA_STRP3      MQDKAEQDVLKQEVFSKLFSEFMNQKE--------APAFRALVKNFSGNCKDTSAFRELV
ADDA_STRPF      MQDKAEQGVLKQEVFSKLFSEFMNQKE--------APVFRALVKNFSGNCKDTSAFRELV
ADDA_STRPM      MQDKAEQDVLKQEVFSKLFSEFMNQKE--------APVFRALVKNFSGNCKDTSAFRELV
ADDA_STRP8      MQDKAEQDVLKQEVFSKLFSEFMNQKE--------APVFRALVKNFSGNCKDTSAFRELV
ADDA_STRP1      MQDKAEQDVLKQEVFSKLFNEFMNQKE--------APVFRALVKNFSGNCKDTSAFRELV
ADDA_STRPZ      MQDKAEQDVLKQEVFSKLFSEFMNQKE--------APVFRALVKNFSGNCKDTSAFRELV
ADDA_STRS7      IQDKAEQDILKREVFRQVFEDYMSQTD--------NKAFIQLVQNFSGRRKDSSAFREIV
ADDA_STRU0      MQDKSEQELLKNEIYKSLFENYMASDH--------SQVFLRLVKNFSGNRKDSKSFRDQV
ADDA_STRT2      MTDLAEQTLMKNEVYADLFNDYMQGKD--------AQLFQKLVRNFTGHSKTSKAFRDLV
ADDA_STRSY      LQDETEKASLKKEVFDQLFADYLEEDE--------NGAFRKLVRNFSGNRKDNSGFRQVV
ADDA_STRPI      LQNQSEQLLLENEVFHEVFEAHYQGKQ--------KETFSHLLKNFAGRGKDERGLRQQV
ADDA_STRR6      LQNQSEQLILENEVFHEVFEAHYQGKQ--------KETFSHLLKNFAGRGKDERGLRQQV
ADDA_STRP4      LQNQSEQLLLENEVFHEVFEAHYQGKQ--------KESFSHLLKNFAGRGKDERGLRQQV
ADDA_STRSV      LQSASEQLILQNEVFSQVFDHYYDSER--------QALFSRLVKNFTGKRKDLSAFREQV
ADDA_LACLS      LADQTESDLIRQEVFEQLVESYLSADESLNI---SKDKFEKLIKNFS-KDRNILGFQKVV
ADDA_LACLA      LADQTESDLIRQEVFEQLVESYLSGDDGLNI---SKEKFEELIKNFS-KDRNIAGFQKVV
ADDA_CARHZ      LEGPRE-TYLKNKVLEEILEERYEKGD---------RELFALLEYLNDEKND-RNLKELI
ADDA_LACF3      I-DDAEQQLLKEQAWQATLDDWVANPDQ-------VGALHQLIDNFGAGNLE-----SVV
                     :   :                            :  .                 :

ADDA_LEUMM      LKLSDFAEARADGNEWLEKLREPYEVTGEP-----------LTATALYVRSIRPIILEII
ADDA_OENOB      IKLNTMAETRANPDFWLDSIAENYRLSGG------------LTKGSFWKELLQPQIFNRA
ADDA_DESHD      LRLHEFAMSQVHPGEWLEHLPAAYDWHSLD-----------DLMESPWGQVVRQGVRDKV
ADDA_LACP7      LKLYQFSQSYPYPHEWLEEREKDFLVETAE-----------DINQTSWMKQLLQYVKAIL
ADDA_BACAH      LALHTESRAHPNPEKWLDKLVEAYDVEGK------------TIEDLVYASYLLEDVKFQL
ADDA_BACAN      LALHTESRAHPNPEKWLDKLVEAYDVEGK------------TIEDLVYASYLLEDVKFQL
ADDA_BACC7      LALHTESRAHPNPEKWLDKLVEAYDVEGK------------TIEDLVYASYLLEDVKFQL
ADDA_BACC4      LALHTESRAHPNPEKWLDKLVEAYDVEGK------------TIEDLVYASYLLEDVKFQL
ADDA_BACMK      LALHTESRAHPNPEKWLDKLVEAYDVEGK------------TIEDLVYASYLLEDVKFQL
ADDA_BACCN      LALHTAAGAHPNPEKWLDRLVEAYNVEGK------------TIEDLMYASYLLEDVKFQL
ADDA_BACSU      KQVYEYSRSHPNPEAWLESFVHLYDVSEKS-----------AIEELPFYQYVKEDIAMVL
ADDA_BACLD      KRVYEFSRSHPDPEGWLHSLAELYDAASDT-----------KVEALPFYSYIKEDIALVL
ADDA_BACP2      KRIYDFSRSHPSPEQWMRAFLSLYDVDAQT-----------KVEELPFYPYIKEDLSLVL
ADDA_GEOTN      LALYEFSRSHPAPDEWLADLVSMYDVDEQT-----------NVETLPPARYIAQHAAMEL
ADDA_LISMH      SKLYDFSRANPDPNAWLEAMVNFYNTEEIT-----------SITELPYFPIIKEDIELRV
ADDA_LISMO      SKLYDFSRANPDPNAWLEAMVNFYNTEEIT-----------SITELPYFPIIKEDIELRV
ADDA_LISMF      SKLYDFSRANPDPNIWLEEMVDFYNTEETT-----------SITELPYFPIIKEDIELRV
ADDA_LISW6      SKLYDFSRANPNPDLWLEQMVNFYDTKDIN-----------SITELPYFPIIKEDIELRI
ADDA_ANOFW      LRLYEFSRSHPNPSGWLQQIVHMYDVEEGA-----------RIDDLPYAHYLFQAVDLAL
ADDA_OCEIH      RSLHTFAMQSPWPNQWLDKLVQTYNIPEEW-----------TEEELPWMNVLRDEVSRQL
ADDA_PELTS      LDAYKFARSTPWPEDWLDGLAEGFNLPGG-----------ASFDRTPWSAVLKQAAEIEL
ADDA_DESAP      SGLHRFARSNPWPEAWLARAAAFGADPQG-----------LDGDG-PLAWGLRDLVGTGL
ADDA_HELMI      LQLYEKALSQPWPEQWLQDILGKFQEAGDTIAEQTLPGELPAWEALPWFAALREEMSIDL
ADDA_THEP3      LRLYGFVRSLPWPEKWLKDVINTFRVEDNF-----------KFETSKWAEVILDSLKVEI
ADDA_THEPX      LRLYGFVRSLPWPEKWLKDVINTFRVEDNF-----------KFETSKWAEVILDSLKVEI
ADDA_CALS4      LKLYGFIRSLPWPEKWLNNVLEAFEVKEDF-----------SFEDSKWAEVILDSIKVEI
ADDA_CLOBH      LELHRFAKSAPFSYDWLLNMAEEFNVGEEF-----------NFEETPWADMIMEDMKVLL
ADDA_CLOB1      LELHRFAKSAPFSYDWLLNMAEEFNVGEEF-----------NFEETPWADMIMEDMKVLL
ADDA_CLOBL      LELHRFAKSAPFPYTWLLNMAEGFNVGENF-----------NFEETLWADMIMEDMKVLL
ADDA_CLOBM      LELHRFAKSAPFPYDWLLNMAEEFNVGEEF-----------NFEETLWADMIMEDMKVLL
ADDA_CLONN      LNLYDFVMSSKNPKKQLQDMAEQFNVDESY-----------NFGESKWAKVLMDDVELEL
ADDA_CLOD6      LGIYSFAMASPEPKKWLIDSAERFNIDENF-----------DFSQSIWARAILDTVKIEI
ADDA_CLOB8      LDLYNFTMSGPWPEKWLINSAEAFNIKQLD-----------ELDRTNWVRVLAQSVKIEL
ADDA_CLOBB      LSLYNFTMAGPWPKKWLKDASRDFDIKTLQ-----------ELDETKWVNVLKESIKIEL
ADDA_CLOPE      LKFYNFIMSGPWPEAWLKDKVEEFNINSIE-----------ELEGKKWIEVLKESIILDL
ADDA_CLOPS      LKFYNFIMSGPWPESWLKDKVEEFNINSIE-----------ELEGKKWIEVLKESIILDL
ADDA_ACET2      LNLYDFIQSSPWPEEWLEKMTESMNIPDGT-----------DFGKTLWGSVLLSSVKIEL
ADDA_RUMCH      MSIYSFVQSYPWPEKWLEQQIESYNFEVGN-----------DFGETTWGRILLETSLMRL
ADDA_ALKOO      LKIYGFIQSQPYPEIWLRERVEDFALSIE------------AFNQSPWIRTIKKRMGILL
ADDA_ALKMQ      LKVYGFIQSQPYPEVWLKEKVGDFSLSIE------------DFDESLWIKTIKSRIEIQL
ADDA_SYNWW      LRLHSFIQSHPQPLSWLEEKIDNLALGED------------NWAENPWASELSQQIKIEL
ADDA_STAEQ      KQLYFFSIANPQPFEWLNQLAQPYKEENKQ---------------QQLMQLINDLAMIFM
ADDA_STAES      KQLYFFSIANPQPFEWLNQLAQPYKEENKQ---------------QQLMQLINDLAMIFM
ADDA_STAAN      KQLYFFSVANPNPTNWLDQLVTPYEEEAQQ---------------AQLIQLLTDLSKVFI
ADDA_STAA8      KQLYFFSVANPNPTNWLDQLVTPYEEEAQQ---------------AQLIQLLTDLSKVFI
ADDA_STAAB      KQLYFFSVANPNPTNWLDQLVTPYEEEAQQ---------------AQLIQILTDLSKVFI
ADDA_STAS1      KEMYYFSVANPNPLNWLQHLSTPYEDESQQ---------------ETLFNLLNDLAMIFM
ADDA_STAHJ      KRFYNFSIANPSPFEWLDSLVEIYTDDNKH---------------KLYLDELERLSKIYI
ADDA_LEVBA      QQTYTFANATPNPTAWLAELPQPYQLDSDQ-----------LMTTSFYQQRLRPFFQSQL
ADDA_LACPL      FRLFDFAQSTPDPEGWLSKLPEPYQVDEEA-----------LTASAFYQQQLLPLLINEV
ADDA_LACS1      MKTYQFANANPNPDEWLNNLVSEYDLGDQP-----------LMESNFYQNKIKPNVLDQI
ADDA_PEDPA      LELFEFSNANPDPQAWLQQIAKNYEVPSDN-----------VMDMEFIQQLLTEVKTKLM
ADDA_ENTFA      FSFYEFAKANPDPEAWINGLTQAYEVG-DQ-----------LGESKLFQTYLKPLAVETL
ADDA_LACCB      FELIRQAGATTDPKAYLEGLATPYAPEKWE-----------AT----FSQQIWPRVKGQL
ADDA_LACH4      LDLYNFAMAKPEYKKWLAQLPQIYEIE-DS-----------VIGSKIWQKQIKPYIATKF
ADDA_LACAC      LDLYNFAMAKPEYRSWLKNLAKIYEVN-NN-----------IVKSKLWQNQIKSYLLNTF
ADDA_LACJO      LQLYNTVVTEPNYEKFLNNLPNFYQVQ-DD-----------LIESDLWQTQIKPLLIKEI
ADDA_LACDA      LDLYQFAMARPNYRAWLQKLAAPYQLETSD-----------VVDSALWQEKIKPYLEEEF
ADDA_LACDB      FDLYQFAMARPNYRAWLQKLAAPYQLETSD-----------VVDSTLWQEKIKPYLEEEF
ADDA_STRMU      YKIYDFSQATDNPQRWLLENFLKG---ANTYK--------------DFSAIPEQE-VKDF
ADDA_STRA3      YKVYAFSQSTDNPKRWMQTVFLKG---AQTYT--------------DFEAIPDQE-VSSL
ADDA_STRP3      YTCYSFSQSTENPKIWLQENFLSA---AKTYQ--------------RLEDIPDHD-IELL
ADDA_STRPF      YTCYSFSQSTENPKIWLQENFLSA---AKTYQ--------------RLEDIPDHD-IELL
ADDA_STRPM      YTCYSFSQSTENPKIWLQENFLSA---AKTYQ--------------RLEDIPDHD-IELL
ADDA_STRP8      YTCYSFSQSTENPKIWLQENFLSA---AKTYQ--------------RLEDIPDHD-IELL
ADDA_STRP1      YTCYSFSQSTENPKIWLQENFLSA---AKTYQ--------------RLEDIPDHD-IELL
ADDA_STRPZ      YTCYSFSQSTENPKIWLQENFLSA---AKTYQ--------------RLEDIPDHD-IELL
ADDA_STRS7      DSIYAFSQSTANPSSWLAEVFLRG---SKTYT--------------SFADIPDQA-VDTL
ADDA_STRU0      YKIYQFSQSTENPKQWLENNFLLA---ANQYQ--------------DYDDLPDET-IDAL
ADDA_STRT2      YDIYSFSQATADPEKWLCQNLLKGQIEAKPEQ--------------AKNELLDGL-KDGL
ADDA_STRSY      YQVHDFSQSTSSPTKWLKEQAVQA--DLYSQE--------------RIEQMLEQGFKEKV
ADDA_STRPI      YKIYDFLQSTSNPQKWLSDSFLKGFEKADFTS--------------EKEKLTEQI--KQA
ADDA_STRR6      YKIYDFLQSTSNPQKWLSESFLKGFEKADFTS--------------EKEKLTEQI--KQA
ADDA_STRP4      YKIYDFLQSTSNPQKWLSESFLKGFEKADFTS--------------EKEKLTEQI--KQA
ADDA_STRSV      YRIYSFLQSTSSPQRWLEETFLYGYEHSDFAA--------------ERERIFCQI--KSA
ADDA_LACLS      YTIYRFASATENPISWLENQFLKGFETYKSLT--------------DLSEDFTVNVKENL
ADDA_LACLA      YTIYRFASATENPIKWLENQFLKGFETYKSLI--------------DLSADFSADIKENL
ADDA_CARHZ      LNLYHFSRSNPEPEKWLLDSLNLFNGNWER------------FEDTFWYREIKSSTEMWL
ADDA_LACF3      QALDTEADAQPHPSDWLAGLSGLYQFEEGAD---------------PRQSAFFKRLLEPL
                                :                                           

ADDA_LEUMM      KNLIKKVEEVQLTITGIDELKKTQDAFLEIQDYLLLIQDKAMVA----PWDELREAILDT
ADDA_OENOB      SAALYQLLSAKKGVEDLEDYHSYIAYLADAVGLVRGFIEVCSQN----NWQQMSDYFVNN
ADDA_DESHD      EEGLILLERAYRLAELPGGPVHYLPVLEDDQSRLGFLREMAEKGTWSDIETAFKSAAAFP
ADDA_LACP7      REASDLCAKAIEITNYPDGPKPYLDALLSDQE--IIERLLNSDAGSQHSYEEYQDAFSNI
ADDA_BACAH      ETAEQHIRKATELAMLPDGPAPRIETLQADLA-LLGTL--SSAA--RESWTSVYEAMQNV
ADDA_BACAN      ETAEQHIRKATELAMLPDGPAPRIETLQADLA-LLGTL--SAAA--RESWTSVYEAMQNV
ADDA_BACC7      ETAEQHIRKATELAMLPDGPAPRVETLQADLA-LLGTL--SSAA--RESWTSVYEAMQNV
ADDA_BACC4      ETAEQHIRKATELAMLPDGPAPRIETLQADLA-LLGTL--SSAA--HESWTSLYEAMQNV
ADDA_BACMK      ETAEKHIRKATELAMLPDGPAPRVETLQADLA-LLGTL--SSAA--RGSWTSVYEAMQNV
ADDA_BACCN      ETATEHIRKAMELAMLPDGPAPRMETLQTDLV-LLETL--SHAA--RKSWTSVYEAMQHV
ADDA_BACSU      NGAKEKLLRALELTKAPGGPAPRADNFLDDLA-QIDEL--IQH---QDDFSELYKRVPAV
ADDA_BACLD      EGMRQKLTRALDLTKQPGGPAPRAENFLDDLA-QIDRL--IQQ---QDDFSALHELVPTV
ADDA_BACP2      RSCQELLERALSLSKEPGGPAPRAENFIDDLE-QVNEL--IRH---QDDFEKLYELLPNV
ADDA_GEOTN      AAAKRFIGLALALAEKESGPKPYEKRLREDMD-LIADL--ERRL--SGSWDELYHALQSL
ADDA_LISMH      NQAKNYLLNAIDYANENNGPAPYLATLENDLV-QIQAL--SELN--WSSWTHLKTSIENI
ADDA_LISMO      NQAKNYLLNAINYANENNGPAPYLATLENDLV-QIQAL--SELN--WSSWTHLKTSIENI
ADDA_LISMF      NQAKNYLLNAIDYANENNGPVPYLATLENDLA-QIEAI--TELS--WNSWGQLKKAIESI
ADDA_LISW6      NQAKSYLLNAIEYASENNGPAPYLETLENDLA-QINTL--SNIS--WTNWQDVKLRVESM
ADDA_ANOFW      EAAEYRLAQALQKTKEPGGPDYLYDTLASDEQ-VIAKL--KEAR--HESWQQLHEAMKNV
ADDA_OCEIH      DAVSQEIDIAYSITQEADGPYHYAKTIEEEKA-IIQEA--LKN---MESWKYLQQSMLQV
ADDA_PELTS      AGARADLEAALRIAREPGGPQAYLANLEQEHD-LVCRLLQSCRT--NAPWAELYSYFKEV
ADDA_DESAP      EAAVFELRAALEAAKAPGGPAVYADALAAEVE-GTARL--AGLV--AGDWEPLRAAFLAF
ADDA_HELMI      AEVESLLVRALSLCRQPGGPAAYGDAVTADLQ-LTQDL--HLAA--GRSWTQLHECFQAL
ADDA_THEP3      SGILNTMLVAVDKLKNEAGLEGYFHAFQREAY-EIEQLLQ------YDNWNEFKNHIQAI
ADDA_THEPX      SGILNTMLVAVDKLKNEAGLEGYFHAFQREAY-EIEQLLQ------YDNWNEFKNHIQAI
ADDA_CALS4      LGLLNGMSVAIEKLREERGLEGYLSLFQSEAH-HLKELID------SKSWNEFKKKIEAI
ADDA_CLOBH      HGFKNMLQQSIDVILNSEGIDYYYEPFKMDLS-FINSLLE------KSSFKEFRGEIIAY
ADDA_CLOB1      HGFKNMLQQSIDVILNSEGIDYYYEPFKMDLS-FINSLLE------KSSFKEFRGEIIAY
ADDA_CLOBL      HGFKNMLQQSIDVILNSEGIDYYYEPFKMDLS-FINSLLE------KSSFKEFRGEIIAY
ADDA_CLOBM      HGFKNMLQQSIDVILNSEGIDYYYEPFKMDLN-FINSLLE------KSSFKEFRGEIIAY
ADDA_CLONN      SGLKDMMEEALKLINDTNGLDAYLEGFTDELL-MINDLILNA----KTSWDSLYNGLSEV
ADDA_CLOD6      NGLCLNMERALKEVESIEELETFAEKLSVEYK-KIADISQAC----NKSWDEAYKKMASM
ADDA_CLOB8      DGYVKMLEKAIEVTSKTDGLEPYMDNLLMELS-YIKKAYEST----DNGLEAMFNSLSSV
ADDA_CLOBB      DGYIKMMQKAVKLINETDGLEPYFEGFSSELD-LIVNAYNNV----ESSLNDLYNSLNLI
ADDA_CLOPE      NNAYSMLTQARDIAEMGGGLEPYLVNINPEII-QVEELKIAL----SEGIVKFYNNLMGA
ADDA_CLOPS      NNAYSMLTQARDIAEMGGGLEPYLVNIYPEII-QVEELRIAL----SEGIVKFYNKLMGA
ADDA_ACET2      EGLKEMISRALEILKDASGLEKYRAVYMEDLA-NVDALLKLLNEESEMQWDRIFNALQGF
ADDA_RUMCH      EGLRDIMNEACAKIKNAQGLEKYLSVFIEDND-NLEKLIGIC--KTGMNWDQLYNYVNSF
ADDA_ALKOO      KGAMDLLEIAQTIALEPGGPDVYEEAILSDLD-QIKELYHSL----ENPITDFYEQLNCI
ADDA_ALKMQ      KGAMDLLNNALSIAQEPGGPEVYEEAILSDLG-QISELYDSL----TLPITSFYEHLNHI
ADDA_SYNWW      SAAQDILNQALKLSNKAGGPRGYLEAIESDQK-WVELLLKAA----DQGLPVLYSCLQQL
ADDA_STAEQ      KAGYEELQKSYDLFSMMESVDKQLEVIETERMFITKAIEGKVLNTDVITQHEFMSRFPAI
ADDA_STAES      KAGYEELQKSYDLFSMMESVDKQLEVIETERMFITKAIEGKVLNTDVITQHEFMSRFPAI
ADDA_STAAN      TAAYDALNKAYDLFSMMDGVDKHLAVIEDERRLMGRVLEGGFIDIPYLTDHEFGARLPNV
ADDA_STAA8      TAAYDALNKAYDLFSMMDSVDKHLAVIEDERRLMGRVLEGGFIDIPYLTGHEFGARLPNV
ADDA_STAAB      TAAYDALNKAYDLFSMMDGVDKHLAVIEDERRLMGRVLEGGFIDIPYLTGHEFGARLPNI
ADDA_STAS1      NSALEALNKSYDLFMMLEEVDKQVAVLDKERRFLAEAMEGGLLNTQKIAEHQFESRFPAK
ADDA_STAHJ      KAAYHTLLEAENNFLNCIEAEKHLDVIKLEKFKCEKMIEGNVINFEEIINYT-SEKLPTI
ADDA_LEVBA      QQLQADLTSAQALANQA----GLDKQAAHVTAVLEN-VAAVQQLVTGDSWNALRAAIQDF
ADDA_LACPL      DGMQMKLRQAQKVATDA----DLVPKTLEVLATAQKTLTTLREQLATASWNELRTQVATF
ADDA_LACS1      QLAKDNLKQGMDEANKL----GLEKLYQTFEQDCATIDELQDFVVGCKEWNNLKTTLQNF
ADDA_PEDPA      RIYRKDLDLTEQAINGG----EPLKNAAEKFQNEVDDLKTIIDSLNG-SWDDVQQAVSKM
ADDA_ENTFA      QRTLQRYEEMVTLTEGE----EKLQKIWYLAQNEKEQTKQFLQFLERNDLESAYNLTELL
ADDA_LACCB      LQIATSLTQASALANQ------LPNPIWYQQIQADLAPLQTLLETNAPTYDTVRSVLISH
ADDA_LACH4      SKLQEKIASYLTQAIMET--KELAKVKESFTLFAQNLNNFVQAVKEDDDYDKQRELLRSC
ADDA_LACAC      VSLQKKIEEYLNNPTIET--KELAKVKEDFSLFTQNLDKFIDAIKNDEDYDQQRNLLRLC
ADDA_LACJO      KDLQTEIRQFFENPQMEN--PDLVKVKENYDIFTSRLEQFLNALEDDHSYNEIRASLMNC
ADDA_LACDA      SNLADKLTALMAEADFDH--EKFAKYQPAFTAFATSLASYRESLATDDPFDRQRELLAAC
ADDA_LACDB      SNLADKLTALMAEADFDH--EKFAKYQPAFTAFATSLASYRESLATDDPFDRQRELLAAC
ADDA_STRMU      LNTLQETALALRDVTDLE----DYKQVTAKGTPTAAYQRHLKMIEQ---LQDWVLHFDSL
ADDA_STRA3      LNVMQTTANQLRDLTDQE----DYKQLTAKGVPTANYKKHLKIIEN---LVHWSQDFNLL
ADDA_STRP3      LLAMQDTANQLRDVTDME----DYGQLTKAGSRSAKYTKHLTIIEK---LSDWVRDFKCL
ADDA_STRPF      LLAMQDTANQLRDVTDME----DYGQLTKAGSRSAKYTKHLTIIEK---LSDWVRDFKCL
ADDA_STRPM      LLAMQDTANQLRDVTDME----DYGQLTKAGSRSAKYTKHLTIIEK---LSDWVRDFKCL
ADDA_STRP8      LLAMQDTANQLRDVTDME----DYGQLTKAGSRSAKYTKHLTIIEK---LSDWVRDFKCL
ADDA_STRP1      LLAMQDTANQLRDVTDME----DYGQLTKAGSRSAKYTKHLTIIEK---LSDWVRDFKCL
ADDA_STRPZ      LLAMQDTANQLRDVTDME----DYGQLTKAGSRSAKYTKHLTIIEK---LSDWVRDFKCL
ADDA_STRS7      LACMQDTADQLRDLTDME----GYAQTTKAGKLTAKYTKHLKMIDS---LYEWALHFDSL
ADDA_STRU0      LQSMKETAISLRDLTDLE----EYGQMTKAGKPTAKYVKHLTMIEA---LNDWSMHFDSY
ADDA_STRT2      LADFLAFLRDHLGIAQRE----FAKAKYLNNVSDAIILLEGSLINDQTDMEDLLKQLLTL
ADDA_STRSY      LDKLYQAADFFRYHVEWGRNDFGSAKYFANVEEVLDLLTGLDSLDQK-DLMERVERILLI
ADDA_STRPI      LWDLESFFRYHLDNDAKE---FAKAAYLENVQLILDEIGSLNQESDSQAYQAVLAHVVAI
ADDA_STRR6      LWDLESFFRYHLDNDAKE---FAKAAYLENVQLILDEIGSLNQESDSQAYQAVLARVVAI
ADDA_STRP4      LWDLESFFRYHLDNDAKE---FAKAAYLENVQLILDEIGSLNQEFDSQAYQAVLARVVAI
ADDA_STRSV      LWELETFFSAHLEHEGRE---FAGAKYQENVQDALTVLAGLNESSSIEETAQILKQIVAL
ADDA_LACLS      LTFFELLENSLTNGVIAK-----KGAGRDKANLILDNKNELLEAISKKDFVTFTALFLSI
ADDA_LACLA      LIFFELLETSLTNGVVAK-----KGAGRDKANLILDNKNELLEAITTKDFATFTELFLSI
ADDA_CARHZ      EYILELLGRAKSVAEKYGQARAFSLLAEDMEKVRGLYAKLNE------GYEAAKQYLSQV
ADDA_LACF3      VGPQLKELRDQWAALGEVGPARFAEQVEEDLAKLATTVDDQGHL--LGSWDSLAQTLNKK
                                                                            

ADDA_LEUMM      PSGKINSQTKAIKEDPDLSATLEVARQIKGQVVGVKSQMNSLITSYFALDEKSWQLVQK-
ADDA_OENOB      SWPKSARKSGKNEQE-----ADYFDNWIKPWIKEAKDSYRSIESDFLFLNESQWLDISE-
ADDA_DESHD      GLPRGSKKNLPDSLIDEENSKRLREESKKARDEAKKKLE-EIKNTVFSVPLTDQLPFLN-
ADDA_LACP7      TFARLSTKKWPDATEER------KEEVKAIRQMVKKILS-DLSDDFFFQPMEDMLTDMR-
ADDA_BACAH      SWQT-----LKRIK-KSDYNEDIVKQVDSLRNKAKDEVK-KLQEELFSRRPESFLRDFQ-
ADDA_BACAN      SWQT-----LKRIK-KSDYNEDIVKQVDSLRNKAKDEVK-KLQEELFSRRPESFLRDFQ-
ADDA_BACC7      SWQT-----LKRIK-KSDYNEDVVKQVDSLRNKAKDEVK-KLQEELFSRKPESFLRDFQ-
ADDA_BACC4      SWQT-----LKRIK-KSDYNEDVVKQVDSLRNKAKDEVK-KLQEELFSRKPESFLRDFQ-
ADDA_BACMK      SWQT-----LKRIK-KSDYNEDVVKRVDSLRNKAKDEVK-KLQEELFSRRPESFLRDFQ-
ADDA_BACCN      SWQT-----LKRIK-KSDYNEDIVKQVDSLRNKAKDEVK-KLQEELFSRKPESFLRDFQ-
ADDA_BACSU      SFKR-----AKAVK-GDEFDPALLDEATDLRNGAKKLLE-KLKTDYFTRSPEQHLKSLA-
ADDA_BACLD      SFQR-----LKPCK-GDEYDPRLVDEAADLRNSAKKQLE-KLKSDYFSRTPEQHLESLR-
ADDA_BACP2      NFKR-----LKTCK-GDEYDPVLLEKATDARNQAKKQLE-KLKDEYFMRSPAQHLKSLA-
ADDA_GEOTN      SFGR-----LPPCR-GDGFDAELIDEAKSLRDQAKKKIE-ALRDNVFSLHPSAWLRHMR-
ADDA_LISMH      DFKR-----IPTLKNKSDYDEVYVEEAKKFRDAAKKEMK-NIATDWFSREEVNYLSDLE-
ADDA_LISMO      DFKR-----IPTLKNKSDYDEVYVEEAKKFRDAAKKEMK-NIATDWFSREEVNCLSDLE-
ADDA_LISMF      DFKR-----IPTLKNKSDYDEEYVEEAKKFRDAAKKEIK-NIATDWFSREEINYLSDLE-
ADDA_LISW6      DFKR-----IPSLKNKSDYDEEYVEETKRFRDAAKKEIK-NVLVDWFSREETNYLADLE-
ADDA_ANOFW      SFAT-----AKRKPKDGAYDEQLVEDVKKLRDQVKKEIS-SITEELFSFQPVTYVRHLH-
ADDA_OCEIH      KFGK-----LSGKK--VDCDEEKKTKVKKLRDSYKKRFQ-KMQEVWFARNLDAHVYDMR-
ADDA_PELTS      VFSP-----LKQCR-KEDADLKLAGQARNFRESAKKKVM-QVKSRYFSLPPEDLCADLR-
ADDA_DESAP      GFTP-----RLPAA-RAGVDQELKDLCSRCRKKAKERIQ-NLKETFFARRPEELLSEMA-
ADDA_HELMI      SFTR-----VKAV--RGPVDESLKKEVSRLRYQAKKKLT-DLQKKYFLRTPHDLVSDLT-
ADDA_THEP3      EFER-------LPNAGKDANKNVKEEVSNIRKKVKDKIK-EIKEKFFSDSVEEIKDEIK-
ADDA_THEPX      EFER-------LPNAGKDANKNVKEEVSNIRKKVKDKIK-EIKEKFFSDSVEEIKDEIK-
ADDA_CALS4      SFER-------LPKASKEADAEVKEEVRKLREDVKKRIR-EIRDKFFIDEEEEIKREIK-
ADDA_CLOBH      DFP------KLPLKRNKDADKEAKERVKKLRDKVKKKIV-ELKNILDSYENEFIKKEFI-
ADDA_CLOB1      DFP------KLPLKRNKDADKEAKERVKKLRDKVKKKIV-ELKNILDSYENEFIKKEFI-
ADDA_CLOBL      DFP------KLPLKRNKDADKEAKERVKKLRDKVKKKIV-ELKNILDSYENEFIKKEFI-
ADDA_CLOBM      DFP------KLPLKRNKDADKEAKERVKKLRDRVKKKIL-EIKNILNSYENEFIKKEFI-
ADDA_CLONN      KFG------RLKTCRNCE-DKKTQEKVKDIRNKVKKQLQDEIKKKITSYSTKEIVTDLR-
ADDA_CLOD6      SFENYVKGVKRISKDAPSYIKESKEKAKTIRDKTKKSLE-SIVSATFNKDNDSIREEIK-
ADDA_CLOB8      QFSR-----LKSIKKDKVSDELSQNTVKKIRDDVKKGIS-ELLNNAYSVNPQQMLRNIQ-
ADDA_CLOBB      TFNR-----LKTIKKNTVSDENIQNLVKQIRDQVKKKIS-ALIEGTFIASPDKMLDNII-
ADDA_CLOPE      SFGR-----LKSVRKASVDDERALEKTKSLRDESKKIIE-NLRDNVFETSLEEAVLGMK-
ADDA_CLOPS      SFGR-----LKSVRKASVDDEKALEKTKSLRDESKKIIE-NLRDNVFETSLEEAVLGMK-
ADDA_ACET2      EFAT-------LPRCGREVDKDKQEIVKKIRDDVKQRIR-KFREKVITSVSNEIISDLK-
ADDA_RUMCH      EFRN-------LPRCGKDAEKSVQESVKKIRDELKSVIN-GLRDEVFFMESDEIASDLK-
ADDA_ALKOO      NFIRLK--------TSKDSDPILKEECKDLRDKAK-DIVKDIRENIFNVSPEEYVEDLN-
ADDA_ALKMQ      NHARLK--------PSKESDPVLKEESKNLRDKAK-GIIKDIKDNIFTVSPEAYVEDLN-
ADDA_SYNWW      SFTRLGR-------VSRDVDENLKNQVKILRDESK-KILNAI-NSLLGRDPLEYLQDLN-
ADDA_STAEQ      NSKI------KEANE---GMEDALNEAKQHYDKYKSLVM-KVKNDYFSRNAEDLQRDMQ-
ADDA_STAES      NSKI------KEANE---GMEDALNEAKQHYDKYKSLVM-KVKNDYFSRNAEDLQRDMQ-
ADDA_STAAN      TAKI------KEANE---MMVDALEDAKLQYKKYKSLID-KVKNDYFSREADDLKADMQ-
ADDA_STAA8      TAKI------KEANE---MMVDALEDAKLQYKKYKSLID-KVKSDYFSREADDLKADMQ-
ADDA_STAAB      TAKI------KEANE---MMVDALKDAKLQYKKYKSLID-KVKSDYFSREADDLKADMQ-
ADDA_STAS1      NKKI------KEANE---MMIDAYDDGKKHYDDYKALVS-KVQEDYFSREAADLKTDMQ-
ADDA_STAHJ      TKKL------KDTNEDEGISSQFLTNAKDFFDDYKKLLS-EVKNKYLMRSYEDLKVDMK-
ADDA_LEVBA      AWGRMP----AVRKTNED-YPIYNELKTTYYDPARKQLD-SLKKTYLIQDEQQAMTTIR-
ADDA_LACPL      KIGALK----KTYKDEPE-KTARAKTMGTFVDGVKKQMT-TLSETYFAADEQQVLDIMV-
ADDA_LACS1      KFKRAK----SDRGLDDDQKKQKERINKTLRDGSKKIIE-DLSVKYFALPEDEIKELTQ-
ADDA_PEDPA      KFAQLP----RGKKEEVQ---EFNAYAKSIRNDFKDEFN-TIADKYFKLSSEQMIAVFK-
ADDA_ENTFA      SFDRYP----TVRAEELK---PTAEQAKQLREQNKKALN-DLKKQLFTLSPDAMKQVLK-
ADDA_LACCB      EFAAWS----RISKGLDDADKDTKNAAKDLRDAAKKTWQ-NKLAPTFALAAEQIGDLLR-
ADDA_LACH4      VFTINF----RKSKKWDEDLLEFYNEIQSLKDEAKSQVF-DTFTSFYAVTEKEQIKIMQ-
ADDA_LACAC      KFEVKY----RKSAKWDEDIQEFYAETQKLKSEAKSQIF-DIFTAFYATDEKEQTRIMQ-
ADDA_LACJO      KFEKNI----RKSKKWSEESLETYQESQKLKSDLNDQLK-KIFANFFVVEEKEQVNILK-
ADDA_LACDA      QFDGTL----RTNK----EIADFVEEAKEVKEAGKQLVF-NVYTGFYASSNADQQALLA-
ADDA_LACDB      QFDGTL----RTNK----EIADFVEEAKEVKEAGKQLVF-NVYTSFYASSNADQHALLA-
ADDA_STRMU      YGRD------GLGKLANDIATLIPSGNDVTVAGVKYPVFRSLHSRLRGLKHLETIFKYQD
ADDA_STRA3      YGKK------GLANLARDITNVIPSGNDVTVAGVKYPIFKQLHNRIVGLKHLEVIFKYQG
ADDA_STRP3      YGKA------GLDRLIRDVTDLIPSGNDVTVSKVKYPVFKTLHQKLKQFRHLETILMYQK
ADDA_STRPF      YGKA------GLDRLIRDVTGLIPSGNYVTVSKVKYPVFKTLHQKLKQFRHLETILMYQK
ADDA_STRPM      YGKA------GLDRLIRDVTGLIPSGNDVTVSKVKYPVFKTLHQKLKQFRHLETILMYQK
ADDA_STRP8      YGKA------GLDRLIRDVTGLIPSGNDVTVSKVKYPVFKTLHQKLKQFRHLETILMYQK
ADDA_STRP1      YGKA------GLDRLIRDVTGLIPSGNDVTVSKVKYPVFKTLHQKLKQFRHLETILMYQK
ADDA_STRPZ      YGKA------GLDRLIRDVTGLIPSGNDVTVSKVKYPVFKTLHQKLKQFRHLETILMYQK
ADDA_STRS7      YGKA------RLGQLAQELTALLPSGADITVAGHKYPIFKSLQEQLVGFRHLETILAYQQ
ADDA_STRU0      YGKS------QIGKLAQDLSALLPSGTDVTVAGQKYPIFKDIQSKISQFRHLATLLTYQP
ADDA_STRT2      SGGT------GLTNMTRPKDEELKA-YKEAYNKTKNEFVAQLREVDTQLTVLEVLTKHND
ADDA_STRSY      NNQSRG---KGLTNANRPKDEHLIAFKEEYNAG-KSQIISELRDLGQEVYELTLLKDYQV
ADDA_STRPI      SKEKNG---RALTNASRKAD---LKPLADAYNEERKTQFAKLGQLSDQITILDYQERYHG
ADDA_STRR6      SKEKNG---RALTNASRKAD---LKPLADAYNEERKTQFAKLGQLSDQIAILDYQERYHG
ADDA_STRP4      SKEKNG---RALTNASRKAD---LKPLADAYNEERKTQFTKLGQLSDQIAILDYQERYHG
ADDA_STRSV      SQLSNG---QAFTARVGKNADELKKEMAKDYNEARKPMIERLRSFDQQLYQLDFIEQHQD
ADDA_LACLS      DTDIRV---GSSKDETLSALKKDFSAQKQDLVGSKSKP-GELRKFVDKIKHGQLIEKYQK
ADDA_LACLA      DTDIRV---GSSKDEILSALKKDFSVQKQDLVGSKSKP-GEIRKFVDKIKHGQLIEKYQN
ADDA_CARHZ      KFGT----------FSWGRGVGGKDEAKDLRDKAKEQFE-TIKKRYFSWEAGNFREELR-
ADDA_LACF3      NFAP------KLRKRKDDDDPELLDELGVQRGGLRDQLG-DLHDTYFFQSAADLVKYGQ-
                                                                            

ADDA_LEUMM      ESYKLIDTLILVTQAFRESFRRTKREEKLLDFPDLGTLALAILSDDVTK-----------
ADDA_OENOB      KSLGVVEELIRLTKVFRKKFALKKRELSLLDFSDGEQFAYQILQNQTVR-----------
ADDA_DESHD      KMGELVGTLAQVTQHFAREYQKAKRQRNCVDFSDLEHYALQLLAKDKQ------------
ADDA_LACP7      KVRRPMLVLLSLTHDFLERLDASKEENNLVDFSDIEHFALNILVTKEDG--NLV------
ADDA_BACAH      DMHPVLEKLVQLVKVFTERFQAMKRDKGMVDFTDLEHFCLQILSEQSED-GEMK------
ADDA_BACAN      DMHPVLEKLVQLVKVFTERFQAMKRDKGMVDFTDLEHFCLQILSEQSED-GEMK------
ADDA_BACC7      DMHPVLEKLVQLVKVFTERFQAMKRDKGMVDFTDLEHFCLQILSEQSEE-GEMK------
ADDA_BACC4      DMHPVLEKLVQLVKVFTERFQAMKRDKGMVDFTDLEHFCLQILSEQSEN-GEMN------
ADDA_BACMK      DMHPVLEKLVKLVKVFTERFQAIKRDKGMVDFTDLEHFCLQILSEQSED-GEMK------
ADDA_BACCN      EMHPVLGKLVQLVKEFSNRFQAIKRDKGMVDFTDLEHFCLQILSEQGED-GELR------
ADDA_BACSU      EMKPVIETLVQLVISYGKRFEAAKQEKSIIDFSDLEHYCLAILTAENDK-GERE------
ADDA_BACLD      EMKPVIQTLVQLVLEYGRRFAEAKKEKAIVDFSDLEHDCLAILSVKNPA-GEAV------
ADDA_BACP2      EMKPIVETLVELVIQFGERFERAKQEKSIVDFSDLEHYCLRILAEQDAE-GHLI------
ADDA_GEOTN      EMKPVVETIAALVRRFSAMFEAAKREKGIVDFSDLEHYCLRILRQYDPETGEWQ------
ADDA_LISMH      KMKPDIQTLSELVKKFAANFFEEKQQRGVLDFNDLEHLALKILLNGDKA-----------
ADDA_LISMO      KMKPDIQTLSELVKKFSANFFEEKQQRGVLDFNDLEHLALKILLNDDKA-----------
ADDA_LISMF      KMKPDIKTLSRLVKKFAENFFEEKQQRGVLDFNDLEHLALKILLKDNEA-----------
ADDA_LISW6      KMKPDIKTISELVKNFANNFFEEKQRRGVLDFNDLEHLALKILLKNDVP-----------
ADDA_ANOFW      EMKPIVTTIVQMVQRFAHLLQAKKDEKGIVDFSDLEHYCLRILRAPSLE-HELK------
ADDA_OCEIH      VLAPVIKHLVELVKQFQDSFAKVKKEKAVVDFSDLEHYCLQILIDESSTEEEVI------
ADDA_PELTS      RMAPLIKELAGLVREFDATYRKAKAARGVVDFNDLEHYCLQVLAEKG--PSGAV------
ADDA_DESAP      ALGPAMRRLAALAADFGEAYRTAKLARNLVDFADLEHYCLQILLAPGSTPEAPV------
ADDA_HELMI      QVLPLMATLVDVVLAFDRAFQAAKREKRLVDFNDLEHFCLRLLLDESASPGVPV------
ADDA_THEP3      ALYPIMEALADLILLFDKKYKEKKREKGIIDFNDIEHFALQILTEIDEE-GAVN------
ADDA_THEPX      ALYPIMEALADLILLFDKKYKEKKREKGIIDFNDIEHFALQILTEIDEE-GDVN------
ADDA_CALS4      KLYPVMKALADLILMFDKKYGEKKKEKGVIDFEDIEHFALKILSNE--------------
ADDA_CLOBH      FLYPSMKALSNLVILFDKKYEAKKRERDLIDFNDIEHLCLSILTDKNSE-GHII------
ADDA_CLOB1      FLYPSMKALSNLVILFDKKYEAKKRERDLIDFNDIEHLCLSILTDKNSE-GHII------
ADDA_CLOBL      FLYPSMKALSNLVILFDKKYEAKKRERDLIDFNDIEHLCLSILTDKNSD-GHII------
ADDA_CLOBM      FLYPSMKALSNLVILFDKKYEAKKRERDLIDFNDIEHLCLSILTDKDSE-DHII------
ADDA_CLONN      NLYPIMKSLCDLVIEFMDRYSKAKKERGIIDFNDFEHFCLEILGHE--------------
ADDA_CLOD6      YLYNIVKPISSVVLRFEEEYSNKKREKGIIDFNDIEHFALNILTDVDEK-GNIV------
ADDA_CLOB8      GSYPYIKKLIELVLEFSARFSKRKRERNILDFNDLEHLCLKILSDYDDE-NNII------
ADDA_CLOBB      KSYPYINQLTELTSEFIDRFTAKKKEKNILDFNDLEHLCLKILIEENEE-NQIV------
ADDA_CLOPE      KMYPLMKCLSGLVIEFSNRYRDKKREKDILDFNDLEHLCLEILIDKDEE-GNIK------
ADDA_CLOPS      KMYPLMKCLSGLIIEFSNRYRDKKREKDILDFNDLEHLCLEILIDKDEE-GNIK------
ADDA_ACET2      ALYPKMKCLANLVKQLAEKYAEKKNRKSVVDFNDLEHFCLEILTERKED-GSII------
ADDA_RUMCH      TMYPILKCVSRLVMDFGRRYAHKKSQRASVDFNDLEHFCLNILAETDKD-GNIR------
ADDA_ALKOO      RLYPLMDYLYRLVIGFTERYTEKKTDKGIVDFNDLEHFALRILAND--------------
ADDA_ALKMQ      KLHPLMDYLYQLVTGFTSRYAQKKADRGIVDFNDLEHYGLEILANE--------------
ADDA_SYNWW      EIYSLMKYLGEIIQSFAEIYQEKKREKGIVDFNDLEHLALQILSNE--------------
ADDA_STAEQ      QLAPRVAYLAQIVQDVIQSFGVQKRSRNILDFSDYEHFALRILTNEDGS-----------
ADDA_STAES      QLAPRVAYLAQIVQDVIQSFGVQKRSRNILDFSDYEHFALCILTNEDGS-----------
ADDA_STAAN      QLAPRVKYLARIVKDVMSEFNRKKRSKNILDFSDYEHFALQILTNEDGS-----------
ADDA_STAA8      QLAPRVKYLARIVKDVMSEFNRKKRSKNILDFSDYEHFALQILTNEDGS-----------
ADDA_STAAB      QLAPRVKYLARIVKDVMSEFNRKKRSKNILDFSDYEHFALQILTNEDGS-----------
ADDA_STAS1      RLAPRVAYLAQVTADVIEQFNQKKRSRNLLDFSDYEHFALRILMDSNGN-----------
ADDA_STAHJ      RLAPRIQYLVQIVKDIINGFAEKKRSRNVLDFSDYEHFALQILTDQEGN-----------
ADDA_LEVBA      RSGELVGELSRVVTAFRTAYRQEKQRRHVLDFADVEHAALAILTQDSDQS----------
ADDA_LACPL      GAKSIVTELVDATKQFKTAFAAEKRRRHVLDFSDLEHLTLQILTSDNESS----------
ADDA_LACS1      KSKQIVETLSEVVKEFGAEFSKEKRRRHVLDFSDLEHLTLQILNTDTPDG----------
ADDA_PEDPA      DAHDLMMKLIEVQNQFAERFLQEKLTRRSLDFSDLEHFALQIVLDDSEEG----------
ADDA_ENTFA      EATPIVQEMAHVGKQFMEAYGAEKRLKNLVDFNDLEHYTLAILAKNQADGWH--------
ADDA_LACCB      EAQPLVATLANVALKFEDALTAEKAARHVQDYSDIAHNALRILQQKDPQT----------
ADDA_LACH4      ESQKIVTAISTAEIKLIERFNQLKRNENLLDYSDMEQLAYQILSQDTSSS----------
ADDA_LACAC      ESQKIVSAISKAELALIDRFNELKRNENFLDYSDMEQLAYQILSADTSNS----------
ADDA_LACJO      KSEKLVKTIVDAEKKLIKRFGQLKREQNLIDYSDMEQFAFSILTTDTSNA----------
ADDA_LACDA      KGAEIASAAAEVELAFIDRFNELKRADRVLDFSDMEQLAYEILTQDSSNS----------
ADDA_LACDB      KGAEIASAAAEVELAFIDRFNELKRADRVLDFSDMEQLAYEILTQDSSNS----------
ADDA_STRMU      QSLPLLQVLQSFTLDFSKQYLQAKMQENAFEFSDIAHFAIQILEEND-------------
ADDA_STRA3      ESLFLLELLQSFVLDFSEQYLQEKIQENAFEFSDIAHFAIQILEENH-------------
ADDA_STRP3      DCFPLLEQLQDFVFAFSEAYLAVKIQESAFEFSDIAHFAIKILEENT-------------
ADDA_STRPF      DCFPLLEQLQDFVLAFSEAYLAVKIQESAFEFSDIAHFAIKILEENT-------------
ADDA_STRPM      DCFPLLEQLQDFVLAFSEAYLAVKIQESAFEFSDITHFAIKILEENT-------------
ADDA_STRP8      DCFPLLEQLQDFVLAFSEAYLAVKIQESAFEFSDIAHFAIKILEENT-------------
ADDA_STRP1      DCFSLLEQLQDFVLAFSEAYLAVKIQESAFEFSDIAHFAIKILEENT-------------
ADDA_STRPZ      DCFPLLEQLQDFVLAFSEAYLAVKIQESAFEFSDIAHFAIKILEENT-------------
ADDA_STRS7      ESLPLLEVLQAFVISFSEAYLAAKMQENAFEFSDIAHFAIEILQQAP-------------
ADDA_STRU0      ETLPLLLELQSFVIDFTEAYLEAKKSENAFEFTDITHFAIEILQNEE-------------
ADDA_STRT2      DILPMLELLQSFVLDFSDQYLQAKIQENTFEFSDIAHFAIRILEENP-------------
ADDA_STRSY      QALPLLILLRDFVLDFSQAYLDVKIKEAAFEFGDIGHFAIRILEENA-------------
ADDA_STRPI      DTWKLAKTFQSFMSDFVEAYRQRKRQENAFEFADISHYTIEILENFP-------------
ADDA_STRR6      DTWKLAKTFQSFMSDFVEAYRQRKRQENAFEFADISHYTIEILENFP-------------
ADDA_STRP4      DTWKLAKTFQSFMSDFVEAYRQRKRQENAFEFADISHYTIEILENFP-------------
ADDA_STRSV      ECLPLVELLRDFVADFAQAYLERKKAENAFEFGDISHFAIEILETFP-------------
ADDA_LACLS      QAFEIASDLQKFIIEFYKTYLERKKNENAFEYSDIAHFAIEILEENP-------------
ADDA_LACLA      QAFEIAENLQKFVIEFYQSYLERKKNENAFEYSDIAHFAIEILEENP-------------
ADDA_CARHZ      TLTSYLDPLVKLVREFSRKYQEEKRKHGFADFSDLEHWALDILKSGVYR-----------
ADDA_LACF3      KAGALIEILTRVATDFRCHYQIIKQDRRLLDFSDLEHYAYAILTGENINPKVTWSDEEAR
                                       *      :: *       ::                 

ADDA_LEUMM      ----------QTIQGQFDEILVDEYQDINQLQETLLTSVSNG------------------
ADDA_OENOB      ----------EEIQSLFDEVLVDEYQDINDLQENILTDVSNG------------------
ADDA_DESHD      -----PTEIALKLQAYYAEVLVDEYQDINPVQERILQLVSRQEE----------------
ADDA_LACP7      -----PTKVATEMSEQFVEIMIDEYQDSNYVQEYILSSISKVTR----------------
ADDA_BACAH      -----PSAVALQYRNKFAEVLVDEYQDTNFVQESIIKFVTKD------------------
ADDA_BACAN      -----PSAVALQYRNKFAEVLVDEYQDTNFVQESIIKFVTKD------------------
ADDA_BACC7      -----PSAVALQYRNKFAEVLVDEYQDTNFVQESIIKFVTKD------------------
ADDA_BACC4      -----PSAVALQYRNKFAEVLVDEYQDTNFVQESIIKFVTKD------------------
ADDA_BACMK      -----PSAVALQYRNKFAEVLVDEYQDTNFVQESIIKFVTKD------------------
ADDA_BACCN      -----PSPVALQYRNRFAEVLVDEYQDTNFVQESIIKLVTKD------------------
ADDA_BACSU      -----PSEAARFYQEQFHEVLVDEYQDTNLVQESILQLVTSG------------------
ADDA_BACLD      -----PSEAAKFYRHQFHEVLVDEYQDTNLVQEAILKLVAK-------------------
ADDA_BACP2      -----ETEAAKYYQQQFEEVLVDEYQDTNLVQETILKLVSKGE-----------------
ADDA_GEOTN      -----PSSAALEYQAQFDEVLVDEYQDTNLVQETILQLVKKG------------------
ADDA_LISMH      ------SEVAQNYQKQFKEVLIDEYQDTNMVQETILRLVTNP------------------
ADDA_LISMO      ------SEVAQNYQKQFKEVLIDEYQDTNMVQETILRLVTNP------------------
ADDA_LISMF      ------SEVAKNYQKQFKEVLIDEYQDTNMVQETILRLVTNS------------------
ADDA_LISW6      ------SDVAKSYQKQFKEVLIDEYQDTNMVQETILLLVTNS------------------
ADDA_ANOFW      -----PSEAALYYRAQFAEVLVDEYQDTNMVQESILRLVSND------------------
ADDA_OCEIH      -----PSTVAMQLQRQFTEVLVDEYQDTNMVQETILQLISDR------------------
ADDA_PELTS      -----PSQVAHELQEKFVEVLVDEYQDINAVQETILQMVSRK------------------
ADDA_DESAP      -----PSPVAAGLREYYVEVLVDEYQDINAVQETILRLVSRQ------------------
ADDA_HELMI      -----PSSLALELKEHFAEVLTDEYQDTNTVQETILTLLSRN------------------
ADDA_THEP3      -----PSEVALHYREKFEEIFVDEYQDSNLIQEEILSIIARENP----------------
ADDA_THEPX      -----PSEVALHYREKFEEIFVDEYQDSNLIQEEILSIIARENP----------------
ADDA_CALS4      -------EVVSYYREKFEEIFIDEYQDSSLIQEAILSLIARDNP----------------
ADDA_CLOBH      -----PSDIALDYRKKFAEVLIDEYQDSNLVQEVIMSMVSRVKGYWSFYNGQLMFNEEEI
ADDA_CLOB1      -----PSDIALDYRKKFAEVLIDEYQDSNLVQEVIMSMVSRVKGYWSFYNGQLMFNEEEI
ADDA_CLOBL      -----PSDIALNYRKKFAEVLIDEYQDSNLVQEVIMSMVSRVKGYWSFYNGQLIFNEEEI
ADDA_CLOBM      -----PSDTALDYRKKFTEVLIDEYQDSNLVQEVIMSMVSRVKGYWSFYNGQLMFNEEEI
ADDA_CLONN      -------EVALKLRQKYIEILVDEYQDSNYVQEAIINSIARR-------------HEETG
ADDA_CLOD6      -----PSDIAVGYRNKFYEIFIDEYQDSNLVQEVLLKAVANT------------------
ADDA_CLOB8      -----PSSIAMNFKEYFDEVLVDEYQDSNNVQETIINLVSRKND----------------
ADDA_CLOBB      -----PSTIAQKFKDYFEEVLVDEYQDSNNVQEAIIELVSRKNS----------------
ADDA_CLOPE      -----PSQVALEFKDRFEEVLVDEYQDSNTIQETIVGMVSRRDI----------------
ADDA_CLOPS      -----PSQVALEFKDKFEEVLVDEYQDSNTIQETIVGMVSRRDV----------------
ADDA_ACET2      -----PSRTAISYRERFAEILVDEYQDSNLVQETIINMISKGDD----------------
ADDA_RUMCH      -----PTKIAQNYKDKFTEILVDEYQDSNLVQEIIINMISKKDI----------------
ADDA_ALKOO      -------LAAQEYREKFEYIFVDEYQDSNIVQETLIQSIKRED-----------------
ADDA_ALKMQ      -------LVAQEYQQRFEYIFVDEYQDSNIVQETLIQSIKRKD-----------------
ADDA_SYNWW      -------AVAREYRDYYSYLFIDEYQDSNLVQETILNYIKKED-----------------
ADDA_STAEQ      -----PSRIAETYREHFKEILVDEYQDTNRVQEKILSCIKTGEE----------------
ADDA_STAES      -----PSRIAETYREHFKEILVDEYQDTNRVQEKILSCIKTGEE----------------
ADDA_STAAN      -----PSEIAESYRQHFQEILVDEYQDTNRVQEKILSCIKTGDE----------------
ADDA_STAA8      -----PSEIAESYRQHFQEILVDEYQDTNRVQEKILSCIKTGDE----------------
ADDA_STAAB      -----PSEIAESYRQHFQEILVDEYQDTNRVQEKILSCIKTGDE----------------
ADDA_STAS1      -----PSEIADMYRKQFEEILVDEYQDTNRVQEKIIACIKRGDE----------------
ADDA_STAHJ      -----ASPIAKEYRSQFEEILVDEYQDTNQVQEAIISKIKRGDE----------------
ADDA_LEVBA      ------RQVAAQLRHQFAEIMVDEYQDTNGLQEAILTAIAEPAPQ---------------
ADDA_LACPL      ------QAALAQLRAQFEEVMVDEYQDINSLQESILQLLARDQP----------------
ADDA_LACS1      ------RRVKERLKNKFKEIMVDEYQDTNQLQETILTTIAHKNP----------------
ADDA_PEDPA      ------QAIRRDFQQKFNEVIVDEYQDINPLQETILTSVASPDP----------------
ADDA_ENTFA      -----ASEASVYYREKFDEVLVDEYQDINQLQESILYWLRRPLSTE--------------
ADDA_LACCB      -----GAPIADNYRASFDEVMVDEYQDISPLQEALLAAVSTTTP----------------
ADDA_LACH4      ------QMARDFYQNKFKEILIDEYQDINALQERIIQQIKSEKK----------------
ADDA_LACAC      ------QMAREFYQNKFKEILIDEYQDINALQERIIQQVKNTDK----------------
ADDA_LACJO      ------HIAQEYYQEKFNEILIDEYQDVNALQENIIAAIKKKGQ----------------
ADDA_LACDA      ------DLARAYYQSRFKEIMVDEYQDTNALQDGLIQRLKKAGK----------------
ADDA_LACDB      ------DLARAYYQSRFKEIMVDEYQDTNALQDGLIQRLKKAGK----------------
ADDA_STRMU      -------AIRQLYIDKYHEVMVDEYQDNNHTQERMLELLSNG------------------
ADDA_STRA3      -------DIRQLYQDKYHEVMVDEYQDNNHTQERMLELLSNG------------------
ADDA_STRP3      -------DIRQSYQQHYHEVMVDEYQDNNHMQERLLTLLSNG------------------
ADDA_STRPF      -------DIRQSYQQHYHEVMVDEYQDNNHMQERLLTLLSNG------------------
ADDA_STRPM      -------DIRQSYQQHYHEVMVDEYQDNNHMQERLLTLLSNG------------------
ADDA_STRP8      -------DIRQSYQQHYHEVMVDEYQDNNHMQERLLTLLSNG------------------
ADDA_STRP1      -------DIRQSYQQHYHEVMVDEYQDNNHMQERLLTLLSNG------------------
ADDA_STRPZ      -------DIRQSYQQHYHEVMVDEYQDNNHMQERLLTLLSNG------------------
ADDA_STRS7      -------DIRQAYQGHYHEVMVDEYQDNNHMQERLLELLSNG------------------
ADDA_STRU0      -------AIRKVYQSKYHEVMVDEYQDNNHMQECLLELLSNG------------------
ADDA_STRT2      -------EVAVSYRDRYHEVMVDEYQDNSHTQERMLELLSNG------------------
ADDA_STRSY      -------DIRQFFQEKYHEVMVDEYQDNNHSQERMLDLLSNG------------------
ADDA_STRPI      -------QVRESYQERFHEVMVDEYQDTNHIQERMLELLSNG------------------
ADDA_STRR6      -------QVRESYQERFHEVMVDEYQDTNHIQERMLELLSNG------------------
ADDA_STRP4      -------QVRESYQERFHEVMVDEYQDINHIQERMLELLSNG------------------
ADDA_STRSV      -------EVRRFYQERYHEVMVDEYQDTNHTQERMLDLLSRG------------------
ADDA_LACLS      -------DIRENLREHYDEIMIDEYQDTSHTQERMLELLSNG------------------
ADDA_LACLA      -------DIRETLREHYDEIMIDEYQDTSHTQERMLELLSNG------------------
ADDA_CARHZ      -----------ELREKYVEILVDEYQDINGLQEEILTYVSRDGQ----------------
ADDA_LACF3      AKRQAAAQVQAELQRHYKEIMIDEYQDTNRLQDDLLRLLHKSGQ----------------
                                :  :: ***** .  *: ::  :                     

ADDA_LEUMM      -----------HNMYMVGDVKQSIYGFRQAEPSLFTNKYKQFAKKESDDIR---------
ADDA_OENOB      -----------SNFFMVGDLKQSIYGFRQADPVNFSNKYIQYKE-GNGGEL---------
ADDA_DESHD      ---------GKANLFMVGDVKQSIYRFRMADPGLFLRKYGEFPHYQEGGGA---------
ADDA_LACP7      ---------GCPNVFMVGDVKQSIYKFRMARPELFMEKYEQYSTEE--------------
ADDA_BACAH      -------SESEGNLFMVGDVKQSIYRFRLAEPGLFLGKYKRFTQEGLGGGM---------
ADDA_BACAN      -------SESEGNLFMVGDVKQSIYRFRLAEPGLFLGKYKRFTQEGLGGGM---------
ADDA_BACC7      -------SESEGNLFMVGDVKQSIYRFRLAEPGLFLGKYKRFTQEGLGGGM---------
ADDA_BACC4      -------SESEGNLFMVGDVKQSIYRFRLAEPGLFLGKYKRFTQEGLGGGM---------
ADDA_BACMK      -------FESEGNLFMVGDVKQSIYRFRLAEPGLFLGKYKRFTQEGSGGGM---------
ADDA_BACCN      -------SEQEGNLFMVGDVKQSIYRFRLAEPGLFLGKYKRFTQEGLEGGM---------
ADDA_BACSU      -------PEETGNLFMVGDVKQSIYRFRLAEPLLFLSKYKRFTESGEGTGR---------
ADDA_BACLD      -------EEHEGNLFMVGDVKQSIYRFRLAEPLLFLSKYKRFTDDGSGSGQ---------
ADDA_BACP2      -------HSSEGNLFMVGDVKQSIYRFRLAEPMLFLNKYKHFQPDGKETGK---------
ADDA_GEOTN      -------SERTGNLFMVGDVKQSIYRFRLAEPMLFLDKYKRFTADGEAGGM---------
ADDA_LISMH      -------SEAQGNLFMVGDVKQSIYRFRLAEPTLFMTKYQTFQQDGSGNGI---------
ADDA_LISMO      -------SEAQGNLFMVGDVKQSIYRFRLAEPTLFMTKYQTFQQDGSGNGI---------
ADDA_LISMF      -------GEEQGNLFMVGDVKQSIYRFRLAEPTLFMTKYQTYQQDGNGSGI---------
ADDA_LISW6      -------EESKGNLFMVGDVKQSIYRFRLAEPTLFMTKYQEYQQNGEGEGI---------
ADDA_ANOFW      -------DEATGNMFMVGDVKQSIYGFRLAEPSLFLQKYNRFTKDGDG-GL---------
ADDA_OCEIH      --------QGSGNMFMVGDVKQSIYRFRHAEPSLFIDKYKRFS-NSDDPSI---------
ADDA_PELTS      -------GEGQSNLFMVGDVKQSIYRFRLAEPGLFLKKYASFSAGTGGGQ----------
ADDA_DESAP      -------DAAAPNLFMVGDVKQSIYRFRLAEPALFLEKYRAFDTGEDAGG----------
ADDA_HELMI      ------------NRFMVGDVKQSIYRFRLAEPNLFLEKYRSFSPYDTPGPVNSDHGAPDH
ADDA_THEP3      -----------PNRFMVGDVKQSIYRFRQANPYIFFEKYNSYSLDTGEKNQ---------
ADDA_THEPX      -----------PNRFMVGDVKQSIYRFRQANPYIFFEKYNSYSLDTGEKNQ---------
ADDA_CALS4      -----------PNRFMVGDVKQSIYRFRQANPYIFFEKYTSYSQEG--ENK---------
ADDA_CLOBH      NLEEPQICLDIPNRFMVGDVKQSIYRFRQAKPEIFLDKYNEYSEEEGTKNR---------
ADDA_CLOB1      NLEEPQICLDIPNRFMVGDVKQSIYRFRQAKPEIFLDKYNEYSEEEGTKNR---------
ADDA_CLOBL      NLEEPQIGLDIPNRFMVGDVKQSIYRFRQAKPEIFLDKYNEYNEEEDRKNR---------
ADDA_CLOBM      NLEEPHIGLDIPNRFMVGDVKQSIYRFRQAKPEIFLDKYNEYSEEESIKNR---------
ADDA_CLONN      NPI---------NVFMVGDVKQSIYRFRQAKPELFLKKYNSYLEGENAKER---------
ADDA_CLOD6      ---------ETPNRFMVGDVKQSIYRFRQAKPELFLQKYNNYNDKKGSSHR---------
ADDA_CLOB8      ---------DNPNVFMVGDVKQSIYRFRQAKPELFIEKYNTYDSSNGV-NR---------
ADDA_CLOBB      ---------DNPNVFMVGDVKQSIYKFRQAKPELFIDKYNSYSLDKGI-NR---------
ADDA_CLOPE      ---------ENPNVFMVGDVKQSIYKFRQANPELFLEKYINYREFEDS-NR---------
ADDA_CLOPS      ---------ENPNVFMVGDVKQSIYKFRQANPELFLEKYINYREFEDS-NR---------
ADDA_ACET2      ---------ASPGVFMVGDVKQSIYRFRQARPELFLEKYNTYLPDKGSPCR---------
ADDA_RUMCH      ---------GSPNVFMVGDVKQSIYRFRQAKPELFLEKYNNYSIDEDSSYR---------
ADDA_ALKOO      ------------NLFMVGDVKQSIYRFRLADPTLFIEKYETFGTEEGHINR---------
ADDA_ALKMQ      ------------NLFMVGDVKQSIYRFRLADPSLFIEKYETFGEKEGDINR---------
ADDA_SYNWW      ------------NLFMVGDVKQSIYRFRLADPSLFLEKQKSYPLQDGSVNR---------
ADDA_STAEQ      ---------HDGNLFMVGDVKQSIYKFRQADPSLFIEKYNRFSSSGNESGL---------
ADDA_STAES      ---------HDGNLFMVGDVKQSIYKFRQADPSLFIEKYNRFSSSGNESGL---------
ADDA_STAAN      ---------HNGNLFMVGDVKQSIYKFRQADPSLFIEKYQRFTIDGDGTGR---------
ADDA_STAA8      ---------HNGNLFMVGDVKQSIYKFRQADPSLFIEKYQRFTIDGDGTGR---------
ADDA_STAAB      ---------HNGNLFMVGDVKQSIYKFRQADPSLFIEKYQRFTIDGDGTGR---------
ADDA_STAS1      ---------ADGNLFMVGDVKQSIYKFRQADPSLFIGKYNRFTLDGSEHGM---------
ADDA_STAHJ      ---------SNGNLFMVGDVKQSIYKFRQADPTLFMDKYHRFTKDGDQSGL---------
ADDA_LEVBA      -----------GNLFMVGDVKQSIYRFRQADPTLFMTKTDQYAADAAAG-----------
ADDA_LACPL      -----------GNMFMVGDVKQSIYQFRLADPLLFLHKYHDFGTNPEHG-----------
ADDA_LACS1      -----------GNMFMVGDVKQSIYGFRLADPGLFLKKYQSFATDDNDD-----------
ADDA_PEDPA      -----------GNMFMVGDVKQSIYAFRMADPSLFISKNNQFKDEEQAD-----------
ADDA_ENTFA      -----------GNLFMVGDVKQSIYSFRLADPTLFIEKYNQYG-QGKEG-----------
ADDA_LACCB      -----------GDRFMVGDVKQSIYGFRLADPQLFIHKYQTFQDAPTDPAA---------
ADDA_LACH4      -----------NTLFMVGDVKQSIYGFRQAEPSLFLQKYHQFAEDENEHE----------
ADDA_LACAC      -----------NTLFMVGDVKQSIYGFRQAEPSLFLKKYHGFASEENKHE----------
ADDA_LACJO      -----------NNLFMVGDIKQSIYGFRQARPDLFLSKYHAYG--QNDDS----------
ADDA_LACDA      -----------NNLFMVGDVKQSIYGFRQAEPSLFIAKYDEYGQENSAGK----------
ADDA_LACDB      -----------NNLFMVGDVKQSIYGFRQAEPSLFIAKYDEYGQENSAGK----------
ADDA_STRMU      -----------RNRFMVGDIKQSIYRFRQADPQIFNQKFKDFQEHPEHGKL---------
ADDA_STRA3      -----------HNRFMVGDIKQSIYRFRQADPQIFNDKYKAYQDNPSQGKL---------
ADDA_STRP3      -----------HNRFMVGDIKQSIYRFRQADPQIFNQKFRDYQKKPEQGKV---------
ADDA_STRPF      -----------HNRFMVGDIKQSIYRFRQADPQIFNQKFRDYQKKPEQGKV---------
ADDA_STRPM      -----------HNRFMVGDIKQSIYRFRQADPQIFNQKFRDYQKKPEQGKV---------
ADDA_STRP8      -----------HNRFMVGDIKQSIYRFRQADPQIFNQKFRDYQKKTEQGKV---------
ADDA_STRP1      -----------HNRFMVGDIKQSIYRFRQADPQIFNQKFRDYQKKPEQGKV---------
ADDA_STRPZ      -----------HNRFMVGDIKQSIYRFRQADPQIFNQKFRDYQKKTEQGKV---------
ADDA_STRS7      -----------HNRFMVGDIKQSIYRFRQADPQIFNQKFKDYQSNPEHGKL---------
ADDA_STRU0      -----------HNRFMVGDIKQSIYRFRQADPQIFNQKFKDYQENPENGKL---------
ADDA_STRT2      -----------HNRFMVGDIKQSIYRFRQADPQIFNDKFQLFLENPDAGKL---------
ADDA_STRSY      -----------HNRFMVGDIKQSIYRFRQADPMIFQEKFELYQANPQSGKL---------
ADDA_STRPI      -----------HNRFMVGDIKQSIYRFRQADPQIFNEKFQRYAQNPQEGKL---------
ADDA_STRR6      -----------HNRFMVGDIKQSIYRFRQADPQIFNEKFQRYAQNPQEGRL---------
ADDA_STRP4      -----------HNRFMVGDIKQSIYRFRQADPQIFNEKFQRYAQNPQEGKL---------
ADDA_STRSV      -----------KNRFMVGDIKQSIYRFRQADPQIFSDKFKAYQEDSSQGKL---------
ADDA_LACLS      -----------HNLFMVGDIKQSIYGFRLADPGLFLEKYKSYDQAENPNQL---------
ADDA_LACLA      -----------HNLFMVGDIKQSIYGFRLADPGLFLEKYKDYAKTENPNQL---------
ADDA_CARHZ      ------------NLFMVGDVKQSIYRFRWARPEIFLKKYEDFTDEKK-------------
ADDA_LACF3      -----------NHRFMVGDMKQSIYRFRQADPTLFKDYYDQFSADGQSSEA---------
                              :****:***** ** * *  *      :                  

ADDA_LEUMM      -------------IDLADNFRSQNNVTNITNLIFTQIMDETLGDIAYAGEAKL-VPKAAY
ADDA_OENOB      -------------IELSENYRSQHNVADFTNAVFRKLMDRKLGGIDYRGDVELKAANRDY
ADDA_DESHD      --------APNLVIDLNQNFRSRPEVIQGINYLFYQIMTEGAGEIVYDEQAALRPGAKFV
ADDA_LACP7      --------GLYRRIDLSKNFRSRAEVLDSINGVFEKIMTKAMGGIEYTKEVSLYPGAQFP
ADDA_BACAH      ------------KIDLAKNFRSRHEVLAGTNFIFKQIMGEEVGEIDYDADAELKLGASYP
ADDA_BACAN      ------------KIDLAKNFRSRHEVLAGTNFIFKQIMGEEVGEIDYDADAELKLGASYP
ADDA_BACC7      ------------KIDLAKNFRSRHEVLAGTNFIFKQIMGEEVGEIDYDADAELKLGASYP
ADDA_BACC4      ------------KIDLAKNFRSRHEVLAGTNFIFKQIMGEEVGEIDYDADAELKLGATYP
ADDA_BACMK      ------------KIDLAKNFRSRHEVLAGTNFIFKQIMGEEVGEIDYDADAELKLGASYP
ADDA_BACCN      ------------KIDLAKNFRSRHEVLAGTNFIFKQIMGEEVGEIEYDADAELKLGASYP
ADDA_BACSU      ------------KIDLNKNFRSRADILDSTNFLFKQLMGGKIGEVDYDEQAELKLGAAYP
ADDA_BACLD      ------------KIDLNKNFRSRSDILDSTNFLFKQLMGEKVGEVEYDEQAELKLGASYP
ADDA_BACP2      ------------RIDLNKNFRSRSDVLDSTNFLFKQLMGETVGEIEYDEQAELKLGASYP
ADDA_GEOTN      ------------KIDLASNFRSRAEVLDGTNFLFAQIMGEAVGEMVYDEAAQLKYGADYP
ADDA_LISMH      ------------RIDLSQNFRSRKEVLDATNFIFRQLMDKHIAEIDYDTAAELTLGAKSP
ADDA_LISMO      ------------RIDLSQNFRSRKEVLDATNFIFRQLMDKHIAEIDYDTAAELTLGANFP
ADDA_LISMF      ------------RIDLSQNFRSRKEVLDATNFIFHQLMDKHIAEIDYDAAAELTLGASFP
ADDA_LISW6      ------------RIDLSQNFRSRKEVLDATNFIFHQLMDKHVAEIDYDEAAELTLGANFP
ADDA_ANOFW      ------------RIDLAKNFRSRKEILDGTNFIFRQLMTETVGDMRYDDDAALRFGAQDY
ADDA_OCEIH      ------------RIDLARNFRSRENVLLGANYIFRQLFDEDLGEISYDDAAELIYGNKMY
ADDA_PELTS      ----------GRRLALTANFRSRQGVVSAVNFIFKQIMTPAVGEMAYGSDAMLVYGADYP
ADDA_DESAP      ----------ARRIDLSHNFRSRESIIHAVNAVFRRIMTPAVGELAYDTAAELVCGGT-P
ADDA_HELMI      AFSGQGASVPGARIDLAKNFRSRRNVLSAVNDLFRRIMTPRAGEMAYDRQAELVYGAAFP
ADDA_THEP3      ------------KILLYKNFRSRIEVIEAINYIFKKIMSKNIGEVNYTEEEKLNYGAE--
ADDA_THEPX      ------------KILLYKNFRSRIEVIEAINYIFKKIMSKNIGEVNYTEEEKLNYGAE--
ADDA_CALS4      ------------KILLYKNFRSRKEIIDAVNYIFEKIMSKNIGEVDYSEEEKLNYGAN--
ADDA_CLOBH      ------------KVKLFKNFRSRKEVINGVNYLFKQIMSKTIGELDYTEEEALKVGAS--
ADDA_CLOB1      ------------KVKLFKNFRSRKEVINGVNYLFKQIMSKTIGELDYTEEEALKVGAS--
ADDA_CLOBL      ------------KVKLFKNFRSREEVINGVNYLFKQIMSKTIGELDYTEEEALKVGAS--
ADDA_CLOBM      ------------KVKLFKNFRSREEVINGVNYLFKQIMSKTIGELDYTEEEALKVGAS--
ADDA_CLONN      ------------KVNLFKNFRSRKEVLDGVNFIFKQIMSENIGELEYGDDEALYLGAD--
ADDA_CLOD6      ------------KIMLYKNFRSREEVVDAVNYIFENIMNENIGEIEYTEKERLNLGAN--
ADDA_CLOB8      ------------KIQLYKNFRSRREIIDGVNYIFKEVMSEVVGELEYTDEEALNLGAD--
ADDA_CLOBB      ------------KIQLYKNFRSREEIINGVNYIFKSVMSKTVGELEYTDVEALNLGAN--
ADDA_CLOPE      ------------KIMLYKNFRSREEIINGVNYIFKTLMSNTVGELEYDEKEALNLGAS--
ADDA_CLOPS      ------------KIMLYKNFRSREEIINGVNYIFKTLMSNTVGELEYDEKEALNLGAS--
ADDA_ACET2      ------------KIILSRNFRSRREVIDAVNFLFKQIMSTGAGELDYTDAEALNFGAV--
ADDA_RUMCH      ------------KILLFKNFRSRKDVVDGINYIFKQIMSQKVGELDYNEIEELNPGAG--
ADDA_ALKOO      ------------RIDLAKNFRSRGQVLNGVNYIFKHMMSKELGEIDYDERAALYQGTE--
ADDA_ALKMQ      ------------RIDLAKNFRSRGEVLAGVNYLFKYIMSKELGEIGYDHRAALYQGAS--
ADDA_SYNWW      ------------RVDLNKNFRSHPEILNAVNYIFRHLMSEELGEIDYDEKSYLYPGLNTG
ADDA_STAEQ      ------------RIDLSQNFRSRQEVLSTTNYLFKHMMDEQVGEISYDDAAQLYFGAP-Y
ADDA_STAES      ------------RIDLSQNFRSRQEVLSTTNYLFKHMMDEQVGEISYDDAAQLYFGAP-Y
ADDA_STAAN      ------------RIDLSQNFRSRKEVLSTTNYIFKHMMDEQVGEVKYDEAAQLYYGAP-Y
ADDA_STAA8      ------------RIDLSQNFRSRKEVLSTTNYIFKHMMDEQVGEVKYDEAAQLYYGAP-Y
ADDA_STAAB      ------------RMDLSQNFRSRKEVLSTTNYIFKHMMDEQVGEVNYDESAQLYYGAP-Y
ADDA_STAS1      ------------RIDLSQNFRSREEVLTTTNYLFKHMMDEAVGEIVYDDAAQLYYGAP-F
ADDA_STAHJ      ------------RIDLSKNFRSRKEVLATTNYLFDHMMDEEVGEIEYDADARLYFGATKY
ADDA_LEVBA      -----------ELIVLAENFRSMKNVDDFTNLIFKQLMDRELGEIDYTGAAQLKFGASYY
ADDA_LACPL      -----------ERIVLAENFRSVANVDHLTNLIFSQLMDAPVGQIDYDEAAYLKYGPKDY
ADDA_LACS1      -----------ERIILAENFRSMENVTAFTNLIFSQLMDEKVGEMAYDEDARLVYGAKYY
ADDA_PEDPA      -----------ERIILAENFRSMRNVDDFTNLIFNQVMDTEVGEIEYDDDAQLQFGAKYY
ADDA_ENTFA      -----------KRIILAENFRSRKDVLDFTNLVFSQLMDERVGQIAYDESAALVHGFDQF
ADDA_LACCB      ----------PERIILAENFRSTKNVLAFTNLIFSQIMDPEVGDLSYDNAAALRYGALDY
ADDA_LACH4      -----------ERILLSDNFRSTEPVTQTVNAVFKSILSTDFGGIDYQKEGQLIFGAKYY
ADDA_LACAC      -----------KRILLSDNFRSTEPVTKTVNQLFKSILSSDFGGIDYSKEGQLIFGAKYY
ADDA_LACJO      -----------EKIVLSDNFRSTQRVTKTVNSLFNPILTANFGGIDYKKEGQLQFGATYY
ADDA_LACDA      -----------QRIIFAENFRSSQPVTQAVNLIFDSLLTKDFGGIDYQKEGQLKFAAGYD
ADDA_LACDB      -----------QRIIFAENFRSSQPVTQAVNLIFDSLLTKDFGGIDYQKEGQLKFAAGYD
ADDA_STRMU      -------------ILLKENFRSQSEVLDATNSVFTHLMDEAVGEILYDDTHQLVAGSSAQ
ADDA_STRA3      -------------IILKENFRSQSEVLDSTNSVFTHLMDEEVGDILYDESHQLKAGSPRQ
ADDA_STRP3      -------------ILLKENFRSQSEVLNVSNAVFSHLMDESVGDVLYDEQHQLIAGSHAQ
ADDA_STRPF      -------------ILLKENFRSQSEVLNVSNAVFSHLMDESVGDVLYDEQHQLIAGSHAQ
ADDA_STRPM      -------------ILLKENFRSQSEVLNVSNAVFSHLMDESVGDVLYDEQHQLIAGSHAQ
ADDA_STRP8      -------------ILLKENFRSQSEVLNVSNAVFSHLMDESVGDALYDEQHQLIAGSHAQ
ADDA_STRP1      -------------ILLKENFRSQSEVLNVSNAVFSHLMDESVGDVLYDEQHQLIAGSHAQ
ADDA_STRPZ      -------------ILLKENFRSQSEVLNVSNAVFSHLMDESVGDVLYDEQHQLIAGSHAQ
ADDA_STRS7      -------------ILLKENFRSQSEVLNVTNAVFSRLMDESLGEITYDDKHQLVAGSEAQ
ADDA_STRU0      -------------ILLKENFRSQSEVIDATNAVFSHLMDEAVGDILYDDNHYLKAGSDKQ
ADDA_STRT2      -------------ILLKENFRSQSEVLDATNGVFSHLMDQEIGDILYDKTHMLVAGSQKQ
ADDA_STRSY      -------------ILLKENFRSQIEVLEATNAIFTRLMDRQVGEIKYDDTHSLVAGSPGQ
ADDA_STRPI      -------------ILLKENFRSSSEVLSATNDVFERLMDQEVGEINYDNKHQLVFAN-TK
ADDA_STRR6      -------------IILKENFRSSSEVLSATNDVFERLMDQEVGEINYDNKHQLVFAN-TK
ADDA_STRP4      -------------ILLKENFRSSSEVLSATNDVFERLMDQEVGEINYDNMHQLVFAN-TK
ADDA_STRSV      -------------IVLKENFRSHLEVLEATNDVFKRLMDEEVGEIDYNETHYLVAGNPAK
ADDA_LACLS      -------------IRLKENFRSRGEVLNFTNDIFKHLMDEKLGEMTYGKEKALVQGNISD
ADDA_LACLA      -------------IRLKENFRSRGEVLTFTNDIFKHLMDEKLGEMTYGKEEALVQGNITD
ADDA_CARHZ      -------------IELSLNFRSREEIIATVNFIFKQIMKKRVAELSYDEKAFLKKGADYL
ADDA_LACF3      -------------LDLSDNYRSRHEVTDLVNLIFEQLMDQQLGEMVYDDKASLKPKADWG
                             : :  *:**   :    * :*  ::    .   *     *       

ADDA_LEUMM      PDD---------------------------VPAVFHMDIIVED-----------------
ADDA_OENOB      PKN---------------------------LKNVADISIFDID-----------------
ADDA_DESHD      SDGELRTAEGPIEV-------------HLFDPKAIDLSLGQKRGAEDAATEVDSPAKG--
ADDA_LACP7      EIG----MDLDNTS-------------FLFSDTKTELIILDLK--EEEASIPDSMDRL--
ADDA_BACAH      EGE----------------------------DVAAELLCIQQT-----------------
ADDA_BACAN      EGE----------------------------DVAAELLCIQQT-----------------
ADDA_BACC7      EGE----------------------------DVAAELLCIQQT-----------------
ADDA_BACC4      EGE----------------------------DVAAELLCIQQT-----------------
ADDA_BACMK      EGE----------------------------DVAAELLCIQQT-----------------
ADDA_BACCN      EGE----------------------------DVAAELLCIHQS-----------------
ADDA_BACSU      DND----------------------------ETETELLLIDN------------------
ADDA_BACLD      PNE----------------------------ATKTELLLIET------------------
ADDA_BACP2      ESK----------------------------DTTTEMLLVHLD-----------------
ADDA_GEOTN      EGT----------------------------DAVPEVMIIDRQ-----------------
ADDA_LISMH      ETN----------------------------AMATELLLIDMK-----------------
ADDA_LISMO      ETN----------------------------AMETELLLIDMK-----------------
ADDA_LISMF      ETT----------------------------DMATELLLIDMK-----------------
ADDA_LISW6      KSN----------------------------HMATELLLIDMK-----------------
ADDA_ANOFW      PDK----------------------------QIPVECVWINEA-----------------
ADDA_OCEIH      DDH----------------------P----LEAKPELLLIDNN-----------------
ADDA_PELTS      PVP----------------------EGQGNYEEAVELHLVERGPAGKDG-----------
ADDA_DESAP      AQL----------------------EGSG---PPVEVHLL----GAPTS-----------
ADDA_HELMI      ELP----------------------GRSG--DPVIELWLLQRQPDADGSEESIETQQNAN
ADDA_THEP3      ----YEIPPED------------SV-----TGGAVELHLIEKQKVEEEVEEKEEEKN---
ADDA_THEPX      ----YEIPPED------------SV-----TGGAVELHLIEKQKVEEEVEEKEEEKN---
ADDA_CALS4      ----YESNPFE------------KE-----NERTVEVHLIER--------EREEE-----
ADDA_CLOBH      ----YGEEVK---------------------GEPIELCLMDKKYEISEEVLK--------
ADDA_CLOB1      ----YGEEVK---------------------GEPIELCLMDKKYEISEEVLK--------
ADDA_CLOBL      ----YGEEVK---------------------GEPIELCLMDKKYEISEEVLK--------
ADDA_CLOBM      ----YGEEVK---------------------GEPIELCLMDKKYEISEEVLK--------
ADDA_CLONN      ----FEQYEDK------------SL-----VGGPIELNLIEK----SKDETK--------
ADDA_CLOD6      ----FNVDTDEK-----------SI-----IGGATEIHLIQKDNKLDDDIINDKDDRI--
ADDA_CLOB8      ----FKEN-----------KFKDTI-----VGGPIEVNIIDKSHNETVVE----------
ADDA_CLOBB      ----YPEK-----------KNDDDI-----IGGPIEVHILDRSDNKEENDEF--------
ADDA_CLOPE      ----YGELNEENVEKEYIDEIENLK-----VAGDIELNILNKAGNKDYSDED--------
ADDA_CLOPS      ----YGELNEENVEKEYIDEIENLK-----VAGDIELNILNKAGNKDYSD-D--------
ADDA_ACET2      ----FDENAKED-----------IT-----VGGEVEFHLIQTEDEDKNFTFENEGEEG--
ADDA_RUMCH      ----FSPCQNEE-----------TV-----VGGAIELHLIETSVGDN--TVLSEGSEP--
ADDA_ALKOO      ----FEPIQDPS----------------------IEINLIEKNM----------------
ADDA_ALKMQ      ----FESIKEPS----------------------IEVNLIEKNM----------------
ADDA_SYNWW      QELKYQEIDKASSQ----EGKEKEN-----TAKRVEICILENNPDLITKLEENETEEREI
ADDA_STAEQ      DEVSHPVQLRALVE----------------------------------------------
ADDA_STAES      DEVSHPVQLRALVE----------------------------------------------
ADDA_STAAN      DESDHPVNLKVLVE----------------------------------------------
ADDA_STAA8      DESDHPVNLKVLVE----------------------------------------------
ADDA_STAAB      DESDHPVNLKVLIE----------------------------------------------
ADDA_STAS1      DHKPHDVQLNMLIE----------------------------------------------
ADDA_STAHJ      SDKSMPLELHALIQ----------------------------------------------
ADDA_LEVBA      PDTV---------------------------TSTAELLVYLTEDAPESAG----------
ADDA_LACPL      PADM---------------------------PQTTNLLLYQTETDKST------------
ADDA_LACS1      PEET---------------------------PIKAEVLVYESEDSSQE------------
ADDA_PEDPA      PDEV---------------------------QNNTEVMIYDDSQ----------------
ADDA_ENTFA      SEAA---------------------------DYSTELLIYEKKATESV------------
ADDA_LACCB      GDAH---------------------------PAVKVLLYSKATSDEDSSD----------
ADDA_LACH4      PKS----------------------------LPQASEVIVHEKKNNN-------------
ADDA_LACAC      PDA----------------------------LPKASEIIVHKKQKDI-------------
ADDA_LACJO      PTD----------------------------LPTASEYIFTDKKQTQA------------
ADDA_LACDA      PEAA---------------------------LPTETEVLYQEDSSAT-------------
ADDA_LACDB      PEAA---------------------------LPTETEVLYQEDSSAT-------------
ADDA_STRMU      KIPYPQN--------------------------ETQVLIYDTKD----------------
ADDA_STRA3      QERHPNN--------------------------KTQVLLLDTDE----------------
ADDA_STRP3      TVPYLDR--------------------------RAQLLLYNSDK----------------
ADDA_STRPF      TVPYLDR--------------------------RAQLLLYNSDK----------------
ADDA_STRPM      TVPYLDR--------------------------RAQLLLYNSDK----------------
ADDA_STRP8      TVPYLDR--------------------------RAQLLLYNSDK----------------
ADDA_STRP1      TVPYLDR--------------------------RAQLLLYNSDK----------------
ADDA_STRPZ      TVPYLDR--------------------------RAQLLLYNSDK----------------
ADDA_STRS7      KQLHPEN--------------------------RAQLLLYNTDQA---------------
ADDA_STRU0      KIRYPEN--------------------------NCQVLIYDTDQ----------------
ADDA_STRT2      KEPHPEN--------------------------ETEVLIYNSDE----------------
ADDA_STRSY      KIAQPKN--------------------------EMEYLIYDQQDS---------------
ADDA_STRPI      LTPNPDN--------------------------KAEFLLYDKDDT---------------
ADDA_STRR6      LTPNPDN--------------------------KAAFLLYDKDDT---------------
ADDA_STRP4      LTPNPDN--------------------------KAEFLLYDKDDT---------------
ADDA_STRSV      REPNPAN--------------------------RASFLIYEGSKE---------------
ADDA_LACLS      YPVEAEKD------------------------FYPELLLYKENTS---------------
ADDA_LACLA      YPVESEKD------------------------FYPELLLYKENTS---------------
ADDA_CARHZ      PNA----------------------------NCFAELHLIEGKPE---------------
ADDA_LACF3      ADRDQ------------------------ASPATPELLLFDGGVKKTTANPT--------
                                                                            

ADDA_LEUMM      ------------------------------AEEDLETDTE-----------VFEKRQAQY
ADDA_OENOB      ------------------------------EESNEDED--------------FNSRQAQI
ADDA_DESHD      ------------------------EGEEFEQNREPESGDDESS------LEEAETARIEA
ADDA_LACP7      ------------------------DVMALEEDAIELSKRE-----------------LEA
ADDA_BACAH      ---------------------------EEEVIDGEEGA-------------EVEKAQLEA
ADDA_BACAN      ---------------------------EEEVIDGEEGA-------------EVEKAQLEA
ADDA_BACC7      ---------------------------EEEVIDGEEGA-------------EVEKAQLEA
ADDA_BACC4      ---------------------------EEEVIDGEEGA-------------EVEKAQLEA
ADDA_BACMK      ---------------------------EEEVQDGEEGA-------------EVEKAQLEA
ADDA_BACCN      ---------------------------EEEVLDGEEGE-------------EVEKAQLEA
ADDA_BACSU      ---------------------------AEDTDASEEAE-------------ELETVQFEA
ADDA_BACLD      ---------------------------PSGAPG-EEAE-------------ELEAVQLEA
ADDA_BACP2      ---------------------------QQEAETGEERE-------------ELETVQFEA
ADDA_GEOTN      ---------------------------RTSEEDEEETA-------------ELEAAELES
ADDA_LISMH      ---------------------------TEDTETEDELSP-----------QELQKNQVES
ADDA_LISMO      ---------------------------TEDTETEDELSP-----------QELQKNQVES
ADDA_LISMF      ---------------------------SVESETEDELSP-----------QELQKNQVES
ADDA_LISW6      ---------------------------SNENESEDELSP-----------QELQKNQVEA
ADDA_ANOFW      ---------------------------KEESDEEEQED--------------VTAVQLEA
ADDA_OCEIH      ---------------------------SEDVEQSDNEETV----------EDLEKAQIEA
ADDA_PELTS      ---------------GGDDPAGEEADGGVEAVEEIEEE--------------LEAGQKEA
ADDA_DESAP      ---------------VGRDTAGTADD---EPDRSDEAD--------------LTAVQREA
ADDA_HELMI      ETKGAIDGDHKNIAKAGESPAQNTADVAGESPSDDAGEDAGQPTGGEEELLLLETAQYEA
ADDA_THEP3      ---------------------------EEKDFEEEEEDL-------------IDDIQVEA
ADDA_THEPX      ---------------------------EEKDFEEEEEDL-------------IDDIQVEA
ADDA_CALS4      -------------------------------FEEDEE-I-------------LDDMQVEA
ADDA_CLOBH      ------------------------------EYNVDEEEA-------------LDNIQLEG
ADDA_CLOB1      ------------------------------EYNVDEEEA-------------LDNIQLEG
ADDA_CLOBL      ------------------------------EYNVDEEEA-------------LDNIQLEG
ADDA_CLOBM      ------------------------------EYNMDEEEA-------------LDNIQLEG
ADDA_CLONN      ------------------------------EEESEEEEI-------------LSNIQVEA
ADDA_CLOD6      ---------------------------NNKENEIEEEEK-------------LDNIQLEA
ADDA_CLOB8      -------------------------------DNEEQEE--------------INNVILEG
ADDA_CLOBB      -------------------------------KLQAEEE--------------IGDVNLEA
ADDA_CLOPE      -------------------------------ELGEEEED-------------LDSIQLEA
ADDA_CLOPS      -------------------------------ELGEEEED-------------LDSIQLEA
ADDA_ACET2      ---------------------------RQADEGEEDEEM-------------LDSIQCEA
ADDA_RUMCH      ---------------------------MDEQDFPEEDEI-------------LDNIQKEA
ADDA_ALKOO      ---------------------------EIDEEMEEELQE-------------LADIEVEA
ADDA_ALKMQ      ---------------------------EIDEDIEEELQE-------------LADIEVEA
ADDA_SYNWW      PG-------------------------EAENDFIERIIE-------------MDNTEIEA
ADDA_STAEQ      ----------------------------ASSENSDLTG-----------------SEQEA
ADDA_STAES      ----------------------------ASSENSDLTG-----------------SEQEA
ADDA_STAAN      ----------------------------ADQEHSDLTG-----------------SEQEA
ADDA_STAA8      ----------------------------ADQEHSDLTG-----------------SEQEA
ADDA_STAAB      ----------------------------ADQEHSDLTG-----------------SEQEA
ADDA_STAS1      ----------------------------DAS--SDLNG-----------------SEQEA
ADDA_STAHJ      ----------------------------DKSSDNDLEK-----------------SEQEA
ADDA_LEVBA      ------------------------DADSEAMDATFQVDN---------------KHQGEV
ADDA_LACPL      -------------------------EDVSTDETNFSIDD---------------PAVGSI
ADDA_LACS1      -------------------------SDDEPVNEDFSIDN---------------KAQGQI
ADDA_PEDPA      -------------------------TDINDKEATPIISN---------------KNDGQL
ADDA_ENTFA      -------------------------EFPELQSPELLIED---------------KTEGEL
ADDA_LACCB      ------------------------ASELPGDADDNEPVD---------------IATGQT
ADDA_LACH4      ---------------------------------EKSENE---------------IDFSEI
ADDA_LACAC      ---------------------------------DNDNNG---------------IDFSEV
ADDA_LACJO      ------------------------------SFEENFGDE---------------MDFSEI
ADDA_LACDA      ----------------------------------DDDGE---------------LNQGDL
ADDA_LACDB      ----------------------------------DDDGE---------------LNQGDL
ADDA_STRMU      ----------------------------QQNQDLAVEDD------------SNQISLGEV
ADDA_STRA3      ----------------------------DDINDSDSQQ--------------YDISPAEA
ADDA_STRP3      ----------------------------DDGNAPSDSEG---------------ISFSEV
ADDA_STRPF      ----------------------------DDGNAPSDSEG---------------ISFSEV
ADDA_STRPM      ----------------------------DDGNAPSDSEG---------------ISFSEV
ADDA_STRP8      ----------------------------DDGNAPSDSEG---------------ISFSEV
ADDA_STRP1      ----------------------------DDGNAPSDSEG---------------ISFSEV
ADDA_STRPZ      ----------------------------DDGNAPSDSEG---------------ISFSEV
ADDA_STRS7      ---------------------------QEGTEEASTNDG---------------ISAGEV
ADDA_STRU0      ---------------------------KDNGEDEHDKEDERRTE------GQETLSPGEV
ADDA_STRT2      ---------------------------SSTSEDEEGPDQ--------------AISSGEI
ADDA_STRSY      ---------------------------ANSSTDAEEETP---------------LTAGEI
ADDA_STRPI      ---------------------------GEEE---ESQTE--------------TKLTGEM
ADDA_STRR6      ---------------------------GEEE---ESQTE--------------TKLTGEM
ADDA_STRP4      ---------------------------GEEE---ESQTE--------------TKLTGEM
ADDA_STRSV      ---------------------------SPEEEADEGLPQ--------------AVSAGEV
ADDA_LACLS      ---------------------------EEEIEDSEVKIS-----------------DGEI
ADDA_LACLA      ---------------------------DEETDESEVRIS-----------------DGEI
ADDA_CARHZ      ---------------------------EDINSNGEPEED-------------LTAVHREA
ADDA_LACF3      ---------------------------GEDAIVVRQPED---------------KVASEV
                                                                          . 

ADDA_LEUMM      ALLAERILKLRETS------IFDRKADPAGLRPVEYSDIAILTRAKS-GYIDLVSTLRAA
ADDA_OENOB      EIIAAKIQALVGQS------EIYDR-QSGKMRPLVYRDITILERSHS-WENDIQTIFKKY
ADDA_DESHD      RLVAARIQKMVLER-----EFQIHDKELGDYRPVQYADIVILMRSLASVASVYAEEFQKA
ADDA_LACP7      KAVAMRIKQLVHGERGF--SVTKRNGEEQDLKRCQYRDIVILLRTMSGWSETFTEILKQE
ADDA_BACAH      RLMAQRIKAMVDSG------YEVYDRKTDSMRPVQYRDFVILLRSMP-WAPQIMEELKLQ
ADDA_BACAN      RLMAQRIKAMVDSG------YEVYDRKTDSMRPVKYRDFVILLRSMP-WAPQIMEELKLQ
ADDA_BACC7      RLMAQRIKAMVDSG------YEVYDRKTDSMRPVQYRDFVILLRSMP-WAPQIMEELKLQ
ADDA_BACC4      RLMAQRIKAMVDSG------YEVYDRKNDSMRPVQYRDFVILLRSMP-WAPQIMEELKLQ
ADDA_BACMK      RLMAQRIKAMVDSG------YAVYDRKTDSMRPVQYRDFVILLRSMP-WAPQIMEELKLQ
ADDA_BACCN      RLIAQRIKAMVDSG------YTVYDRKTNEMRQVQYRDFVILLRSMP-WAPQIMEELKLQ
ADDA_BACSU      KAIAKEIRKLISSP------FKVYDGKKKTHRNIQYRDIVILLRSMP-WAPQIMEELRAQ
ADDA_BACLD      RAMAGQIRRLITEK------FQVYDAKAKASRNIQYRDIVVLLRSMP-WAPQIMDEFKQQ
ADDA_BACP2      RIIAKKIKELVEQP------FQVYDAKQQMTRNLQYRDIVILLRSMP-WAPQMMEELKKQ
ADDA_GEOTN      RLMAEKIKEIVSRP------FYVYDRSSGQQRRAMYRDIVVLVRSMT-NAPQMIEQLQAQ
ADDA_LISMH      RTIAMKIREMIDNK------FPIYDKKLKQNRPIQYRDIVILSRAMT-SAPDMEEAMKVQ
ADDA_LISMO      RAIAMKIREMIDNK------FPIYDKKLKQNRPIQYRDIIILSRAMT-SAPDMEEAMKVQ
ADDA_LISMF      RAIAMKIKEMIDNK------FPIFDKKMKQNRPIQYRDIVILARAMT-SAPDMEEAMKVQ
ADDA_LISW6      RAIATKIREMIDNK------FPIYDKKLQQNRSIQYRDIVILSRAMT-SAPDMEEAMKVQ
ADDA_ANOFW      RWIAKKIKQLLAEP------FFVYDRRLKGERRLMYRDIVILCRSMS-SASAMLEEFRKQ
ADDA_OCEIH      RAYAKQIKNWIGTPED-EIPMQVVDKATGKQRDLQYKDIVILMRSMT-WASTIADELQQQ
ADDA_PELTS      RLVARRIKELLGGSPGGEHALEIYDRELKKYRPLTYRDVAVLLRATAGYANSFVEEFRRE
ADDA_DESAP      RLVAGIIRRLAG---------------LGGECTVPYRDIVVLMRATTGKAGTYLEEFRRQ
ADDA_HELMI      RLAARRIEELMKS------AMPVYDREQGGYRPVCYRDIVILMRSTKGRADIFLEEFRAA
ADDA_THEP3      RVVAERIKQLFS------QNFMVYDKNIKSYRVVDYRDIVVLLRATDRWAPVFLEELTQA
ADDA_THEPX      RVVAERIKQLFS------QNFMVYDKNIKSYRAVDYRDIVVLLRATDRWAPVFLEELTQA
ADDA_CALS4      HVVGERIKGLFR------EGFKVYDKEIGGYRPVEYRDICVLLRATEKWAYAFEEEFVKM
ADDA_CLOBH      RLVAKKIQKLVGNNLEG-GL-KVFDKKLGEYRNLQYRDIVILMRATSNWAPIFVEELAKE
ADDA_CLOB1      RLVAKKIQKLVGNNLEG-GL-KVFDKKLGEYRNLQYRDIVILMRATSNWAPIFVEELAKE
ADDA_CLOBL      RLVAKKIQKLVGNNLEG-GL-KVFDKKLGEYRNLQYRDIVILMRATSNWAPVFVEELAKE
ADDA_CLOBM      RLVAKKIQKLVGNNLEG-GL-KVFDKKLGEYRNLQYRDIVILMRATSNWAPVFVEELAKE
ADDA_CLONN      RFVAKKINELVNPKIGE-PF-KVYDNELKAYRNVEYRDIVVLLRSTSNWAPVFTDEMKEN
ADDA_CLOD6      RMVGNIIKDLMKVNEDG-KIQKVYDKGIDGYRPVEFRDIVILLRATSAWAPVFADELMNM
ADDA_CLOB8      RIVAKRIKELMSKSEDE-QIFKVLDKESGEYRPLKYRDIVILLRATKNWSEPLLDELSAE
ADDA_CLOBB      RIIVKRINELISKKEG--NKFKVLDKDTGEYRDLKYKDIVILLRATKNWSEVLLDELGLA
ADDA_CLOPE      RIIGKKINELMNPEDG--SHYMVFDKDLGKYRKIKYKDIVILLRATKNWAETFVDELGTY
ADDA_CLOPS      RIIGKKINELMNPEDG--SHYMVFDKDLGKYRKIKYKDIVILLRATKNWADTFVDELGTY
ADDA_ACET2      RLVGRRILELMKPDENG-RYFSVFDKAKNEYRRVEYRDVVILLRTTRNWAEVFVDELSVM
ADDA_RUMCH      RMVANRIIELFQADKDG-KKYAVYDKKLGEYRNVRFSDIVILLRTTRNWTEVFSAELANA
ADDA_ALKOO      RIVAKRIKALLNE--------EIYDPRVEGYRKIEYKDIVVLLRTTQNWAQSFLEVFVRE
ADDA_ALKMQ      RIIAKRIKDLLNE--------EIYDEKNEVYRRLEFKDIVVLLRTTKNWAQSFLEAFIRE
ADDA_SYNWW      LLIAQKIRQLIQE--------DIYDPELQCMRKIEYRDMVILLRATRNSAGIFMEQLSAE
ADDA_STAEQ      NYIVEQVKDIINHQ-------NVYDMKTGQYRKATYKDIVILERSFG-QARNLQQAFKNN
ADDA_STAES      NYIVEQVKDIINHQ-------NVYDMKTGQYRKATYKDIVILERSFG-QARNLQQAFKNN
ADDA_STAAN      HFIVEQVKDILEHQ-------KVYDMKTGSYRSATYKDIVILERSFG-QARNLQQAFKNE
ADDA_STAA8      HFIVEQVKDILEHQ-------KVYDMKTGSYRSATYKDIVILERSFG-QARNLQQAFKNE
ADDA_STAAB      HFIVEQVKDILEHQ-------KVYDMKTRSYRSATYKDIVILERSFG-QARNLQQAFKNE
ADDA_STAS1      EYIVQQVEKIMSQH-------EIYDIKTEQYRKPSYKDIVILERSYG-QARKIQQAFKDH
ADDA_STAHJ      RYIAEQVKYIIEHK-------QVYDMKSETYRQATFKDIVILERGLK-NARNLQQVFKDY
ADDA_LEVBA      LMVGQKIQQLIAD------QTPIYDREAKQVRPMTYGDITLLTPTRT-NNLIITDELRRL
ADDA_LACPL      TMVAQKILALKAQ------DKPIYERANGEYRPFRYSDVALLVPTRN-HNLTIIDVFKRY
ADDA_LACS1      VMTAKRIKELVEN------GEKIYDKKQGTIRPIEYRDIAILAPTRK-NNLILTEEFKRL
ADDA_PEDPA      QMIAQRIQKLFAD------HTQIYDKKEQKMRDLEYSDIALLHSTGS-NNLEIVDTFKKY
ADDA_ENTFA      YVTALKIRELIDQ------NFLIYDKKLKTDRPITYQDIVLLTPTKK-NNLTILDVFKSL
ADDA_LACCB      QLVLAEIQRLINDP-----DAQLWDRQAQEYRRIHYRDITLLTRQTS-QNSLIQTQFAAA
ADDA_LACH4      QMVLARIKQLEDE------HVQIFDSNTGKMRDMEYSDIAILTRSRS-DNLEIMQEFAKQ
ADDA_LACAC      EMVLARIKQLKKE------HFQVLDSTTGEVRALKYSDIAILTRSHG-DNLEIMQEFAKR
ADDA_LACJO      QMVIARIKQLKEE------NFQVWDRKTQLKRPLEYSDIAIITRTRS-DNLQVMQEFAKA
ADDA_LACDA      AMVISRIQKLIAD------QTPIFDPKTGQTRPVSYGDIAILTRSKT-SNLDIKQEFDRY
ADDA_LACDB      AMVISRIQKLIAD------QTPIFDPKTGQTRPVSYGDIAILTRSKT-SNLDIKQEFDRY
ADDA_STRMU      KLVAKEIIRLHNEEKVQ------------------FEDITLLVSSRT-RNDGILQTFDDY
ADDA_STRA3      KLVAKEIIRLHKEENVP------------------FQDITLLVSSRT-RNDGILQTFDRY
ADDA_STRP3      TIVAKEIIKLHNDKGVP------------------FEDITLLVSSRT-RNDIISHTFNQY
ADDA_STRPF      TIVAKEIIKLHNDKGVP------------------FEDITLLVSSRT-RNDIISHTFNQY
ADDA_STRPM      TIVAKEIIKLHNDKGVP------------------FEDITLLVSSRT-RNDIISHTFNQY
ADDA_STRP8      TIVAKEIIKLHNDKGVP------------------FEDITLLVSSRT-RNDIISHTFNQY
ADDA_STRP1      TIVAKEIIKLHNDKGVP------------------FEDITLLVSSRT-RNDIISHTFNQY
ADDA_STRPZ      TIVAKEIIKLHNDKGVP------------------FEDITLLVSSRT-RNDIISHTFNQY
ADDA_STRS7      TLVAKEIIRLYNEEKVA------------------FEDITLLVSSRT-RNDTIFQVFNQY
ADDA_STRU0      NILVKEIIRLHQEEAVP------------------FSDITLLVSSRT-RNDLLFKTFNQY
ADDA_STRT2      SLVIKEIIKLH-EQGVR------------------FEDITLLAPNRN-TYLDLMVSFEEH
ADDA_STRSY      EVVAKEIIRLHNEEGAD------------------FKDITLLVQKRT-HNDLIMSIFEKH
ADDA_STRPI      RLVIKEILKLHQEKGVA------------------FKEIALLTSSRS-RNDQILLALSEY
ADDA_STRR6      RLVIKEILKLHQEKGVA------------------FKEIALLTSSRS-RNDQILLALSEY
ADDA_STRP4      RLVIKEILKLHQEKGVA------------------FKEIALLTSSRN-RNDQILLALSEY
ADDA_STRSV      DLVIKEIIRLHNEEGVA------------------FKDITLLTASRT-RNDLILAAFEQH
ADDA_LACLS      KGAAQEIKKLI-ESGVE------------------PKDIAILVRSKS-NNNKIEDILLSY
ADDA_LACLA      KGAAQEIKKLI-EAGVE------------------PKDIAILVRSKS-NNNKIEDILLSY
ADDA_CARHZ      RLVAAKILKLKEEG------FKVFDRETKEFRPLQYRDIVILSRSLSNSSNIWQEELTRA
ADDA_LACF3      WLIGQRIRELLAKE-------TILDPETKRVRPITPGDIAILSRAKR-IHSVIAEQFAKL
                      :                              :. ::              :   

ADDA_LEUMM      GIPVQVE-GVGNYFQTMEVYLMLDILRVIDNPHQDIPLAAVLRSPVFNFDENELAAIRIA
ADDA_OENOB      HIPINV--AAGNFLQEFEVSIVLSFLKIIDNPHQDIPLVAVLRSPIYGLDENQLAEIRTA
ADDA_DESHD      GIPVYAE-TNSGYFGTNEVDTVLSLLKIIDNPRLDIPFAAVLRSPLVGMNGTELGKLRSL
ADDA_LACP7      GIPAYSD-TQTGYFQTLEVKTVLNYLRILDNPRQDAPLTAILYSPIVGLSAEQLSFLRVK
ADDA_BACAH      GIPVYAD-LATGYFEATEVNIMMNVFRVIDNPMQDIPLAAVLRSPIVGLNDEELATLRAH
ADDA_BACAN      GIPVYAD-LATGYFEATEVNIMMNVFRVIDNPMQDIPLAAVLRSPIVGLNDEELATLRAH
ADDA_BACC7      GIPVYAD-LATGYFEATEVNIMMNVFRVIDNPMQDIPLAAVLRSPIVGLNDEELATLRAH
ADDA_BACC4      GIPVYAD-LATGYFEATEVNIMMNVFRVIDNPMQDIPLAAVLRSPIVGLSDEELATLRAH
ADDA_BACMK      GIPVYAD-LATGYFEATEVNIMMNVFRVIDNPMQDIPLAAVLRSPIVGLNDEELATLRAH
ADDA_BACCN      GIPVYAE-LATGYFEATEVNIMMNVFRVIDNPVQDIPLAAVLRSPIVGLNDEELAMLRAH
ADDA_BACSU      GIPVYAN-LTSGYFEAVEVAVALSVLKVIDNPYQDIPLASVLRSPIVGADENELSLIRLE
ADDA_BACLD      GIPVYAN-LSTGYFEATEVSVTLSLLKIIDNAYQDIPLASVLRSPVVGLDENELSLIRIK
ADDA_BACP2      GIPVYAN-LSSGYFEATEVSVILSLLKVIDNPYQDIPLAAVLRSPLVHLDENELALIRTS
ADDA_GEOTN      GIPAAAD-LSSGYFQATEISVMLSLLKVIDNPYQDIPLAAVLRSPLFRFDENELAMIRLS
ADDA_LISMH      DIPFYAN-NNSGYFETTEVATMIALMKVVDNPYQDIPLAAVLRSPIIGLNEEELGQIRMA
ADDA_LISMO      DIPFYAN-NNSGYFETTEVATMIALMKVVDNPYQDIPLAAVLRSPIIGLNEEELGQIRMA
ADDA_LISMF      DIPFYAN-NNSGYFETTEVATMIALMKVIDNPYQDIPLAAVLRSPIIGLNEEELGQVRMA
ADDA_LISW6      DIPFYAS-NNSGYFETTEVATMIALLKVIDNPYQDIPLAAVLRSPIVGLNEEELGQIRMA
ADDA_ANOFW      NVPVYAE-LSSGYFSATEVSIMLSLLKVIDNPYQDIPLAAVLRSPIVGLDEEALARIRLA
ADDA_OCEIH      GIPTYAD-LSTGYFEAIEIKVMLSFLKVIDNPRQDIPLASILRSPIIGLEEDQLASIRLA
ADDA_PELTS      GIPAYAE-LSTGYFESTEVETVISLLKVIDNPRQDIPLAGVLRSPAVGLKAGDLARIRLA
ADDA_DESAP      NIPAYAK-VGTGYFEAVEVETVLSLLKVIDNPHQDIPLAGVLRSPLVGLGAAELAAVRLA
ADDA_HELMI      AIPAYAD-TGAGYFEATEVSILLSLLRVIDNPCQDIPLAAVLRSPIFRFTGEDLARIRLA
ADDA_THEP3      GIPAFAD-TGTGYFDTTEIKTIISLLQVIDNPMQDIPLLAVLRSPIFSFTEEELIDLRLE
ADDA_THEPX      GIPAFAD-TGTGYFDTTEIKTIISLLQVIDNPMQDIPLLAVLRSPIFSFTEEELIDLRLE
ADDA_CALS4      GIPVFAD-TNAGYFDTAEIKTMLSLLQVIDNPMQDIPLLAVLRSPIFSFTEEELVDIRLE
ADDA_CLOBH      GIPVFAD-TNSGYFDTAEIKTMISLLQIIDNPLQDIPLLSVLRSPIASFTDDELIDIRMV
ADDA_CLOB1      GIPVFAD-TNSGYFDTAEIKTMISLLQIIDNPLQDIPLLSVLRSPIASFTDDELIDIRMV
ADDA_CLOBL      GIPVFAD-TNSGYFDTAEIKTMISLLQIIDNPLQDIPLLSVLRSPIASFTDDELIDIRMI
ADDA_CLOBM      GIPVFAD-TNSGYFNTTEIKTIISLLQIIDNPLQDIPLLSVLRSPIASFTDDELIDIRMV
ADDA_CLONN      LIPAYAD-VGNGYFETVEIKTILSLLEIIDNPRQDIPLIAVLRSPIASFTPEELIDIRLE
ADDA_CLOD6      DIPTYAD-VGVGYFDTIEIKTILSLLQIIDNPMQDIPLISVLKSPIFGFTPEDLIDIRVQ
ADDA_CLOB8      GIPVYAD-TGSGYFESIEIRTIISLLKVVDNPMQDIPVISVMRSPIMGFSAEEISDIRLV
ADDA_CLOBB      GIPVYAD-TGSGYFESIEIRTIMSLLKVIDNPMQDVPMLSLLISPIIGLSAEELSDIRLI
ADDA_CLOPE      GIPVYAD-TGTGYFQTIEIRTILALLHIIDNPMQDIYILSALRSPIFSFTSEEFADLRLL
ADDA_CLOPS      GIPVYAD-TGTGYFQTIEIRTILALLHIIDNPMQDIYILSSLRSPIFSFTSEEFADLRLL
ADDA_ACET2      GIPVFAD-TGTGFFKTVEVQVMLSLLQIIDNPLQDIPLLSVLRSPIVGFTTDELAELRLV
ADDA_RUMCH      DIPVFAD-TGSGFFKTPEVQVVLSLLQIIDNPYQDIPLLAVLRSPIVNFSTADLTDVRLM
ADDA_ALKOO      GIPAYAD-ANTGYFEAIEVNMFLNLLRVIDNKRQDIPLLSVMRSPIGDFTTEELIHIRVN
ADDA_ALKMQ      GIPAYAD-ANTGYFEAIEVGMFLNLLKVIDNKRQDIPLISVMRSPIGEFTTAELIDIRIN
ADDA_SYNWW      GIPVYAD-ASSGYFDTLELNLFINLLRLIDNKRQDIALLSVMRSPIGGFSIDDFIKIRTK
ADDA_STAEQ      DIPFHVN-SKEGYFEQTEVRLVLSFLRTIDNPLQDIYLVGLMRSVIYQFTEEELAEIRVV
ADDA_STAES      DIPFHVN-SKEGYFEQTEVRLVLSFLRTIDNPLQDIYLVGLMRSVIYQFTEEELAEIRVV
ADDA_STAAN      DIPFHVN-SREGYFEQTEVRLVLSFLRAIDNPLQDIYLVGLMRSVIYQFKEDELAQIRIL
ADDA_STAA8      DIPFHVN-SREGYFEQTEVRLVLSFLRAIDNPLQDIYLVGLMRSVIYQFKEDELAQIRIL
ADDA_STAAB      DIPFHVN-SREGYFEQTEVRLALSFLRAIDNPLQDIYLVGLMRSVIYQFKEDELAQIRIL
ADDA_STAS1      NIPFHVN-SKEGYFEQTEVQLILSFLRTIDNPLQDIYLVGLMRSVIYQFTEDELSNIRVF
ADDA_STAHJ      NIPFHVN-SKEGYFEQTEVRLVLSFLRTVDNPLQDIYLVGLMRSVIYQFTEDELANIRVQ
ADDA_LEVBA      GIPVVVN-DARNYFKTTEIQIMMALLQIIDNPYQDIPLAAVLRSPIVGLNENELALLRIN
ADDA_LACPL      HIPVVVN-DAQNYFQTTEIRIMMALLSIIDNPYQDIPLVAVLRSPIVGLDENQLVYLRIQ
ADDA_LACS1      GVPIFVP-DAQNYFQTTELKIMMSFLQIIDNPYQDIPLVAVLRSPIVGLKENELAYLRIN
ADDA_PEDPA      GIPIQVN-NAQDYFQTTEVSIMMALLKIIDNPYQDIPLAAVLRSPMVGLKENELAFLRIG
ADDA_ENTFA      EIPVQVN-DAQNYFQATEIRTMIALLQLIDNPYQDIPLAAVLRSPIVGLKENELVLIRLA
ADDA_LACCB      GVPLFVA-DTKNFFKTTELMVMLALLKVIDNQKQDIPLVAVLRSPIVGLSADQLALIRLA
ADDA_LACH4      DIPLFVT-DAENYFQTFELTVMMNYLKIIDNPDQDIPLVTVLRSPLFNFDEKELAKIRIK
ADDA_LACAC      DIPLFIT-DAENYFQTFELTVIMNYLKIIDNPDQDIPLVTVLRSPLFNFSEKDLAKIRIN
ADDA_LACJO      DLPLFVT-DAQNYFQTFELVMIMNYLRLIDNPQQDIPLVAVLRSPLFNFKEPELAQIRVK
ADDA_LACDA      GVPLFVM-DVQNYFQTFELTVIMSYLKIIDNPDQDIPLVAVLRSPIFNFSSSDLAEIRLV
ADDA_LACDB      GVPLFVM-DVQNYFQTFELTVIMSYLKIIDNPDQDIPLVAVLRSPIFNFSSSDLAEIRLV
ADDA_STRMU      GIPLVTDGGEQNYLKSVEVMVMLDTLRSIDNPLNDYALVALLRSPMFAFDEDDLARLALQ
ADDA_STRA3      GIPLVTDGGEQNYLKSVEVMVMLDTLRSIDNPLNDYALVALLRSPMFGFNEDDLTRIAIQ
ADDA_STRP3      GIPIVTDGGQQNYLKSVEVMVMLDTLRTINNPRNDYALVALLRSPMFAFDEDDLARIALQ
ADDA_STRPF      GIPIVTDGGQQNYLKSVEVMVMLDTLRTINNPRNDYALVALLRSPMFAFDEDDLARIALQ
ADDA_STRPM      SIPIVTDGGQQNYLKSVEVMVMLDTLRTINNPRNDYALVALLRSPMFAFDEDDLARIALQ
ADDA_STRP8      GIPIVTDGGQQNYLKSVEVMVMLDTLRTINNPRNDYALVALLRSPMFAFDEDDLARIALQ
ADDA_STRP1      GIPIATDGGQQNYLKSVEVMVMLDTLRTINNPRNDYALVALLRSPMFAFDEDDLARIALQ
ADDA_STRPZ      GIPIVTDGGQQNYLKSVEVMVMLDTLRTINNPRNDYALVALLRSPMFAFDEDDLARIALQ
ADDA_STRS7      GIPLVADGGQENYLKSVEVMVMLDTLRSINNPLNDYALVALMRSPMFSFDEDQLARISLQ
ADDA_STRU0      DIPLVSDGGQENYLKSVEVMVMLDTLRSINNPLNDYALVALMRSPMFAFNEDQLARIALQ
ADDA_STRT2      GIPLVPDEYKSSYLESLEVMIMLDTLRAINNPLNDYALVALLRSPMFNFNEDDLTRIAVQ
ADDA_STRSY      GIPIVADGGAASYLQSLEVMIMLDTLRVINNPLNDYALVALLKSPMFRFDEDELTRISLQ
ADDA_STRPI      GIPVKTDGEQNNYLQSLEVQVMLDTLRVIHNPLQDYALVALMKSPMFGFDEDELARLSLQ
ADDA_STRR6      GIPVKTDGEQNNYLQSLEVQVMLDTLRVIHNPLQDYALVALMKSPMFGFDEDELARLSLQ
ADDA_STRP4      GIPVKTDGEQNNYLQSLEVQVMLDTLRVIHNPLQDYALVALMKSPMFGFDEDELARLSLQ
ADDA_STRSV      QIPLVPDDGAANYLQSVEVLVMLDTLRTINNPLNDYALTALLKSPMFDFGEDELARLSLQ
ADDA_LACLS      DIPVILDEGRVDFLKSMEVLIMLDILRAIDNPLYDLSLVAMLRSPLFGFNEDELTRISVQ
ADDA_LACLA      DIPVVLDEGRVDFLKSMEVLIMLDVLRAIDNPLYDLSLVAMLRSPLFGFNEDELTRISTQ
ADDA_CARHZ      GIPVYVE-GAGSFLNSKEILLMTSFLKVIDNPCQDVPLAAVLCSPVAGLTYEELWQVRKE
ADDA_LACF3      NLPVMVH-GVENYFKATEIRVVMSLLKVIDNPYQDVPLAAVLRSPLIQVAPEVAAKFGLS
                 :*        .::   *:      :  :.*   *  .   : *            .   

ADDA_LEUMM      ------DKMHDYWTALQAYAQQDQ------------------------------------
ADDA_OENOB      ------DMKHDYFSALQAYAKTGQDL----------------------------------
ADDA_DESHD      ------LPQGDFYETLVLTFWAGDAHRQE------EGHEFY-----------SEIREILG
ADDA_LACP7      ------PGKGAEKLSIYDAARECALNYLEIQDEVTQPEETQ-----------PVYDSIIQ
ADDA_BACAH      ------GKKGSFYEVMSSFLKGAPLE----------------------------------
ADDA_BACAN      ------GKKGSFYEVMSSFLKGAPLE----------------------------------
ADDA_BACC7      ------GKKGSFYEVMSSFLKGAPLE----------------------------------
ADDA_BACC4      ------GKKGSFYEVMSSFLKGAPLE----------------------------------
ADDA_BACMK      ------GKKGSFYEVMSSFLKGAPLE----------------------------------
ADDA_BACCN      ------AKKGSFYEVMRSFLRGAPLE----------------------------------
ADDA_BACSU      ------NKKAPYYEAMKDYLAAGDRS----------------------------------
ADDA_BACLD      ------DKKAPFYEAMKAYLAAADGD----------------------------------
ADDA_BACP2      ------DKKGTYYDAVKAFMSVTHSD----------------------------------
ADDA_GEOTN      ------DPKGTFFEALQAFCQKTAETG---------------------------------
ADDA_LISMH      ------KKKGYFYDALLAYKDITVSE----------------------------------
ADDA_LISMO      ------KKKGYFYDALLTYKDITVSE----------------------------------
ADDA_LISMF      ------KKNGYFYDALLTYKDTTVSE----------------------------------
ADDA_LISW6      ------KKKGYFFDALLAYKDITVSA----------------------------------
ADDA_ANOFW      ------KKDGAFYEALCAFVQEPHDD----------------------------------
ADDA_OCEIH      ------DRKASFYEAVQRYLQNEQDN----------------------------------
ADDA_PELTS      ------SPRGDFYDAVVAASLAGQ------------------------------------
ADDA_DESAP      ------DKEGDFFRAVVAAAGQG-------------------------------------
ADDA_HELMI      ------EPRKTFFDAIEAFIGQAEAAARDTF-----------------------------
ADDA_THEP3      ------DMEKTIYEAIKKASQ---------------------------------------
ADDA_THEPX      ------DMEKTIYEAIKKASQ---------------------------------------
ADDA_CALS4      ------DADGTIYEALKKASL---------------------------------------
ADDA_CLOBH      ------NKNITFYECMEIIYRLYKNEKLDSYY----------------------------
ADDA_CLOB1      ------NKNITFYECMEIIYRLYKNEKLDSYY----------------------------
ADDA_CLOBL      ------NKNITFYECMEIIYRLYKNEKLDSYY----------------------------
ADDA_CLOBM      ------NKNIAFYECMEIIYKLYKDEELDSYY----------------------------
ADDA_CLONN      ------NKDGDFYGGLLKVAS---------------------------------------
ADDA_CLOD6      ------SKDKIFYEVLKSTAEYDG------------------------------------
ADDA_CLOB8      ------KKDNYFYENIKYISE---------------------------------------
ADDA_CLOBB      ------DKEKYFYENIIKISK---------------------------------------
ADDA_CLOPE      ------NKDKYFFEIIKEVVD---------------------------------------
ADDA_CLOPS      ------NKDKYFFEIIKEVVD---------------------------------------
ADDA_ACET2      ------DKKALLFDALKKLAE---------------------------------------
ADDA_RUMCH      ------NRNASIFEALKETAV---------------------------------------
ADDA_ALKOO      ------DKTGTYYDAIEKYVE---------------------------------------
ADDA_ALKMQ      ------DKNGTYYDAIEKYIE---------------------------------------
ADDA_SYNWW      LIPRREKQPYSFYEAMEFYME---------------------------------------
ADDA_STAEQ      S-----PHDDYFYQSIKNYMIDEK------------------------------------
ADDA_STAES      S-----PHDDYFYQSIKNYMIDEK------------------------------------
ADDA_STAAN      S-----PNDDYFYQSIVNYINDEA------------------------------------
ADDA_STAA8      S-----PNDDYFYQSIVNYINDEA------------------------------------
ADDA_STAAB      S-----PNDDYFYQSIVNYINDEA------------------------------------
ADDA_STAS1      S-----PNDDYFYQSIKHYMANDV------------------------------------
ADDA_STAHJ      S-----MNDDYFYQSILHYMKDQE------------------------------------
ADDA_LEVBA      ------QRTGDYYQAVLHFQRSFVPNQAS-------------------------------
ADDA_LACPL      ------NKTSDYFQAVQDFYHHYPTGPAT-------------------------------
ADDA_LACS1      ------DKTGDYFQAVESFYDNFEVEKAS-------------------------------
ADDA_PEDPA      ------KKNGHYFEALLYFLNEAKLDSNN-------------------------------
ADDA_ENTFA      ------NKETSYYEAFLTFNQKMEPTME--------------------------------
ADDA_LACCB      ------AKQVPYYDAVTAFLQAEPKTPL--------------------------------
ADDA_LACH4      ------SKNSNFYSALTSYVGT--------------------------------------
ADDA_LACAC      ------SKNSGFYSAVASYVGI--------------------------------------
ADDA_LACJO      ------TRSGNFYNALTSFASV--------------------------------------
ADDA_LACDA      ------NKSVSFYAALRTYAKK--------------------------------------
ADDA_LACDB      ------NKSVSFYAALRTYAKK--------------------------------------
ADDA_STRMU      NLPD--QHKQNLYEKMENARNGQGQQVQ--------------------------------
ADDA_STRA3      DV------KMAFYHKVKLSYHKEGHHSD--------------------------------
ADDA_STRP3      KDNE--LDKDCLYDKMQRAVIGRGAHPE--------------------------------
ADDA_STRPF      KDNE--LDKDCLYDKIQRAVIGRGAHPE--------------------------------
ADDA_STRPM      KDNE--LDKDCLYDKIQRAVIGRGAHPE--------------------------------
ADDA_STRP8      KDNE--LDKDCLYDKIQRAVIGRGAHPE--------------------------------
ADDA_STRP1      KDNE--LDKDCLYDKIQRAVIGRGAHPE--------------------------------
ADDA_STRPZ      KDNE--LDKDCLYDKIQRAVIGRGAYPE--------------------------------
ADDA_STRS7      SSSQ--DQPQAFYDKLSNSLRGQGEHPG--------------------------------
ADDA_STRU0      DSQE--GKVEHFYEKVLNSLSHQGQHAE--------------------------------
ADDA_STRT2      AD------KGQFYDKLLAAHTKSGLHPE--------------------------------
ADDA_STRSY      AG------TGFFYQKMEIAQQASGQHPE--------------------------------
ADDA_STRPI      KAED--KVHENLYEKLVNAQKMASSQKG--------------------------------
ADDA_STRR6      KAED--KVHENLYEKLVNAQKMASSQKG--------------------------------
ADDA_STRP4      KAED--KAHENLYEKLVNAQKKASSQKG--------------------------------
ADDA_STRSV      ASQE--RSQENLYEKLVNALEGRGLNPA--------------------------------
ADDA_LACLS      GS-----RDLRFWDKILLSLKKEGKNPE--------------------------------
ADDA_LACLA      GS-----HDLRFWDKILLSLNKEGQNPE--------------------------------
ADDA_CARHZ      ------YPEGLLYDALKNKSLG--------------------------------------
ADDA_LACF3      QG----ENRIGFTEPELAYLKVNSTSKDFFGVVQQNYYAWRDQEVEAVENHDALTEEELA
                                                                            

ADDA_LEUMM      -------------------------KAQNFLNLIEKWHAIATQNDLVALIWAIYDDTAWL
ADDA_OENOB      ---------------------DLQKKMAAFLVQLENYREIAADNQIVDLIWQIYNDTNWP
ADDA_DESHD      KHWESLPQLEVKVRHILETSPEIKEKVDAFFPKLQEWRHRSRRTSLADLLWHLYEDTGYL
ADDA_LACP7      ADLMYEKSSAEKTVSMDKNLIETGEKLKRFFATYDKLREKAIYLPVHEIILEFFKETGYD
ADDA_BACAH      ------------------EEKELHDKLEWFYNLLQGWREFARQQSLSDLIWKVYGETGYY
ADDA_BACAN      ------------------EEKELHDKLEWFYNLLQGWREFARQQSLSDLIWKVYGETGYY
ADDA_BACC7      ------------------EEKELHDKLEWFYNLLQGWREFARQQSLSDLIWKVYGETGYY
ADDA_BACC4      ------------------EEQELHDKLEWFYNLLQGWREFARQQSLSDLIWKVYGETGYY
ADDA_BACMK      ------------------EEQELHDKLEWFYKLLQGWREFARQQSLSDLIWKVYGETGYY
ADDA_BACCN      ------------------GGKELHEKLKWFYHLLQGWREFARQQSLSDLIWKVYRETGYY
ADDA_BACSU      --------------------DELYQKLNTFYGHLQKWRAFSKNHSVSELIWEVYRDTKYM
ADDA_BACLD      --------------------ERLSEKLRRFDGLLKKWRAYAKNHSVAELIWEIYRDTKYL
ADDA_BACP2      --------------------HPTCKKLERFFQLLRKWRDFSINHSVAELIWEVYRDTQYL
ADDA_GEOTN      ------------------EEENAKEKAISFLNKLEEWRTMARRRSLADLIWQLYRDTQFY
ADDA_LISMH      ----------------------TADKISDFVQQLNNWRELSIRENLTSLIWQIYQETNFY
ADDA_LISMO      ----------------------TANKISDFVQQLNNWRELSIRENLTSLIWQIYQETNFY
ADDA_LISMF      ----------------------TADKMSDFIQQLNNWRELSIRENLTSLIWQIYQETNFY
ADDA_LISW6      ----------------------AADRISDFITQLNNWRELSIRENLTALIWQIYQETNFY
ADDA_ANOFW      ---------------------ELHEKMKRWLASLSEWRTAARQKPLADLIWQLYRETNFY
ADDA_OCEIH      --------------------SDTVKSLIRFMEMLNDFRQSARQGSLSELIWDIYRETGYY
ADDA_PELTS      --------------------GELSERLADFLKKLEEWRTIARQGTLADLIWAVYRDTGYY
ADDA_DESAP      --------------------GRLGAVLAGFLERLEKWRSQARCGSLADLIWDVYRTTGYY
ADDA_HELMI      -----------------TPIDPVAIRLREFLRQIDAWRTLARRDSLAKLIATIYRETGFY
ADDA_THEP3      ------------------REDELGEKAKNFLDTLKKWQEKAVYMPVDEFLWYLYKDTGYY
ADDA_THEPX      ------------------REDELGEKAKNFLDTLKKWQEKAVYMPVDEFLWYLYKDTGYY
ADDA_CALS4      ------------------REDELGEKVRNFLDSLKRWQEKSIYMPVDEFLWYLYEETGFY
ADDA_CLOBH      --SFYIEDENKINKIIKDMNEKLKNKICSFIEKLKLWREKSIHIDIDEFIWFLYVETGYY
ADDA_CLOB1      --SFYIEDENKINKIIKDMNEKLKNKICSFIEKLKLWREKSIHIDIDEFIWFLYVETGYY
ADDA_CLOBL      --SFYIEDENKINKIIKDMNEKLKNKICSFIEKLKLWREKSIHIDIDEFIWFLYVETGYY
ADDA_CLOBM      --SFYMEDEDKTNKIVKDIKEELKNKICSFIEKLNLWRKKSIHIDIDEFIWFLYVETGYY
ADDA_CLONN      -----SEDRD-------DNWILFKRKCNSFLEKLNYWREKSIHMPIDEFIWYLYMETGYY
ADDA_CLOD6      -----FTDSQNENESEFIPSEECINKSKDFLIKLKEFKEKSMYMSTDEFIWYLYTRTGYY
ADDA_CLOB8      ---------EAYNSINESYSDVLIAKCKYFINSVDKWRNKSIYMAIDEFIWYLYMDTAYY
ADDA_CLOBB      ---------EKLISVE------LQEKCEYILSSIDKWRRKSIYMPIDEFIWYLYMDTAYY
ADDA_CLOPE      ---------GIYDESI---SKDLKGKCKYFLDYLNKWREKAAYMPIDEFIWFLYSDTSYY
ADDA_CLOPS      ---------GIYDESI---SKDLKGKCKYFLDYLNKWREKAAYMPIDEFIWFLYSDTSYY
ADDA_ACET2      -----------------SGQGEAAGKASAFLENLQKWREMSLYMSTDRLLWQLYNDTGYY
ADDA_RUMCH      -----------------HDT-QVSKKASDFLQKLEKWRDMSLYMSTHELIWQLYNETGYF
ADDA_ALKOO      -----------------EKTDDLKYKLVSFIEKLNQWANDARYIKIDQFIWKLFMDTGYY
ADDA_ALKMQ      -----------------KNEDALKDKLVSFIEKLNKWGNEARYIKIDQFIWKLLMDTGFY
ADDA_SYNWW      -----------------DNNDDLKDRLVFFIQRLKEWELESRIMALDEFMGKLFMDTGYY
ADDA_STAEQ      ------------------ADSRLVDKLNRFIQDIQKYQNYSQSQPVYQLIDKFYNDHFVI
ADDA_STAES      ------------------ADSRLVDKLNRFIQDIQKYQNYSQSQPVYQLIDKFYNDHFVI
ADDA_STAAN      ------------------ADAILVDKLKMFLSDIQSYQQYSKDHPVYQLIDKFYNDHYVI
ADDA_STAA8      ------------------ADAILVDKLKMFLSDIQSYQQYSKDHPVYQLIDKFYNDHYVI
ADDA_STAAB      ------------------ADAILVDKLKMFLSDIQSYQQYSKDHPVYQLIDKFYNDHYVI
ADDA_STAS1      ------------------ANKKLVAKLASFLEDIEQYQDYSQSHPVYQLIDKFYNDHYVI
ADDA_STAHJ      ------------------ANPLLVEKLEHFMDDINMYQEYSQSHPVYQLIDKFYNDHYVI
ADDA_LEVBA      -----------------DFQQAVYQKVSHFLEQLQEFRDIAQQDELVTLIWRIYQETGFL
ADDA_LACPL      -----------------EYGDQVYAKIETFLTQLTEFRDLARRNQIVTLIWQIYERTGFL
ADDA_LACS1      -----------------AFAQSLYEKIAIFLKQLTEFRNMAQQNELASLIWKIYEETGFL
ADDA_PEDPA      -----------------EFQMQLKTKITHFLEQLDHFSKLARQSTLVDLLWAIYDETGYL
ADDA_ENTFA      -------------------EAVVQEKTIRFAESLEKWREQARRNQISNLLWTIYRETAYL
ADDA_LACCB      -------------------AQRTHDMLTHFFNQLSHFRDLARENDLVTLLWAIYQDTGFL
ADDA_LACH4      -------------------NDVLSKKCKNFLNQLAELRSFATTHRISELIWSIYERTNLL
ADDA_LACAC      -------------------GDELSDRCKNFLNKLDELRKFATTHRISELIWSIYAQTNLL
ADDA_LACJO      -------------------NSDLGQKCKNFLQQLESLRSFAATHRISELIWSIYERTHLL
ADDA_LACDA      -------------------DTDLAARCRDFLAQLQDLRDFSLSHRISELLWTIYERTSFL
ADDA_LACDB      -------------------DTDLAARCRDFLAQLQDLRDFSLSHRISELLWTIYERTSFL
ADDA_STRMU      -----------------LITEALSAKLDAFFETFLSWREFSLLNSLYDLIWKIYNDKFYY
ADDA_STRA3      -----------------LITPELSSKIDHFMKTFQTWRDFAKWHSLYDLIWKIYNDRFYY
ADDA_STRP3      -----------------LIHDTLLGKLNVFLKTLKSWRRYAKLGSLYDLIWKIFNDRFYF
ADDA_STRPF      -----------------LIHDTLLGKLNVFLKTLKSWRRYAKLGSLYDLIWKIFNDRFYF
ADDA_STRPM      -----------------LIHDTLLGKLNIFLKTLKSWRRYAKLGSLYDLIWKIFNDRFYF
ADDA_STRP8      -----------------LIHDTLLGKLNIFLKTLKSWRRYAKLGSLYDLIWKIFNDRFYF
ADDA_STRP1      -----------------LIHDTLLGKLNVFLKTLKSWRRYAKLGSLYDLIWKIFNDRFYF
ADDA_STRPZ      -----------------LIHDTLLGKLNVFLKTLKSWRRYAKLGSLYDLILENFHERFYF
ADDA_STRS7      -----------------LIGQELMTKLVDFDRTLSDWRQFAKLHSLYELIWKVFNDRFYF
ADDA_STRU0      -----------------LITQELHDQLELFDQSLNAWRDYSRTHSLYELIWKIYNDRFYF
ADDA_STRT2      -----------------VVMQGLEAKLTLFTETLADWRDYSKCHSIYDLIWKIYNDRFYY
ADDA_STRSY      -----------------LMSEKLKKKITDFLSILENWRAYAKLHSIYDMIWKMFNEKFYY
ADDA_STRPI      -----------------LIHTALAEKLKQFMDILASWRLYAKTHSLYDLIWKIYNDRFYY
ADDA_STRR6      -----------------LIHTALAEKLKQFMDILASWRLYAKTHSLYDLIWKIYNDRFYY
ADDA_STRP4      -----------------LIHTALAEKLKQFMDILASWRLYAKPHSLYDLIWKIYNDRFYY
ADDA_STRSV      -----------------LVTEELQKKLQHFYETLQSWRTYSKTHSLYDLIWKIYQDRFYY
ADDA_LACLS      -----------------LINLSLEQKLKAFNQKFTEWRKLVNQIPIHRLLWKIYTETYYF
ADDA_LACLA      -----------------LINPSLENKLKAFYKKFTEWRKLVNQVAIHDLLWKIYTETYYF
ADDA_CARHZ      -------------------KDELSVKSQKFLELLVEFQKLSRQISLAELVNEIYRKTNLP
ADDA_LACF3      ERVAGDPAGLATKEELGVNCGLIYLKLARFFELRDHLRRVAQRRPLVDLIWTIYQATGYL
                                                                ::          

ADDA_LEUMM      DYVAGMPGGAQRQANLHALYEYARTYQNNTHSGLFRFIRYIEQLQSGDSDLGEA-AQETD
ADDA_OENOB      EYVAGMVGGSQRQANLHALYQYAQQLSDNHFVGLFSFIRYVEQLMDSVEDFAQA-PVDMG
ADDA_DESHD      AYVGTLPAGAQRQANLRVLYDRACRYEATNYRGLFRFLRFLEKFQSQGKDLGNASIVGEK
ADDA_LACP7      LFVYAMPGGEQRRNNLNLLVQHALSFEESSYHGLFQFIRYIERLLKFEIDYGEAGGLSEN
ADDA_BACAH      DFVGGLPAGKQRQANLRVLYDRARQYEATSFRGLFRFLRFIERILERGDDMGTARALGEQ
ADDA_BACAN      DFVGGLPAGKQRQANLRVLYDRARQYEATSFRGLFRFLRFIERILERGDDMGTARALGEQ
ADDA_BACC7      DFVGGLPAGKQRQANLRVLYDRARQYEATSFRGLFRFLRFIERILERGDDMGTARALGEQ
ADDA_BACC4      DFVGGLPAGKQRQANLRVLYDRARQYEATSFRGLFRFLRFIERILERGDDMGTARALGEQ
ADDA_BACMK      DFVGGLPAGKQRQANLRVLYDRARQYEATSFRGLFRFLRFIERILERGDDMGTARALGEQ
ADDA_BACCN      DFVGGLPGGKQRQANLRVLYDRARQYEATSFRGLFRFLRFIERILERGDDMGTARALGEQ
ADDA_BACSU      DYVGGMPGGKQRQANLRVLYDRARQYESTAFRGLFRFLRFIERMQERGDDLGTARALSEQ
ADDA_BACLD      DYVGGMPGGKQRQANLRALYDRARSYEATSFRGLFRFLRFIERMQERGDDLGTARALSEQ
ADDA_BACP2      DYVGGMPGGKQRQANLRALYDRAKQYEKAAFRGLFRFLRFIERMQERGDDLGAAKTFSET
ADDA_GEOTN      DFVGALPGGKQRQANLRALYDRARQYESTSFRGLFRFLRFIERLQERGDDLGAARPLGDQ
ADDA_LISMH      EFVGGLPGGKQRQANLRALYDRANQYEKTSFRGLFRFVRFVERLEIRGDDLGTAKTLGEK
ADDA_LISMO      EFVGGLPGGKQRQANLRALYDRANQYEKTSFRGLFRFVRFVERLEIRGDDLGTAKTLGEK
ADDA_LISMF      EFVGGLPGGKQRQANLRALYDRANQYEKTSFRGLFRFVRFVERLEVRGDDLGTAKTLGEK
ADDA_LISW6      EFVGGLPGGKQRQANLRALYDRANQYEKTAFRGLFRFVRFVERLEVRGDDLGTAKTLGEK
ADDA_ANOFW      DYVGGMPGGKQRQANLRALYDRAKQYEQTSFRGIFRFLRFIERLKEREDDFGAARSLTEQ
ADDA_OCEIH      DFVGAIPGGKQRQANLRALYDRARGYESTSFRGLYRFLRFIERMEERGKDLGAARALSEQ
ADDA_PELTS      DFTGCLPGGGQRQANLRALHDRARQFETTAFRGLFLFLRFIERLREGGRDFGAARLLSEK
ADDA_DESAP      DYVGGLPGGAGRQANLRALYDRARQYEATAFRGLFRFLRFIELLQEGGQDLGPAPALAES
ADDA_HELMI      DYAGAMPGGGQRQANLRALYDRARQYEATTLRGLFRFLRFIERLQDQGGDLGTARTLGEK
ADDA_THEP3      SYVAAMPQGVQRQANLRILFERAKQYEETSFKGLFNFINFINRLKVSSGDMGSAKIVGEN
ADDA_THEPX      SYVAAMPQGVQRQANLRILFERAKQYEETSFKGLFNFINFINRLKVSSGDMGSAKIVGEN
ADDA_CALS4      SYVGAMPQGVERQANLRVLFERAKEYEETSFKGLFNFVNFINRLRTTSTDMGSAKTVGEN
ADDA_CLOBH      GYAGALQAGEQRQANLRILFQRAKQYAKTSYKGLFNFINFINKLKFSSGDMGSAKILGEN
ADDA_CLOB1      GYAGALQAGEQRQANLRILFQRAKQYAKTSYKGLFNFINFINKLKFSSGDMGSAKILGEN
ADDA_CLOBL      GYAGALQAGEQRQANLRILFQRAKQYAKTSYKGLFNFINFINKLKFSSGDMGSAKILGEN
ADDA_CLOBM      GYVGALPAGEQRQANLRILFQRAKQYEKTSYKGLFNFINFINKLKFSSGDMGSAKILGEN
ADDA_CLONN      GYVGALAGGMQRQANLKILFQRARQYEKTSYKGLFNFINFINRLKVSSGDMGSAKILGEN
ADDA_CLOD6      AYVGALPGGSQRQANLKVLFERAKQFEETSLKGIFNFVNFIEKLKKSSSDMGSAKTLGEN
ADDA_CLOB8      GYVGAMPNGVLRQANLKILFQRARQFEKTSFKGLFNFINFINKLIKSSGDMGSAQVLGEN
ADDA_CLOBB      GYVGAMPNGVLRQANLKILFQRARQFSDTSFKGLFNFINFINKLTKSSGDMGSAKILGEN
ADDA_CLOPE      GYVGTMPNGVQRQANLRILFQRAKQYESTSFKGLFNFINFINKLKKSSGDMGSAKILGEN
ADDA_CLOPS      GYVGTMPNGVQRQANLRILFQRAKQYESTSFKGLFNFINFINKLKKSSGDMGSAKILGEN
ADDA_ACET2      SIVGAMPAGEQRQANLRILYERARQFEETSYKGLFNFINFIDKLKSSRGDMGSAKILSEN
ADDA_RUMCH      SIVGAMQDGERKQANLKILFERALQYENTSYSGLFNFISFIDKLKTNKGDMGSAKVLGEN
ADDA_ALKOO      YYVGAMPGGLQRQANLRVLFDRANQFEKTSIKGLFNFIKFIEKLQSSKGDMGAAKILGEN
ADDA_ALKMQ      YYVGAMPGGLQRQANLRILFDRASQFEKTSIKGLFNFIKFIEKLQGSKGDMGAAKILGEN
ADDA_SYNWW      YYAGAMPGGGQRQANLRILLHRAREFQKSSFKGLFSFIKYIEKIKSSGSDMGNACIIGEN
ADDA_STAEQ      QYFSGLIGGKGRRANLYGLFNKAVEFENSSFRGLFQFIRFIDELIDRKKDFGEENVVGPN
ADDA_STAES      QYFSGLIGGKGRRANLYGLFNKAVEFENSSFRGLFQFIRFIDELIDRKKDFGEENVVGPN
ADDA_STAAN      QYFSGLIGGRGRRANLYGLFNKAIEFENSSFRGLYQFIRFIDELIERGKDFGEENVVGPN
ADDA_STAA8      QYFSGLIGGRGRRANLYGLFNKAIEFENSSFRGLYQFIRFIDELIERGKDFGEENVVGPN
ADDA_STAAB      QYFSGLIGGRGRRANLYGLFNKAIEFENSSFRGLYQFIRFIDELIERGKDFGEENVVGPN
ADDA_STAS1      QYFSGIIGGKGRRANLYGLFNKAVEFENSSFRGLYQFIRFIDELIERGKDFGEENIVGPN
ADDA_STAHJ      QYFSGLIGGKGRRANLYGLFNKAVEFENSSFRGLYQFIRFIDELIERNKDFGEENVIGPN
ADDA_LEVBA      DYVGGMPAGEQRQANLHALYERAKSYEQSSFKGLFQFVRFVERLQERDDDLAGAPVQA-A
ADDA_LACPL      DYVGGMPAGKQRQANLHALYERAYTYEQGSFKGLFQFVRFIRRMQEKDQDLAAAVAET-D
ADDA_LACS1      DYVGGMPGGLQRQANLHALYERAAEYEEMSFKGLFQFVRFINKMQTKNKDLSEATTQV-S
ADDA_PEDPA      DYVGGMPDGPQRQNNLHALYDRAKGYEESSFKGLFQFVRFVEKMRDKNKDLAENPVVT-D
ADDA_ENTFA      DYVGGLPVGKQRQANLYALVDRAAAYEKTTFRGLFQFVRFIEKMQEKDKDLAEPVVLS-E
ADDA_LACCB      DYVGGTPGGSQRQANLQALIDRARTYEAGGFKGLFAFIHFITLMQKQDQDLAMPAQVDPD
ADDA_LACH4      EIMTALPNGEQRRVNLEALYERATSYESAGFKGLYQFINFIDRMRRSQKDLAQPLLTKEA
ADDA_LACAC      EIMTGLPNGEQRRINLEALYERASSYESAGFKGLYQFINFINRMRRSQKDLAQPLLSKEA
ADDA_LACJO      EIVTGLPNGQQRRVNLESLYERATSYESAGFKGLYQFISFIERMRKNQKDLAQPLLSDKA
ADDA_LACDA      EIVTAMTNGQQRRLNLTALYERASAYESSGFKDLYQFINFIARMRKNQKDLAQPILSENA
ADDA_LACDB      EIVTAMTNGQQRRLNLTALYERASAYESSGFKDLYQFINFIARMRKNQKDLAQPILSENA
ADDA_STRMU      DYVGSLPKSEQRQANLYALALRADNFEKTGFKGLSRFIRMIDKILENQNDLADVEVAL-P
ADDA_STRA3      DYVGALPKAEQRQANLYALALRANQFEKTGFKGLSRFIRMIDKVLENENDLADVEVAL-P
ADDA_STRP3      DFVASQAKAEQAQANLYALALRANQFEKSGYKGLYRFIKMIDKVLETQNDLADVEVAA-P
ADDA_STRPF      DFVASQAKAEQAQANLYALALRANQFEKSGYKGLYRFIKMIDKVLETQNDLADVEVAA-P
ADDA_STRPM      DFVASQAKAEQAQANLYALALRANQFEKSGYKGLYRFIKMIDKVLETQNDLADVEVAA-P
ADDA_STRP8      DFVASQAKAEQAQANLYALALRANQFEKSGYKGLYRFIKMIDKVLETQNDLADVEVAA-P
ADDA_STRP1      DFVASQAKAEQAQANLYALALRANQFEKSGYKGLYRFIKMIDKVLETQNDLADVEVAT-P
ADDA_STRPZ      DFVASQAKAEQAQANLYALALRANQFEKSGYKGLYRFIKMIDKVLETQNDLADVEVAT-P
ADDA_STRS7      DFVASQPKAEQAQANLYALAIRADQFEQSGYKGLSRFIGMIDKVLETQNDLADVEVER-P
ADDA_STRU0      DFVGLSPKAEQAQANLYALALRANQFEKTTFKGLTRFISMIDNILNTENDLADVDLAK-P
ADDA_STRT2      DYVGGLPRAEQRQANLYALALRANAYEKTGFKGLSRFIGMIDKIIASGNDLEEVTDLV-P
ADDA_STRSY      DYVGALPNGSKRQANLYALGLRANQFEKTGYKGLSRFIAMIDRALANDKDLADVQEFL-P
ADDA_STRPI      DYVGALPNGPARQANLYALALRADQFEKSNFKGLPRFIRMIDQVLEAQHDLASVVVAP-P
ADDA_STRR6      DYVGALPNGPARQANLYALALRADQFEKSNFKGLSRFIRMIDQVLEAQHDLASVAVAP-P
ADDA_STRP4      DYVGALPNGPARQANLYALALRADQFEKSNFKGLSRFIRMIDQVLEAQHDLASVAVAP-P
ADDA_STRSV      DMVGTLVNGAQRQANLYALSLRANEYEKSSFKGLSRFIGMIDRILENQHDLASVPVAA-P
ADDA_LACLS      DYVGALKNGEMRQANLQALSVRAESYESSGYKGLFKFVRLINKFMEQNNDLASVNIKL-P
ADDA_LACLA      DYVGALKNGEIRQANLQALAVRAESYESSGYKGLFKFVRLINKFMEQNNDLASVNIKL-P
ADDA_CARHZ      EIFGAYPGGEVRQANLKLLHDLAVDFAEINGGGIYNFLTFLSQAAES-EDFSPAKLIGEA
ADDA_LACF3      DYVGGMSGGPQRQANLHALYERASGYEESGFKGLYQFIHFIEQMQKKNDDLGEATTAL-A
                        .   : **  *   *         .:  *:  :        *          

ADDA_LEUMM      AQAVRIMTIHASKGLEFPIVFLPEFDKSFNT---QDLKGGLLIQKNEGIGVEYIQP----
ADDA_OENOB      QEAVSVMTIHAAKGLEFPIVFLLNLDKQIDN---RDSNGAMVVDFDNGIGIDFVHP----
ADDA_DESHD      ENVVRFITVHSSKGLEFPVVFIAGLGKKFNT---RSLSSQLLLHSHLGVGIPLIDI----
ADDA_LACP7      DNAVRIMSIHKSKGLEFPVVILAGMGKQFNT---MDAREKIVLHADYGIGPECIDY----
ADDA_BACAH      EDVVRIMTIHKSKGLEFPVVFVAGLGRRFNT---QDLMKRFLLHKDFGFGSQFIDP----
ADDA_BACAN      EDVVRIMTIHKSKGLEFPVVFVAGLGRRFNT---QDLMKRFLLHKDFGFGSQFIDP----
ADDA_BACC7      EDVVRIMTIHKSKGLEFPVVFVAGLGRRFNT---QDLMKRFLLHKDFGFGSQFIDP----
ADDA_BACC4      EDVVRIMTIHKSKGLEFPVVFVAGLGRRFNT---QDLMKRFLLHKDFGFGSQFIDP----
ADDA_BACMK      EDVVRIMTIHKSKGLEFPVVFVAGLGRRFNT---QDLMKRFLLHKDFGFGSQFIDP----
ADDA_BACCN      EDVVRIMTIHKSKGLEFPVVFVAGLGRRFNT---QDLMQRFLLHKDFGFGSQFIDP----
ADDA_BACSU      EDVVRLMTIHSSKGLEFPVVFVAGLGRNFNM---MDLNKSYLLDKELGFGTKYIHP----
ADDA_BACLD      EDVVRLMTIHSSKGLEFPVVFTAGLGRNFNM---MDLNKSYLLDKELGFGTKFIHP----
ADDA_BACP2      EDVVRMMTIHSSKGLEFPVVFTVGLGRNFNM---MDLNQSYLLDKELGFGSKYIHP----
ADDA_GEOTN      EDVVRVMTIHSSKGLEFPIVFLVGLARPFYT---RDLHSPYLLDKELGFAARFVHP----
ADDA_LISMH      EDVVRMMTIHASKGLEFPVVIVSGLSRKFNM---RDIYSKTLLDKDYGFASSYRDV----
ADDA_LISMO      EDVVRMMTIHASKGLEFPVVIVSGLSRKFNM---RDIYSKTLLDKDYGFASSYRDV----
ADDA_LISMF      EDVVRMMTIHASKGLEFPVVIVSGLSRKFNM---RDIYSKTLLDKDYGFASNYRDI----
ADDA_LISW6      EDVVRMMTIHASKGLEFPVVIISGLSKKFNM---RDIYSKTLLDKDYGFASNYRDI----
ADDA_ANOFW      EDVVRMMTIHKSKGLEFPVVFLAGAAKSFNM---QDLRSDYVLDKDFGLGMRFVHP----
ADDA_OCEIH      EDVVRIMTIHKSKGLEFPIVILGGMNKEFNQ---RDLSEKYLLHKDLGFASKYIDP----
ADDA_PELTS      ENVVRIMSIHKSKGLEFPVVFVAGLGRNFNF---RNLNKAVLFHKDLGLGPQLVDA----
ADDA_DESAP      ENVVRIMSIHQAKGLEFPVVILADMGRRFYM---PDLNGEVLLHKDLGLGPYFVDP----
ADDA_HELMI      EDVVRIMSIHKSKGLEFPVVFVAGLGSQFNL---QDLRRDLLIHKNLGLGPVVVDT----
ADDA_THEP3      ENVVRIMSIHKSKGLEFPVVIVAGLGKQFNT---KDLYQKILYHHFLGLGPEFVDF----
ADDA_THEPX      EKVVRIMSIHKSKGLEFPVVIVAGLGKQFNT---KDLYQKILYHHFLGLGPEFVDF----
ADDA_CALS4      ENVVRVMSIHKSKGLEFPIVIVAGLGKQFNT---KDLNEKILYHHFLGIGPEFVDY----
ADDA_CLOBH      ENVVRIMSIHKSKGLEFPVVILSGTGKNFNM---TDLNKNILFHRDLGYGPDYVDT----
ADDA_CLOB1      ENVVRIMSIHKSKGLEFPVVILSGTGKNFNM---TDLNKNILFHRDLGYGPDYVDT----
ADDA_CLOBL      ENVVRIMSIHKSKGLEFPVVILSGTGKNFNM---TDLNKNILFHRDLGYGPDYVDT----
ADDA_CLOBM      ENVVRIMSIHKSKGLEFPVVILSGTGKNFNM---MDLNKNILFHRDLGYGPDYVDT----
ADDA_CLONN      DNVVRIMSIHKSKGLEFPVIILSALGKNFNM---QDLNKRILYHDELGFGPDYIDL----
ADDA_CLOD6      ANVVRIMSIHKSKGLEFPVVICSAMGKNFNT---QDFKKSILYHHNLGYGPQFVDY----
ADDA_CLOB8      EDVVRIMSIHKSKGLEFPVVFLCGLGKNFNL---MDLNKSILYHDELGLGPDFIDI----
ADDA_CLOBB      EDVIRIMSIHKSKGLEFPVVFLAGCGKNFNL---MDLNNKILYHEELGLGPEYINL----
ADDA_CLOPE      ENVVRIMSIHKSKGLEFPVVILGGTGKQFNK---MDLREDILLHETLGIGTNCIDI----
ADDA_CLOPS      ENVVRIMSIHKSKGLEFPVVILGGTGKQFNK---MDLREDILLHETLGIGTNCIDV----
ADDA_ACET2      DNVVRIMSIHKSKGLEFPVVIVAGCGKKFNL---QDMNKSILLHHELGFGPDVVDH----
ADDA_RUMCH      DNVVRLMSIHKSKGLEFPVVFLCGCGKKFNM---QDMYKSILLHQELGFGPDFVDY----
ADDA_ALKOO      DNVVRIMSIHKSKGLEFPVVITAGMGKNFNL---RDTSADVLLHKDLGLGPKFTDP----
ADDA_ALKMQ      DNVVRIMSIHKSKGLEFPVVIAAGMGKNFNL---RDTSADVLLHKDLGLGPKFVDS----
ADDA_SYNWW      DNVVRIMSIHKSKGLEFPVVILGGLGKNFNI---RDSNENVLLHRKLGIGPRYINT----
ADDA_STAEQ      DNVVRMMTIHSSKGLEFPFVIYSGLSKKFNK---GDLNAPVILNQQYGLGMDYFDV----
ADDA_STAES      DNVVRMMTIHSSKGLEFPFVIYSGLSKKFNK---GDLNAPVILNQQYGLGMDYFDV----
ADDA_STAAN      DNVVRMMTIHSSKGLEFPFVIYSGLSKDFNK---RDLKQPVILNQQFGLGMDYFDV----
ADDA_STAA8      DNVVRMMTIHSSKGLEFPFVIYSGLSKDFNK---RDLKQPVILNQQFGLGMDYFDV----
ADDA_STAAB      DNVVRMMTIHSSKGLEFPFVIYSGLSKDFNK---RDLKQPVILNQQFGLGMDYFDV----
ADDA_STAS1      DDVVRMMTIHSSKGLEFPFVIYSGLSRKFRR---DDLHRPVILNQSYGLGMAYYDV----
ADDA_STAHJ      DNVVRMMTVHSSKGLEFPYVIYSELSKNFNK---GDLRKPLILNQKYGLGIDYFDL----
ADDA_LEVBA      DDAVSVMTIHGSKGLEFPVVFIMDASRQFNK---QDQQGNYVMSGKTGIGIDYLDP----
ADDA_LACPL      AEAVNVMTIHGSKGLEYPVIFVMDMDKQFNQ---TDTRSSALLDREAGIGITYLDP----
ADDA_LACS1      DDAVTVMTIHGSKGLEFPVVFLLDATHKFNV---GDLNKPYLLNADDGIGISYLDP----
ADDA_PEDPA      VKAVKLMTIHGSKGLEFPIVFLIDAEHGFNT---MDEKGRYVLDRDAGMGITLKDF----
ADDA_ENTFA      ENAVRVMTIHASKGLEFPVVFVLDMTKEFNV---SDLNERYIFEENLGVGIRYLQP----
ADDA_LACCB      NDAVKLMTIHKSKGLEFPVVFLMQANKHFNM---RDQTGTAILTKQ-GIGIKWLDP----
ADDA_LACH4      GNAVRLMTIHGSKGLEFPIVFYVGMQHHYQ----MRDLNGNYIINSDSMGITLR------
ADDA_LACAC      GNAVRLMTIHGSKGLEFPVVFYLGMQHQYQ----LRDLKGNYVINPDSLGITLR------
ADDA_LACJO      DKAVKLMTIHASKGLEFPVVFVMGLGHKYQ----TRDLSGNFTISKDGLGLTIK------
ADDA_LACDA      GNSVKLMTIHASKGLEFPVVFVLGLEHRYNY---QQDITGSYVLDASGLGLSFAYPFD--
ADDA_LACDB      GNSVKLMTIHASKGLEFPVVFVLGLEHRYNY---QQDITGSYVLDASGLGLSFAYPFD--
ADDA_STRMU      KNAVTLMTIHKSKGLEFKYVFILNIDKKF---SIQDMTSPLILSRQNGVGIKYIADMKEE
ADDA_STRA3      QNAVNLMTIHKSKGLEFKYVFILNIDKKF---SMVDITSPLILSRNQGIGIKYVADMRHE
ADDA_STRP3      KQAVNLMTIHKSKGLQFPYVFILNCDKRF---SMTDIHKSFILNRQHGIGIKYLADIKGL
ADDA_STRPF      KQAVNLMTIHKSKGLQFPYVFILNCDKRF---SMTDIHKSFILNRQHGIGIKYLADIKGL
ADDA_STRPM      KQAVNLMTIHKSKGLQFPYVFILNCDKRF---SMTDIHKSFILNRQHGIGIKYLADIKGL
ADDA_STRP8      KQAVNLMTIHKSKGLQFPYVFILNCDKRF---SMTDIHKSFILNRQHGIGIKYLADIKGL
ADDA_STRP1      KQAVNLMTIHKSKGLQFPYVFILNCDKRF---SMTDIHKSFILNRQHGIGIKYLADIKGL
ADDA_STRPZ      KQAVNLMTIHKSKGLQFPYVFILNCDKRF---SMTDIHKSFILNRQHGIGIKYLADIKGL
ADDA_STRS7      KHAVNLMTIHKSKGLEFHYVFILNCDKRF---AMADLQAPIILNRDEGIGIKYVANVKEL
ADDA_STRU0      KEAVNVMTIHKSKGLEFKYVFILNCDKKF---SMADIHSPLILSRQKGVGIKFLADVKKE
ADDA_STRT2      KNAVSLMTIHKSKGLEFKYVFVLQMNRKFIGHSKDGLSGKYIINREKGLGIKYLADLKDQ
ADDA_STRSY      QNAVQLMTIHKSKGLEFKYVFLMNIDKRF---NLEDHYQSVIISRKNGLGIQYLADMKDK
ADDA_STRPI      KDAVELMTIHKSKGLEFPYVFILNMDQDF---NKQDSMSEVILSRQNGLGVKYIAKMETG
ADDA_STRR6      KDAVELMTIHKSKGLEFPYVFILNMDQDF---NKQDSMSEVILSRQNGLGVKYIAKMETG
ADDA_STRP4      KDAVELMTIHKSKGLEFPYVFILNMDQDF---NKQDSMSEVILSRQNGLGVKYIAKMETG
ADDA_STRSV      KDAVRLMTIHKSKGLEFKYVFLLNMDKAF---NRQDSSSAIILSRTKGVGIKYVADVSVS
ADDA_LACLS      QNAVRVMTFHKSKGLEFDYVFLMNLQSRF---NDRDLKEDVILSREHGLGMKYIADLKAE
ADDA_LACLA      QSAVRVMTFHKSKGLEFDYVFLMNLQSRF---NDRDLKENVILSRENGLGMKLIADLKDE
ADDA_CARHZ      DDVVRVMSVHKSKGLEFPVVFVVGLGKRFKF----DYSNTVFLHSDLGFGPKFFDP----
ADDA_LACF3      GDAINVMTIHKSKGLQFPIVFLVETTHQFQAD-----RDPVTIEPQAGLGFTYVDSTANE
                   : .::.* :***::  ::                          . .          

ADDA_LEUMM      --------DALVMIPTLQKLVVQQALKRQSWSEEMRLLYVALTRAEQQLYIVGSVKVKGE
ADDA_OENOB      --------TSQVKIPTIQKIAVAEKIKEKNWAEEMRLLYVALTRAEQRLYLVGSSK----
ADDA_DESHD      --------ENQVRYPSVIQYAVKERLWQEALAEELRILYVALTRGKERLFLFGHQHK---
ADDA_LACP7      --------QLRTKCPTLLKQVIKKNIVLDNLGEELRVLYVALTRAKEKLIMIGSAND---
ADDA_BACAH      --------RKRIKYTTLSQLAIKRKMKMELIAEEMRVLYVALTRAKEKLILIGTVKD---
ADDA_BACAN      --------RKRIKYTTLSQLAIKRKMKMELIAEEMRVLYVALTRAKEKLILIGTVKD---
ADDA_BACC7      --------RKRIKYTTLSQLAIKRKMKMELIAEEMRVLYVALTRAKEKLILIGTVKD---
ADDA_BACC4      --------RKRIKYTTLSQLAIKRKMKMELIAEEMRVLYVALTRAKEKLILIGTVKD---
ADDA_BACMK      --------RKRIKYTTLSQLAIKRKMKMELIAEEMRVLYVALTRAKEKLILIGTVKD---
ADDA_BACCN      --------RKRIKYTTLSQLAIKRKMKRELIAEEMRVLYVALTRAKEKLILIGTVKD---
ADDA_BACSU      --------QLRISYPTLPLIAMKKKMRRELLSEELRVLYVALTRAKEKLFLIGSCKD---
ADDA_BACLD      --------KWRISYPTLPLIAMKKKLRRELLSEELRVLYVALTRAKEKLYLVGTAKD---
ADDA_BACP2      --------ELRISYATLPLVAMKKKMRKELLSEELRVLYVALTRAKEKLFLVGSVKN---
ADDA_GEOTN      --------RLRISYPTLPLLAIQVKKRLELLAEEMRILYVALTRAKEKLYLLASVND---
ADDA_LISMH      --------EKMIVYPTIMQQAIKQKKSREMIAEEMRVLYVALTRAEEKLILVATVPD---
ADDA_LISMO      --------EKMIVYPTIMQQAIKQKKSREMIAEEMRVLYVALTRAEEKLILVATVPD---
ADDA_LISMF      --------EKMIVYPTIMQQAMKQKKSREMIAEEMRVLYVALTRAEEKLILTATVPD---
ADDA_LISW6      --------EKMIVYPTIMQQAIKQKKSREMIAEEMRVLYVALTRAEEKLILTATVPD---
ADDA_ANOFW      --------TWRASYPTVAQLAIKKKMKWQLLAEEMRILYVALTRAKEKLYIVCTAKD---
ADDA_OCEIH      --------VKRIQYPTLYYHAVRQAKFRDMLSEEIRVLYVALTRAKEKLLMVGTVPS---
ADDA_PELTS      --------EARVTRPTAAKLALKHRLKMEALAEEMRILYVAMTRAQEKLILVGSARN---
ADDA_DESAP      --------GARVSHPTAAWHVVRERLRREQLAEEMRILYVAMTRARERLILTGSAGR---
ADDA_HELMI      --------QLRYRYPTVAKLAIQRRLHRETLAEEMRILYVALTRAKEKLILLGTVRE---
ADDA_THEP3      --------RRRISYPSIVKEAIKYKIKLEGLSEEMRVLYVALTRAKEKLILVGSARD---
ADDA_THEPX      --------RRRISYPSIVKEAIKYKIKLEGLSEEMRVLYVALTRAKEKLILVGSARD---
ADDA_CALS4      --------RRRLSYPSIVKEAIKYKIKLESLSEEMRVLYVALTRAKEKLILVASVKD---
ADDA_CLOBH      --------ERRIAYPSLVKNIIKNKIRLETLSEEMRILYVALTRAREKLIITGLINN---
ADDA_CLOB1      --------ERRIAYPSLVKNIIKNKIRLETLSEEMRILYVALTRAREKLIITGLINN---
ADDA_CLOBL      --------ERRIAYPSLVKNIIKNKIRLETLSEEMRILYVALTRAREKLIITGLINN---
ADDA_CLOBM      --------ERRIAYPSLVKNIIKNKIRLETLSEEMRILYVALTRAREKLIITGLINN---
ADDA_CLONN      --------DKRIIYETVPKSALKKKIKLESLSEEMRILYVALTRAKEKLILTGAVND---
ADDA_CLOD6      --------ERRISFPSIAKEALKSKINIENLSEEMRVLYVAFTRAKEKLIITGSTRN---
ADDA_CLOB8      --------GKRFSIGTLAKESIKKKMKFETLSEEMRILYVACTRAKEKLIMTGTVGN---
ADDA_CLOBB      --------ENRTSITTLPKEAIKKRMKLETLSEEMRVLYVAFTRAKEKLIITGAVRN---
ADDA_CLOPE      --------KKRIKYDTLQKHAIKKKCELEVLSEEMRILYVAFTRAKEKLIITGAVSD---
ADDA_CLOPS      --------KKRIKYDTLQKHAIKKKCELEVLSEEMRILYVAFTRAKEKLIITGAVSD---
ADDA_ACET2      --------KLRLSWPSVAKQAIREKIKAETLSEEMRILYVALTRAREKLVITGAVKN---
ADDA_RUMCH      --------KKRIKYPSIPKQAIAQKIRIETLSEEMRILYVAMTRAREKLIITGSVNN---
ADDA_ALKOO      --------NLRTYRDTIAKLAMKDQIKIESLSEEMRILYVAFTRPKDKLIVVGSIRN---
ADDA_ALKMQ      --------NLRTYRDSIAKLAMKDQIKIESLSEEMRILYVAFTRPKDKLIIVGSLRK---
ADDA_SYNWW      --------QLRTYHDTIARLAIKNRIKLENLAEEMRILYVACTRPQEKLIMVGTTRQ---
ADDA_STAEQ      --------NKDMAFPSLASVAYRAINEKELISEEMRLIYVALTRAKEQLILVGRVKD---
ADDA_STAES      --------NKDMAFPSLASVAYRAINEKELISEEMRLIYVALTRAKEQLILVGRVKD---
ADDA_STAAN      --------DKEMAFPSLASVAYKAVAEKELVSEEMRLVYVALTRAKEQLYLIGRVKN---
ADDA_STAA8      --------DKEMAFPSLASVAYRAVAEKELVSEEMRLVYVALTRAKEQLYLIGRVKN---
ADDA_STAAB      --------DKEMAFPSLASVAYRAVAEKELVSEEMRLVYVALTRAKEQLYLIGRVKN---
ADDA_STAS1      --------ESNLSYPSLSSVTYKAIAEKEMVSEEMRLIYVALTRAKEQLFLIGRVKD---
ADDA_STAHJ      --------EQNVTYPSLSSVVIKSITEKELISEEMRLMYVALTRAKEQLILIGTIDK---
ADDA_LEVBA      --------DSRVKAPSLQKLVTAQAISRASLAEEMRKLYVALTRAESRVYIVGSHKT---
ADDA_LACPL      --------ETRVKYPTLPQVVTKQVVSKKMRAEEMRKLYVAMTRAQQQLYLVGTIKD---
ADDA_LACS1      --------DTRVKTDTLMKVIAGKQALKKLAAEQMRLLYVALTRAEQQLFIVGSYKD---
ADDA_PEDPA      --------IHRLEIDTVQKNWIISIKKQKALAEKLRVLYVALTRAEQKLIITGAVNS---
ADDA_ENTFA      --------EERVMYDTLPFLAIKQVRLRKLLSEEMRKLYVALTRAEQKLFLVGSYKD---
ADDA_LACCB      --------ETRVEYELPQYQAAKAARQNQTLAEEMRLLYVALTRAQQRLYVVGATMSGNQ
ADDA_LACH4      --------EQNYRVDSLVKAMGNITKKQQLLEEEARILYVALTRAKQKLILVGDV-----
ADDA_LACAC      --------QEHYRVDSLVKAIGNVTKKRQLLEEEARVLYVALTRAKQKLILVGDI-----
ADDA_LACJO      --------EKDYRIDSLVKSLADVEKRQQMLEEEARILYVGLTRAQQKLILVASV-----
ADDA_LACDA      --------EAEYRADTLANVWLKIAKKQKLLEEEARLLYVALTRAKQKLILAANIKLPAR
ADDA_LACDB      --------EAEYRADTLANAWLKIAKKKKLLEEEARLLYVALTRAKQKLILAANIKLPAR
ADDA_STRMU      LEEKLLPT-VKVSMDTLPYQLNKRELRLATLSEQMRLLYVAMTRSEKKLYLVGKGSQEK-
ADDA_STRA3      LEEELLPA-VKVSMETLPYQLNKRELRLATLSEQMRLLYVAMTRAEKKLYLVGKASQTK-
ADDA_STRP3      LGETTLNS-VKVSMETLPYQLNKQELRLATLSEQMRLLYVAMTRAEKKVYFIGKASKSK-
ADDA_STRPF      LGETTLNS-VKVSMETLPYQLNKQELRLATLSEQMRLLYVAMTRAEKKVYFIGKASKSK-
ADDA_STRPM      LGETTLNS-VKVSMETLPYQLNKQELRLATLSEQMRLLYVAMTRAEKKVYFIGKASKSK-
ADDA_STRP8      LGETTLNS-VKVSMETLPYQLNKQELRLATLSEQMRLLYVAMTRAEKKVYFIGKASKSK-
ADDA_STRP1      LGETTLNS-VKVSMETLPYQLNKQELRLATLSEEMRLLYVAMTRAEKKVYFIGKASKSK-
ADDA_STRPZ      LGETTLNS-VKVSMETLPYQLNKQELRLATLSEEMRLLYVAMTRAEKKVYFIGKASKSK-
ADDA_STRS7      LRDEKLAS-LKVTMETLPYQLNKQQLRLATLSEQMRLLYVAMTRAEKKVYLVGKASKEK-
ADDA_STRU0      LNATQLPS-VKLYLETLPYQINKKELKIATLSEQMRLLYVAMTRAEKKLYLIGKGSQEK-
ADDA_STRT2      IN-TNLPK-LNVVLETLTFQENRREERRASISEEMRLLYVAMTRAEKKLYLVGKGSKET-
ADDA_STRSY      VN-SPLPQ-VRVLMNTLPYQNNLQELKIANLSEQMRLLYVALTRAEKKLYLVGKGNADK-
ADDA_STRPI      AVEDHYPKTIKLSIPSLTYRQNEEELQLASYSEQMRLLYVAMTRAEKKLYLVGKGSREK-
ADDA_STRR6      AVEDHYPKTIKLSIPSLTYRQNEEELQLASYSEQMRLLYVAMTRAEKKLYLVGKGSREK-
ADDA_STRP4      AVEDHYPKTIKLSIPSLTYRQNEEELQLASYSEQMRLLYVAMTRAEKKLYLVGKGSREK-
ADDA_STRSV      VKDSYAPNQLRISMDTLPYQQNLAELQLASLSEQMRLLYVAMTRAETKLYLVGKGSQEA-
ADDA_LACLS      PDVITDFPYALVKMETFPYMVNKDLKQRAALSEEMRVLYVAFTRAKKKLYLVGKIKDTDK
ADDA_LACLA      ADVITDFPYALVKMETFPYMVNKDLKQRAALSEEMRVLYVAFTRAKKKLYLVGKIKETDK
ADDA_CARHZ      --------EKRIRRHSIASQILSERMRRETLAEEMRILYVALTRAREKLILVGTVKN---
ADDA_LACF3      --------TMRVKHPLVQQAALKEKKKRQDRAEEMRLLYVALTRAEQRLFITGYVKDAD-
                                                *: * :**. ** . :: .         

ADDA_LEUMM      -AGNQSLKSLWQQSKNAN---------GQFLPEFLRLQADSYLKWTIMSLARTKNKVLED
ADDA_OENOB      --RMSDLIHNWGTPVSIG---------KKVIAFQDRMRAKSYQSWIGMSLANSGYIKLDK
ADDA_DESHD      ---LAEAINKWR--------SLALSCPDTAFPDGQLRGAKTYLDWLGPALVRHPEDLFKL
ADDA_LACP7      ---ANDVFDKWRQDSTPGVTPLRFQTLAMAKDYFSFVGPAALYDSRIRVITLTPNDLLED
ADDA_BACAH      ---ATKEMEKWLDAREH---------SEWLLPDHVRAGASCYLDWIAPSLYRHRDSE-ML
ADDA_BACAN      ---ATKEMEKWLDAREH---------SEWLLPDHVRAGASCYLDWIAPSLYRHRDSE-ML
ADDA_BACC7      ---ATKEMEKWLDAREH---------SEWLLPDHIRAGASCYLDWIAPSLYRHRDSE-IL
ADDA_BACC4      ---ANKEMEKWLDAREH---------SEWLLPDHIRAGASCYLDWIAPSLYRHRDSE-ML
ADDA_BACMK      ---ANKEMEKWLDAREH---------SEWLLPDHIRAGASCYLDWIAPSLYRHRDSE-ML
ADDA_BACCN      ---KEKEMEKWLDTREH---------TEWLLPDYVRASASCYLDWIAPSLYRHRDSE-IL
ADDA_BACSU      ---HQKQLAKWQASASQ---------TDWLLPEFDRYQARTYLDFIGPALARHRD----L
ADDA_BACLD      ---KEKLLADWRTQAAG---------SEWLLPDYERFQAKSYLDFIGPALMRHRD----M
ADDA_BACP2      ---QVKALSKWQNAATG---------EEWLLPDFERYQSKTYLDFIGPALIRHQA----M
ADDA_GEOTN      ---ADKEIEKWKGVAAE---------SGWLLPDDVRASARSYLDWIGRALIRHRD----G
ADDA_LISMH      ---FEKTSKNWLQVAKE---------KETILPAATRAKAKCYLDWIGNATIRHSA-----
ADDA_LISMO      ---FEKTSKNWLQVAKE---------KETILPAATRAKAKCYLDWIGNATIRHPA-----
ADDA_LISMF      ---FEKTSKNWLQVAKE---------KETILPASTRAKAKCYLDWIGNATIRHPN-----
ADDA_LISW6      ---FEKTSKNWLQVSNQ---------KETILPASIRAKAKCYLDWIGNTIIRHTS-----
ADDA_ANOFW      ---MEAKKKKWQEVAYT---------STWELPAYVIEKAKSYADWIGYALARHQQ-----
ADDA_OCEIH      ---IEKKLEKWQRIVDH---------PSWVLPAYFRMESKTYLDWVGPALLRHVGSEKIR
ADDA_PELTS      ---LPGCARRWCGPAGT---------AGWALPDGFLAGAGTCLDWLMAALARHRDGAAIR
ADDA_DESAP      ---LEQAVLRWSHAAAG---------DGETLPVPVLAEAESFLDWVMPVLMAHPDGEPLR
ADDA_HELMI      ---VAKSAQQWLHDAEGIP-------VAAALPDEVLLRAKCYLDWIGPALVGHPDGQEIR
ADDA_THEP3      ---IKKNVRKWANAAIL----------QEKVSEYDILNGKSYMDWIGAAVIRHK-DLEPL
ADDA_THEPX      ---IKKNVRKWANAAIL----------QEKVSEYDILNGKSYMDWIGAAVIRHK-DLEPL
ADDA_CALS4      ---IKERAKKWGKAKLL----------GKKISEYDVLKSRSYIDWIGSALIRHR-DLKLL
ADDA_CLOBH      ---MDKTVEDWLNLSE----------DKNKVPEYAVMSGKTYLDWIGPALIKHK-DAVSF
ADDA_CLOB1      ---MDKTVEDWLNLSE----------DKNKVPEYAVMSGKTYLDWIGPALIKHK-DAVSF
ADDA_CLOBL      ---MDKTVEDWLNLSE----------DKNKVPEYAVMSGKTYLDWIGPALIKHK-DAVSF
ADDA_CLOBM      ---MDKTVEDWLNLSD----------DKNKVPEYAVMSGKTYLDWIGPALIKHK-DAVSL
ADDA_CLONN      ---IEKSAKKWSYALEG---------EDYKLSQYQVMTGKNYLDWICPVIMRHK-DGEVL
ADDA_CLOD6      ---IQDSIKRWSNGIE----------SLDTISQYEILKGKNFLDWIMPCVLRHR-DLSNL
ADDA_CLOB8      ---LEKSAEKWL-GSASL--------DYNRISPSEVLKGKSYLDWICMSLCQHR-DGSVL
ADDA_CLOBB      ---AEKSIEKWI-NSAVL--------DKDVVLPYEISKGKSYLDWIGMALCKHK-DGEIL
ADDA_CLOPE      ---LEKSCENWCKASASS--------EDNRINPGNVLKGKSYLDWIGMALTKHK-DGDAI
ADDA_CLOPS      ---LEKSCENWCKASASS--------EDNRINPGNVLKGKSYLDWIGMALTKHK-DGDAI
ADDA_ACET2      ---VRKAVEKWLDSASV---------QKSRLSAYDMLSGANYLDWIGPALLRHK-NCGGL
ADDA_RUMCH      ---IEKSALKWLGTAQS---------NDNKFPPHNMLKAQNYLDWICPSVMRHK-DSVIL
ADDA_ALKOO      ---IEKQVKKWSKADNV----------------YSLMNAKNYLDWIGTALVKHP-DGQAL
ADDA_ALKMQ      ---IDRLVTNWNQADNI----------------YSLMNAKSYLDWIGAALIKHP-HGEVL
ADDA_SYNWW      ---LESAWRRWSQPVNS----------------YNQSRARSFLDWLIPIIMRHKKEGQYL
ADDA_STAEQ      ---EKSLIKYEQLAVSD-----------THIAVNERLTATNPFVLIYGVLAKHQSPSLPN
ADDA_STAES      ---EKSLIKYEQLAVSD-----------THIAVNERLTATNPFVLIYGVLAKHQSPSLPN
ADDA_STAAN      ---DKSLLELEQLSISG-----------EHIAVNERLTSPNPFHLIYSILSKHQSASIPD
ADDA_STAA8      ---DKSLLELEQLSISG-----------EHIAVNERLTSPNPFHLIYSILSKHQSASIPD
ADDA_STAAB      ---DKSLLELEQLSISG-----------EHIAVNERLTSPNPFHLIYSILSKHQSASIPD
ADDA_STAS1      ---EKTLSQFEQVSVSE-----------SHLPVSYRITAQRPIDMIYPILAKYQSSSLPN
ADDA_STAHJ      ---EEALEKLERLPISG-----------NQIALHKRLSADRPFDLIYSILAKYQSTSLLP
ADDA_LEVBA      ---QEAAISAWEQAYQSP-------NLVLNATLREKNTLANYLDWIGMCLVRDPKFAAEL
ADDA_LACPL      ---IDTATEKWRQAFASD-------GRVLSAQAR--IAATNQLDWVGMAVMRHPAMKAYW
ADDA_LACS1      ---KNEALSKWKKATQSE-------SLVLNAGIR--ASVRNFMDWIGMCLTRSEIFKEVD
ADDA_PEDPA      ---ADDTLNKWAEAVDTD-------ETLIPAEAR--SKVSNFLDWIGMAIMRVPSVVEKY
ADDA_ENTFA      ---QAAMWKEWLKVGDVE-------TLVLPAENR-LQSKSSLMNWVGMTLVRHQKADEYQ
ADDA_LACCB      LTSADKTVEKWAAAAEGE-------ARVLAPQVR--SGATSYLDWIGPALIRHPQARGLA
ADDA_LACH4      -PSFNKKVKEWSTELNH--------AGQLPLINK--LSATSPLSFIGPSLRFDRHVAIKL
ADDA_LACAC      -ANLDKKVQDWSIELDQ--------SGQLSLADK--LSVTNPLGFMGPALAFDKHIVINM
ADDA_LACJO      -SEMEAKQKKWESEIDQK-------TNILPLIRK--INAQSPLDFLGPKLEQKHEFDQTI
ADDA_LACDA      -TDLAGLEEKWAKEISA---------GRLTLLDK--MKVAKPLDFLAPALARAKQVKRLG
ADDA_LACDB      -TDLAGLEEKWAKEISA---------GRLTLLDK--MKVAKPLDFLAPALARAKQVKRLG
ADDA_STRMU      ---LGDQYDGKSENN--------------HLPVADREHYLTFQDWLLAIEAAYAADELHF
ADDA_STRA3      ---WADHYDLVSENN--------------HLPLASRETFVTFQDWLLAVHETYKKQELFY
ADDA_STRP3      ---SQEITDPKKLGK--------------LLPLALREQLLTFQDWLLAIADIFSTEDLYF
ADDA_STRPF      ---SQEITDPKKLDK--------------LLPLALREQLLTFQDWLLAIADIFSTEDLYF
ADDA_STRPM      ---SQDITDPKKLGK--------------LLPLALREQLLTFQDWLLAIADIFSTEDLYF
ADDA_STRP8      ---SQDITDPKKLGK--------------LLSLALREQLLTFQDWLLAIADIFSTEDLYF
ADDA_STRP1      ---SQEITDPKKLGK--------------LLPLALREQLLTFQDWLLAIADIFSTEDLYF
ADDA_STRPZ      ---SQEITDPKKLGK--------------LLPLALREQLLTFQDWLLAIADIFSTEDLYF
ADDA_STRS7      ---IQAKTADNSSEG--------------RLALASRERLLSFQDWLLAITATFSKEDLFI
ADDA_STRU0      ---LSQKFDTKREGQ--------------HLPKALRESITNFQDWLLAIHQVFDSKDLSF
ADDA_STRT2      ---LTQQYGTDVENN--------------RLPVALRDQIATYQDWIMALDTAFMRKDLKF
ADDA_STRSY      ---LAEKYDGKKENG--------------VLAQSTRESMATFQDWILAIDEAFSGEDLHF
ADDA_STRPI      ---LESKEYPAAKNG--------------KLNSNTRLQARNFQDWLWAISKVFTKDKLNF
ADDA_STRR6      ---LESKEYPAAKNG--------------KLNSNTRLQARNFQDWLWAISKVFTKDKLNF
ADDA_STRP4      ---LESKEYPAAKNG--------------KLNSNTRLQARNFQDWLWAISKVFTKDKLNF
ADDA_STRSV      ---LDKRQWGKSQQG--------------RLSASLRSQISNFQDWLYAIQDVFSDENLAY
ADDA_LACLS      KAGLELYDTATLEGK--------------ILSDKFRNSSRGFQHWILALQNAT---KLPM
ADDA_LACLA      KSGLDLYDNASLEGK--------------ILEDKFRNSSRGFQHWILALQNAT---KLPI
ADDA_CARHZ      ---LAKKMAGWQSQTEAL---------KDTLSDGQIARAGNFLDWIGPVVFREGSDLPDC
ADDA_LACF3      ---LTKKMDKWNRAFDSA---------SPLLTTTTRLKGQSMLDWIMMTLVRTANFPTLR
                                                                            

ADDA_LEUMM      WLGDGQLPRLVGSETPL-------------------------------------------
ADDA_OENOB      VEGNYSKKDLTFKIESY-------------------------------------------
ADDA_DESHD      GSFPTASELPDSSSQWKVILHDQIAGKGPVQEATSSQDEIILPDQETLGEREASEE----
ADDA_LACP7      EYEKQTDIKNKQEELNPYNFLQSFEEESDEQSDEERSDEERSDGEQSDGEQSDGEQPRKD
ADDA_BACAH      LELGQGSIPDEIYGYD--------------------------------------------
ADDA_BACAN      LELGQGSIPDEIYGYD--------------------------------------------
ADDA_BACC7      LELGQGSVPDEIYGYD--------------------------------------------
ADDA_BACC4      LELGQGSIPDEIYGYD--------------------------------------------
ADDA_BACMK      LELGQGNIPGEIYEYS--------------------------------------------
ADDA_BACCN      LELGQGTIPNEIYEYD--------------------------------------------
ADDA_BACSU      GDLAGVPAHADISGHP--------------------------------------------
ADDA_BACLD      DESGAPPVIDEIREHP--------------------------------------------
ADDA_BACP2      SSV-LEETGDVVLSHP--------------------------------------------
ADDA_GEOTN      RSLVEVNRPDEIASHP--------------------------------------------
ADDA_LISMH      --FKELLCEEMIQTLA--------------------------------------------
ADDA_LISMO      --FKELLCEEIIQTLA--------------------------------------------
ADDA_LISMF      --FKELLCEEMIQTLP--------------------------------------------
ADDA_LISW6      --FKDLLCEERIQTLP--------------------------------------------
ADDA_ANOFW      ----GICSSATVLHDP--------------------------------------------
ADDA_OCEIH      TENIGNQVLESINQDP--------------------------------------------
ADDA_PELTS      ELAACAEEPPAEVAAD--------------------------------------------
ADDA_DESAP      RLAVRSR-PAAGTPKD--------------------------------------------
ADDA_HELMI      RWAEGAPALGATLPENNLTMTKNETMTEQERIDG--------------------------
ADDA_THEP3      REFAGVSL----SEEED-------------------------------------------
ADDA_THEPX      REFAGVSL----SEEED-------------------------------------------
ADDA_CALS4      REFAEISP----ELEQD-------------------------------------------
ADDA_CLOBH      REELKMTS-ELSNIVDD-------------------------------------------
ADDA_CLOB1      REELKMTS-ELSNIVDD-------------------------------------------
ADDA_CLOBL      REELKMTS-ELSNIVDD-------------------------------------------
ADDA_CLOBM      REELKITS-GLSNIVDD-------------------------------------------
ADDA_CLONN      RELAGIEIFEKVNLLSD-------------------------------------------
ADDA_CLOD6      LEEVGLDA---VFNVEH-------------------------------------------
ADDA_CLOB8      SESFGTEN---LILKDD-------------------------------------------
ADDA_CLOBB      RKKLGFSS---EMCKDD-------------------------------------------
ADDA_CLOPE      RNIGNGDI---TLNLDD-------------------------------------------
ADDA_CLOPS      RNVGNGDI---TLNLDD-------------------------------------------
ADDA_ACET2      RDCVG-SAGFRGLLIDD-------------------------------------------
ADDA_RUMCH      RNAAGLGVDYSGPTISD-------------------------------------------
ADDA_ALKOO      RELGGLGF-DAASDGME-------------------------------------------
ADDA_ALKMQ      RELGDFEF-NELKYKAE-------------------------------------------
ADDA_SYNWW      REIAGGDW-DREILWED-------------------------------------------
ADDA_STAEQ      DQRFERDIDQLNSEVKP-------------------------------------------
ADDA_STAES      DQRFERDIDQLNSEVKP-------------------------------------------
ADDA_STAAN      DLKFEKDIAQVEDSSRP-------------------------------------------
ADDA_STAA8      DLKFEKDIAQIEDSSRP-------------------------------------------
ADDA_STAAB      DLKFEKDIAQVEDSSRP-------------------------------------------
ADDA_STAS1      ELRFEQTIEDVDQAMRP-------------------------------------------
ADDA_STAHJ      EYRFEKSIDNLDESLRP-------------------------------------------
ADDA_LEVBA      RQGTT-TFSGLAGDPATFAVH---------------------------------------
ADDA_LACPL      GDEWP-NYE-LTDDPTKLAVE---------------------------------------
ADDA_LACS1      DTVDAKEPEYIGELPVKFEVK---------------------------------------
ADDA_PEDPA      ADYNTRKLQ--GTLIPDVELK---------------------------------------
ADDA_ENTFA      QEVVVSNVPQVKKHPANFHIQ---------------------------------------
ADDA_LACCB      ETTIK---PALVGDETEFTIE---------------------------------------
ADDA_LACH4      NDITKSIDQSQ--KILFIDYQ---------------------------------------
ADDA_LACAC      NDISNALDQSQ--SVLYVEYK---------------------------------------
ADDA_LACJO      EDMTLALEEQD--KIYYLKFA---------------------------------------
ADDA_LACDA      EKAVSDLATGQEGSLVFVHFD---------------------------------------
ADDA_LACDB      EKAVSDLATGQEGSLVFVHFD---------------------------------------
ADDA_STRMU      KTSFITDEDLTEDKMGSLE-----------------------------------------
ADDA_STRA3      DINFVSLEELTDHHIGMVN-----------------------------------------
ADDA_STRP3      DVRFIEDSDLTQESVGRLQ-----------------------------------------
ADDA_STRPF      DVRFIEDSDLTQESVGRLQ-----------------------------------------
ADDA_STRPM      DVRFIEDSDLTQESVGRLQ-----------------------------------------
ADDA_STRP8      DVRFIEDSDLTQESVGRLQ-----------------------------------------
ADDA_STRP1      DVRFIEDSDLTQESVGRLQ-----------------------------------------
ADDA_STRPZ      DVRFIEDSDLTQESVGRLQ-----------------------------------------
ADDA_STRS7      DVRFVDDSDLTAEAVGQLR-----------------------------------------
ADDA_STRU0      TIDFVTDNELGPESIGSIS-----------------------------------------
ADDA_STRT2      TVRFVEDEELTPEAIGQVE-----------------------------------------
ADDA_STRSY      KKVFVTDEDLTEEKIGKLT-----------------------------------------
ADDA_STRPI      SYRFIGEDQLTREAIGELE-----------------------------------------
ADDA_STRR6      SYRFIGEDQLTREAIGELE-----------------------------------------
ADDA_STRP4      SYRFIGEDQLTREAIGELE-----------------------------------------
ADDA_STRSV      ETRFVTDEELTAEEIGRIN-----------------------------------------
ADDA_LACLS      KLNVYTKDELETEKLEFTS-----------------------------------------
ADDA_LACLA      KLNVYTKEELEAEKLEFTS-----------------------------------------
ADDA_CARHZ      LKVEVHPQQEKIEGEQ--------------------------------------------
ADDA_LACF3      EGVEAAATPLRGLTKAAYQ-----------------------------------------
                                                                            

ADDA_LEUMM      ---------TGKVAVTLTNQN------EIHAPIASTKGSELVEDGTYSPMDFDRAKTILN
ADDA_OENOB      ---------NAQTIPKIVENK------AKIKQNEQEE----------TGIDLARSKKILD
ADDA_DESHD      --TEIPGETEASGKTEIPGETKNSEETKTSEDKKNLEAQTPETADLDTKNLQEEVFRQLN
ADDA_LACP7      LLTKLSFRYPYEHEAMLPIKTTVSELKKLSQQVDEELTETFTQVKDELTKTWPQVDEELT
ADDA_BACAH      ----TSWKVEVVDGNTLLAP--EPVQ--EEKQELLEALREKKAVPLQSE-RKDEVYDRLM
ADDA_BACAN      ----TSWKVEVVDGNTLLAP--EPVQ--EEKQELLEALREKKAVPLESE-RKEEVYDRLM
ADDA_BACC7      ----TSWKVEVVDGNTLLAP--EPVQ--EEKQELLEALREKKAVPLESE-RKEEVYDRLM
ADDA_BACC4      ----TSWKVEVVDGNTLLAP--EPVQ--EEKQELLEALREKKAVPLESE-RKDEVYDRLM
ADDA_BACMK      ----ASWKVEVVEGKDLLAP--EPVQ--EEKQELLEALRDKKAVPLESE-RKEEVYDRLM
ADDA_BACCN      ----TSWKVEFVDGKTLLAP--EPAQ--EEKQELLEALREKKAVPLESE-RKDEVYNRLT
ADDA_BACSU      ----ARFAVQMIHSYDLLDD--DLEERMEEKSERLEAIRRGEPVPGSFA-FDEKAREQLS
ADDA_BACLD      ----ARFQVSWLSAADLQAE--AVDQAGEERHDRLVQIQMGHAIEGAFE-YEQQVRERLA
ADDA_BACP2      ----STFTISFTQASDLLKE--DMSLEKKEQDEIVQALMDGLPVEGYGD-ADEKVAERLS
ADDA_GEOTN      ----SVWRFEIVSAAKLRNA--EVSTDRED-GGALVALEQGRPVPTQGE-WEEEARRRLL
ADDA_LISMH      ----TEMKLQIEIKTKEMFL--TNELERAESDNWLENIKEHQPVPIQSP-YKDEIQRYME
ADDA_LISMO      ----TEMKLQIEIKTKEMFL--TNELERAESDNWLENIKEHQPVPIQSP-YKDEIQRYME
ADDA_LISMF      ----TDMKLQIEIKTKEMFL--TNELEKTETVNWLENIKEHQPIPVKSP-YKDEIQRYMN
ADDA_LISW6      ----TEMKLQIEIKTKEMFL--TTELEEHKADNWLENVKAHEPVPVQSA-YKDEIERFMN
ADDA_ANOFW      ----SLWDIHIVPAHELEQE--DAQA--NEHRDIVEAIQQLQPVAIKSE-YEEEVNRRLF
ADDA_OCEIH      ----SDWQITMNHALDYMDM--KDSS-MDNDDNLKEKVFNWESVETEQEGLKNDVDARLS
ADDA_PELTS      ---RSRWRVFFS---DSRGR----SAEMAEEPVLLAKVRRMEPLEPAGP-LAGMIKARLE
ADDA_DESAP      ---RSRWEVHLHRPEDLEEA----AGADPDTAAVLESLRRLAPIPADGG-LDEAVHRALS
ADDA_HELMI      ---SSRWRLFYAAKKELIGLRKETGSETPFNPVWLEKLRRLEPIIPT-----DLVDASLS
ADDA_THEP3      ---ASKWEVKLWNKKDVLLEK-EKNDKVDVVERLR-----SLDLDAHYSEFYKEVERRLN
ADDA_THEPX      ---ASKWEVKLWNKKDVLLEK-EKNDKVDVVERLR-----SLDLDAHYSEFYKEVERRLN
ADDA_CALS4      ---SSKWEVKIWNKRDVIIER-KKDEGIEVLERLN-----ALNLEGLHTEFRKEVEERLN
ADDA_CLOBH      ---KSKWKIELWNKRELLKEK-VEEDEVEISEKIK----ETLMNLE-ESNYKEEIYKRLS
ADDA_CLOB1      ---KSKWKIELWNKRELLKEK-VEEDEVEISEKIK----ETLMNLE-ESNYKEEIYKRLS
ADDA_CLOBL      ---KSKWKIELWNKRELLKEK-VEEDEVEISEKIK----ETLMNLE-ESNYKEEIYKRLS
ADDA_CLOBM      ---KSKWKIELWNKKELLKEK-VEENEVEISEKIK----ETLMNLG-ESNYKEEIYKKLS
ADDA_CLONN      ---ESSWKITTDNISGILQND-DETNEI-ILEDIK----EIEDIEE-SSSYYDEINERLN
ADDA_CLOD6      ---NSKWYGKLWNKNDILVEK-KSDEEKESIEEIL----EKIDVNNPDSDYYGEIEEKLN
ADDA_CLOB8      ---NSRWKVSFWNKGDLIDKT-KTE-VLEQGEGYEL---TIINNKPYDNYLYEEVDKILS
ADDA_CLOBB      ---LSMWKISIWNKYELDMYD-ELD-ENQEEEDVKI---SILD-KDVNKEIKSEVYRRLG
ADDA_CLOPE      ---KSNWSFKSWDRSELLETN-NNKKEKNNIDIFES---NNWIESKKDIKEVIEIRDRLG
ADDA_CLOPS      ---KSNWSFKSFDRSELLETN-NNKKEKNNIDIFES---NNWIESKKDIKEVIEIRNRLG
ADDA_ACET2      ---PSVWSVKIWNKTDVQSSG--VSEEQGESEFIKW---LDSLEKEEPSEYAEETARRLS
ADDA_RUMCH      ---DSSWTIILADQSDIAVAKRFETDTQDREDITKW---LQEKGSAD-SGDSHEIHRRLD
ADDA_ALKOO      ---DSEWTINILGRQVIVLEEQDKVLKEEDYREKLLYFNREDFSSGGYTEYKEEIENRLN
ADDA_ALKMQ      ---DSKWTVNILGRQAVVLEEHEKRLKEEEYKEKLTHFNREDFSPHRHTEHKEEIDNRLN
ADDA_SYNWW      ---ESRWKVKLISPWQLTAEEIRKKEEKYEWERLLEQGGYSCPSAE-----SEEIIKRLN
ADDA_STAEQ      -----RVSIVIDHYEDVSTEE-------VVNDNEIRTIEELKAINTGNEDVKIKIHQQLS
ADDA_STAES      -----RVSIVIDHYEDVSTEE-------VVNDNEIRTIEELKAINTGNEDVKIKIHQQLS
ADDA_STAAN      -----NVNISIIYFEDVSTET-------ILDNNEYRSVNQLETMQNGNEDVKAQIKHQLD
ADDA_STAA8      -----NVNISIVYFEDVSTET-------ILDNDEYRSVNQLETMQNGNEDVKAQIKHQLD
ADDA_STAAB      -----NVNISIIYFEDVSTET-------ILDNDEYRSVNQLETMQNGNEDVKAQIKHQLD
ADDA_STAS1      -----YVQLNTDFYEDIASET-------VTDVSEQRTVADIEMNHSKNEALQAQIHNQLS
ADDA_STAHJ      -----TVDIKIAQFEELSIED-------SESEQESRNISDLEVEGSHDDTLKQQINDQLS
ADDA_LEVBA      ---------FVTAHDLGPTQ--GVNETAVDWLQAAS---ETAAKVTTPPVDTEQLHQIMD
ADDA_LACPL      ---------LGDATTVLAEQSEAVTDTQPDALELV----EQQVTIDVDQVTRDYLTTLLN
ADDA_LACS1      ---------FYSNQDLRGEN-ITLDENSESWLKQQLKKIEEQEPLEINDKQYRIIDKILQ
ADDA_PEDPA      ---------IINSSELMDQQ-------GLTALKSAQIPELQQLNAFDDIADVDKFKQIMN
ADDA_ENTFA      ---------WFNEEQLRAAI------QQLQLPERQAEDLAEKAQLSADKINRGLAR--LS
ADDA_LACCB      ---------IDVNPQVTPTA--------------------TPEKVSDDSGTMVDLSAWFK
ADDA_LACH4      ---------DEDTKFIKKDED-------------TDNQNENTRKSALLTQTVNKLYQFN-
ADDA_LACAC      ---------DSDNFEFKKDEDK-----------VVGDSKNNNYTMDKLISTTKKLYQFD-
ADDA_LACJO      ---------VQSDIEEKDEQK-----------------DDTQKLSSKMNDVVKTLYNFE-
ADDA_LACDA      ---------PKKDQAQLPDSEA-----------VAASGADLTEDEAAVFKQAEKLYTFSQ
ADDA_LACDB      ---------PKKDQAQLPDSEA-----------VAASGADLTEDEAAVFKQAEKLYTFSQ
ADDA_STRMU      --------AEQAYDADNLKD---------------------NRQSDDITRALDMLEAVEK
ADDA_STRA3      --------PSLPFNPDNKAE---------------------NRQSEDIVRAISVLESVEQ
ADDA_STRP3      --------TPQLLNPDDLKD---------------------NRQSETIARALDMLEAVSQ
ADDA_STRPF      --------TPQLLNPDDLKD---------------------NRQSETIARALDMLEAVSQ
ADDA_STRPM      --------TPQLLNPDDLKD---------------------NRQSETIARALDMLEAVSQ
ADDA_STRP8      --------TPQLLNPDDLKD---------------------NRQSETIARALDMLEAVSQ
ADDA_STRP1      --------TPQLLNPDDLKD---------------------NRQSETIARALDMLEAVSQ
ADDA_STRPZ      --------TPQLLNPDDLKD---------------------NRQSETIARALDMLEAVSQ
ADDA_STRS7      --------SSGLLQADDLKD---------------------NRQTEDIARALDMLDKVSK
ADDA_STRU0      --------HQSNIMIDDLRD---------------------NRQSDSIARAIDMLNNVNQ
ADDA_STRT2      --------VKAAVDADDLSN---------------------NRQTEEIERALTVLESVEK
ADDA_STRSY      --------LKSKLEDASLKD---------------------IRQSEDIAQALDQLSSVQE
ADDA_STRPI      --------TKSPLQDSSQAD---------------------NRQSDTIKEALEMLKEVEV
ADDA_STRR6      --------TKSPLQDSSQAD---------------------NRQSDTIKEALEMLKEVEV
ADDA_STRP4      --------TKSPLQDSSQAD---------------------NRQSDTIKEALEMLKEVEV
ADDA_STRSV      --------EPVLFPADDLAD---------------------NRQSDDIRRALDILESVDR
ADDA_LACLS      --------QPDFKKLVEESEK--------------------FDNIMSFSDEIKEAQKIMN
ADDA_LACLA      --------QPDFKKLVEESEK--------------------FDNIMAHSDEIQKAQKIMN
ADDA_CARHZ      ------WELPEVLRVKLLTKT----------------------PFTEETDYTGQFRAGLE
ADDA_LACF3      --------IKLQNADQVQAAL-----NTPLDLHPNATAEQATPAAATSRQFKADLERVLN
                                                                            

ADDA_LEUMM      YQYANLQATQTAAYQSVSEIKQIFEDPDLAQMQTAVITENGQLQP-----------ANVL
ADDA_OENOB      YNYPYKIESELAAYHNVSELKRVFEDPDSLLMPEMNSDRQP-------------------
ADDA_DESHD      WQYPYPEGVNQSAKTSVSELKRQSLWYMDNEYSSPSSSS--------------SSSPSAL
ADDA_LACP7      EKYPQVEELIETSPPVKEESQMLIEPTIPKFLKEEKELR--------------GTERGNL
ADDA_BACAH      WKYGYEEATSHRAKQSVTEIKRN--YQSEEGSD--------------------NAFIKKL
ADDA_BACAN      WKYGYGEATSHRAKQSVTEIKRN--YQSEEGSD--------------------NAFIKKL
ADDA_BACC7      WKYGYEEATSHRAKQSVTEIKRN--YQSEEGSD--------------------NAFIKKL
ADDA_BACC4      WKYGYEEATSHRAKQSVTEIKRN--YQSEDGSD--------------------NAFIKKL
ADDA_BACMK      WKYGYEDATSHRAKQSVTEIKRN--YQSEEGSD--------------------NAFIKKL
ADDA_BACCN      WKYEYEDATLQRAKQSVTEIKRN--YQSEDGSD--------------------TAFIQKL
ADDA_BACSU      WTYPHQEVTQIRTKQSVSEIKRKREYEDEYSGR--------------------APVKPAD
ADDA_BACLD      WSYPYKDAAKVRTKQSVSEMKRQKEYEDEYGDR--------------------SLIRPSQ
ADDA_BACP2      WKYPYLAASQVGTKQSVSEIKRMKEIQDEYSVP--------------------SSIRKAR
ADDA_GEOTN      WRYRYGKETVVRAKQSVSELKEQQALFGEQADE--------------------WLPRKGT
ADDA_LISMH      YEYQNEAATEIRAKQSVTELKRQFSLQDNWSDT--------------------TLLKEFQ
ADDA_LISMO      YEYQNEAATEIRAKQSVTELKRQFSLQDSWSDT--------------------TLLKEFQ
ADDA_LISMF      YEYQNEEATEIRAKQSVTELKRQFSLQDSWSDT--------------------TLLKEFQ
ADDA_LISW6      YKYKDVAATEIRAKQSVTELKRQFSLQDSWSDT--------------------SILKEFQ
ADDA_ANOFW      WTYTHAPATVLRAKQSVSELKRQRDIYGGHAEQ--------------------PF-----
ADDA_OCEIH      YEYAYKQATVFRAKQSVTELKRQQEVKDDYS-D--------------------QQILPPS
ADDA_PELTS      WSYPAIAVLGRPAKAAVTELKRRFDQLAAGEEQ-------------------YGEGHFES
ADDA_DESAP      WHYPWSALASCGAKISATEVKRRFAAAAAGEE---------------------EVPAVFP
ADDA_HELMI      WSYPYTGLSGIAAKVAVSRIKKQFVWHSPETPPSSETPPSLEIPPSLETPPSLETQTPSP
ADDA_THEP3      YVYPYEKACYLPAKLSVTEVKRILNAEVVDEDTTSIF-----------------------
ADDA_THEPX      YVYPYEKACYLPAKLSVTEVKRILNAEVVDEDTTSIF-----------------------
ADDA_CALS4      YVYPYDRSSKLPAKLSVTEIKRILNDEVIDEETTSIF-----------------------
ADDA_CLOBH      FKYKYDNASSIPTKLSVSDVKKQFILDEKEN-TEELF-----------------------
ADDA_CLOB1      FKYKYDNASSIPTKLSVSDVKKQFILDEKEN-TEELF-----------------------
ADDA_CLOBL      FKYKYDNASSIPTKLSVSDVKKQFILDEKEN-TEELF-----------------------
ADDA_CLOBM      FKYKYDNASSIPTKLSVSDVKKQFILDEKEN-TEELF-----------------------
ADDA_CLONN      FKYKYIESSKLPTLLTVTELKRMKNSSMYEDYSRDMY-----------------------
ADDA_CLOD6      YIYPYEFSTRKPATISVTEIKKIQNNYEEELINTIFE-----------------------
ADDA_CLOB8      YKYPFKASTTIKSNISVSDLKRRHAEEDYDTEQLY-------------------------
ADDA_CLOBB      YEYEFKESTKLTSNISVSDLKKRNIEDDIDTLKMFDLE------------------EEDN
ADDA_CLOPE      FKYKYIESCNTPSNISVTELKRAHQEEEFMQESYNIIDN--------------ESNEENK
ADDA_CLOPS      FKYKYIESCNTPSNISVTELKRAHQEEEFMQESYNIIDN--------------ESSEENK
ADDA_ACET2      WSYPYVKASKVPAKVSVTELKRRYNEVVSEDVMQF----------------------PDY
ADDA_RUMCH      WKYTYRDFAQIPSKISVTELKRYFHLNNDEDNSQ-----------------------LQY
ADDA_ALKOO      WKYDHPHSVQIPSKLSVSDIKKAHINEIDVIAHQI-------------------------
ADDA_ALKMQ      WQYPYPQATVIPSKLSVSDIKKANMGEMDSIVHQI-------------------------
ADDA_SYNWW      WKYPYQEAENIPAKLSVSQVSQISSGYLEDGAAD--------------------------
ADDA_STAEQ      YDYPFKVNTMKPSKQSVSELKRQLETEESNTNYDRVR-------------------QYRI
ADDA_STAES      YDYPFKVNTMKPSKQSVSELKRQLETEESNTNYDRVR-------------------QYRI
ADDA_STAAN      YQYPYVNDTKKPSKQSVSELKRQYETEESGTSYERVR-------------------QYRI
ADDA_STAA8      YRYPYVNDTKKPSKQSVSELKRQYETEESGTSYERVR-------------------QYRI
ADDA_STAAB      YQYPYVNDTKKPSKQSVSELKRQYETEESGTSYERVR-------------------QYRI
ADDA_STAS1      YEYPYQSAIEKPSKQSVSELKRQHETEQSDTNYDRVR-------------------QYRI
ADDA_STAHJ      FKYPYLKDTEKPSKQSVSELKRQLETEESGTSYERVR-------------------QYRI
ADDA_LEVBA      FRYPHQAATATTAYQSVSEAKRLFEDPDNATIGEYQASATGQVG------------GHRF
ADDA_LACPL      FHYPHQASTTTTAYQSVSEVKRIFEDPDTPLMNANPTVSQRRSRP-----------TSRF
ADDA_LACS1      SKYPNESLAKTTAYQAVSDLKRAFDDPDNNMMQSLEIDWQDQVPQG----------INRY
ADDA_PEDPA      FKYHDEAATTTTAYQSVSEIKRVFDDPDKFELNFSEVDADQHIKP-----------QNRF
ADDA_ENTFA      FNYPFEVATRTTSYQSVSEIKRVFDDPDNKEIGKIEVREDNTIQAQP-------LIVNRM
ADDA_LACCB      KAYPFQAATTTTGFQSVSEIKRAFDDPDTIDLVNADRFLG----------------PKPP
ADDA_LACH4      --YPFRDASETTAYQAVSEIKKAFNDPIDAELENSH--LLTST--------------NRY
ADDA_LACAC      --YPFKDASETTAYQAVSEIKKAFNDPIETELENSR--LLSST--------------NRY
ADDA_LACJO      --YPFADATKTTAYQSVSEIKKVFNDPMDTELENSR--LISSS--------------NRY
ADDA_LACDA      GGYPYLDASRTTAYQAVSEIKKVFGDPIEDELADSHISELQSA--------------NRY
ADDA_LACDB      GGYPYLDASRTTAYQAVSEIKKVFGDPIEDELADSHISELQSA--------------NRY
ADDA_STRMU      LNQHYKAAIHLPTVRTPSQIKK-FYEPVMETEGVEVMQTSY------------------Q
ADDA_STRA3      INQTYKAAIELPTVRTPSQVKK-FYEPILDIEGVDVMETIT------------------K
ADDA_STRP3      LNANYEAAIHLPTVRTPSQLKA-AYEPLLEPIGVDIIEKSS------------------R
ADDA_STRPF      LNANYEAAIHLPTVRTPSQLKA-AYEPLLEPIGVDIIEKSS------------------R
ADDA_STRPM      LNANYEAAIHLPTVRTPSQLKA-AYEPLLEPIGVDIIEKSS------------------R
ADDA_STRP8      LNANYEAAIHLPTVRTPSQLKV-TYEPLLEPIGVDIIEKSS------------------R
ADDA_STRP1      LNANYEAAIHLPTVRTPSQLKA-TYEPLLEPIGVDIIEKSS------------------R
ADDA_STRPZ      LNANYEAAIHLPTVRTPSQLKA-TYEPLLEPIGVDIIEKSS------------------R
ADDA_STRS7      LNASYQAAIELPTVRTPSQLKT-LYEPLMDTDGVDIIDQPY------------------H
ADDA_STRU0      LNQKYEAAINLPTVRTPSQLKK-FYQPIMDIDGVEILADKS------------------Q
ADDA_STRT2      LNHLYAPAIDLPSVRTPSQLKT-FYEPIMDTEGVDIMDKKEGVQP-------------LE
ADDA_STRSY      LNERYKAAIELPSLRTPSQIKK-LYEPILEQEGMEVMEKYQ-------------------
ADDA_STRPI      YNTLHRAAIELPSVQTPSQIKK-FYEPVMDMEGVEIAGQGQS----------------VG
ADDA_STRR6      YNTLHRAAIELPSVQTPSQIKK-FYEPVMDMEGVEIAGQGQS----------------VG
ADDA_STRP4      YNTLHRAAIELPSVQTPSQIKK-FYEPVMDMEGVEIAGQGQS----------------VG
ADDA_STRSV      LNSQYRSAIELPSVRTPSQIKK-FYEPIMDTDGLDIMDERAA----------------FR
ADDA_LACLS      YQYPHQAATELSSIQTPSQVKKRSYEKQLQVGEVQPVSEFV-------------------
ADDA_LACLA      YEYPHQAATELSSIQTPSQVKKRSYEKQLQVGEIQPKSEFT-------------------
ADDA_CARHZ      FNYPGLKIAKLPAKMSVSDLKEVFSTDDVISLED--------------------------
ADDA_LACF3      FTYPDQVATQTTAFQAVSTVREAFARQDPTNLEMGRLEIDRDQ-------IKEAGAYLAP
                                                                            

ADDA_LEUMM      KVDELPLPDFMNDGSQ---KPSSSAVGTATHLILQLIDFTKINTVQS-------------
ADDA_OENOB      QITELPEPKFIGGNDQE--QVSSTDKGTATHLILEKIDWKKEIDKDY-------------
ADDA_DESHD      SAPSFLRPQFIVSRK----ELTPAERGTAVHAAIQHLPLALWRDTWEELAQEVRESMLQE
ADDA_LACP7      YHKILELIDFSDNKT----KLNLREFVSQLANRGLIQEESISSINFERLSRFFESELYQR
ADDA_BACAH      RAPIKTRPRFMEKK-----GLTYAERGTAVHAVMQHVDLKKPITVEV----------LQE
ADDA_BACAN      RAPIQTRPRFMEKK-----GLTYAERGTAVHAVMQHVDLKKPITVEI----------LQE
ADDA_BACC7      RAPIRTRPRFMEKK-----GLTYAERGTAVHAVMQHVDLKKPITEEV----------IRE
ADDA_BACC4      RAPIKTRPRFMEKK-----GLTYAERGTAVHAVMQHVDLKKPITVEV----------LQE
ADDA_BACMK      RAPIKTRPRFMEKK-----GLTYAERGTAVHAVMQHVDLKKPITIEV----------LQE
ADDA_BACCN      RAPIRTRPRFMEKK-----GLTYAERGTAVHAVMQHVDLKQSITIES----------IQE
ADDA_BACSU      GSILYRRPAFMMKK-----GLTAAEKGTAMHTVMQHIPLSHVPSIEE----------AEQ
ADDA_BACLD      EALLFKRPSFMMAK-----GLTAAERGTAMHTVMQHIPLTRTPEKNE----------LSR
ADDA_BACP2      -ATLYDRPAFMKKK-----TLTAAEQGTAMHTVMQHIPLPSEEPYDESR--------IGH
ADDA_GEOTN      -APLFSRPRFMQEK-----TLTPAEKGTALHVVMRHLDLHAPMDESS----------IRS
ADDA_LISMH      KVSLD-RPKFLQKN-----KLSATEIGTAMHTLMQAVSLDYKPTKED----------LEQ
ADDA_LISMO      KVSLD-RPKFLQKN-----KLSATEIGTAMHTLMQAVSLDYKPTKED----------LEQ
ADDA_LISMF      KVSLD-RPKFLQQN-----KLSATEIGTAMHTLMQAVSLEHQPTKED----------LEQ
ADDA_LISW6      KVSLD-RPKFLQQN-----KLSATEIGTAMHTLMQAVSLTYKPSEKD----------LTS
ADDA_ANOFW      RKELVERPRFLQAK-----MMTPAERGTMMHLVMQHVDVTKEVTVDA----------VRE
ADDA_OCEIH      HGPIGKRPNFLQKKL----KLSPAEKGTALHTVMQHLPMTHVLSEPE----------IEE
ADDA_PELTS      FRLTAGRPLFMQEKR----GLTAAEAGEALHLVMQHLDLTGSLDITA----------VRS
ADDA_DESAP      YRAPPARPAFLETAR----GLSPQAFGRAMHVVLQHLDLAGDLSVDG----------IRA
ADDA_HELMI      DALVDLRPRFLQQDR----RLTATERGSAVHLFLQHLDLAGEISQAG----------IAG
ADDA_THEP3      EREVLKTPIFLEK----KKGLTAAEKGIAMHLVMQKLDLDKDLSLEG----------IKE
ADDA_THEPX      EREVLKTPIFLEK----KKGLTAAEKGIAMHLVMQKLDLDKDLSLEG----------IKE
ADDA_CALS4      ERRVLKTPLFLEK----KRGLTPAERGIAMHLVMQKLDLSKDLSYRG----------IKE
ADDA_CLOBH      KKLELRKPMFME----EKKKISPSERGTIIHLFMQHLDLKKAENEED----------IKE
ADDA_CLOB1      KKLELRKPMFME----EKKKISPSERGTIIHLFMQHLDLKKAENEED----------IKE
ADDA_CLOBL      KKLELRKPMFME----EKKKISPSERGTIIHLFMQHLDLKKAESEED----------IKE
ADDA_CLOBM      KKVELRKPMFMG----EEKKISPSERGTIIHLFMQHLDLKKAENEED----------IKE
ADDA_CLONN      TPKLVKKPMFME----KDKKLKGAEKGTAMHAVMQKINYSEELTIED----------INR
ADDA_CLOD6      QKVILKKPLFIQNEE-EREKISGTERGTIVHLVMEVLDLKNVSSVND----------IKS
ADDA_CLOB8      REKVKVVPKFLQE----KKGLTPSEKGTAVHFVMKKIDFNRVSSTEE----------IKE
ADDA_CLOBB      KNKDIITPKFLQE----EKGISAAERGTAIHFAMKKIDFSKVGTLKE----------IKE
ADDA_CLOPE      KEKIKRKPRFMEER---QEEFSAAKKGTITHFVMQHIDLDKVTYIDE----------IRE
ADDA_CLOPS      KEKIKRKPRFMEER---QEEFSAAKKGTITHFVMQHIDLDKVTYIDE----------IRE
ADDA_ACET2      MPVLVKKPMFLEE----KKGLTYAEKGTILHFVMQHLDYGRE----D----------IEA
ADDA_RUMCH      KTATIKKPAFLEG----KKGLSPAEKGTAMHFVMQHLDFHNE----D----------IAG
ADDA_ALKOO      -PILVKSPKFMEG----KTTFTAAERGTVIHFVLQHLDLNKVGSEED----------IRE
ADDA_ALKMQ      -PTLVKTPKFMEG----KKALTAAERGTIIHFVLQHLALNQVGSEEE----------ISQ
ADDA_SYNWW      -TFLTRVPAFLSGEKDKKTRLSPADKGSIVHLVMQNIDYRRVSREDS----------INQ
ADDA_STAEQ      GVASYERPKFLTQTK----KRKANEIGTLMHTVMQHLPFREQRLTKDE---------LFQ
ADDA_STAES      GVASYERPKFLTQTK----KRKANEIGTLMHTVMQHLPFREQRLTKDE---------LFQ
ADDA_STAAN      GFSTYERPKFLSEQG----KRKANEIGTLMHTVMQHLPFKKERISEVE---------LHQ
ADDA_STAA8      GFSTYERPKFLSEQG----KRKANEIGTLMHTVMQHLPFKKERISEVE---------LHQ
ADDA_STAAB      GFSTYERPKFLSEQG----KRKANEIGTLMHTVMQHLPFKKERISEVE---------LHQ
ADDA_STAS1      GSTSYERPAFLSRSK----QRKANEIGTLMHTVMQHLPFNKDRLTEED---------VNR
ADDA_STAHJ      GVSTYERPKFLRENK----KRKANEIGTLMHTVMQHLPFKETRMTETE---------LND
ADDA_LEVBA      VTHDFARPDFLQTV----REPLATEIGSATHLVLQQLDVTVTPTLDR----------VQG
ADDA_LACPL      VTGSLELPQFLQTT----QAPTSAEVGSATHLVLEQLDLTKPVNETT----------VQS
ADDA_LACS1      VQNELSLPKFMTTK----VKVSPAQVGIATHLLLQKLPLDDEVTLEE----------LMQ
ADDA_PEDPA      VTESLMAPRFMNEA----TKPKAAEIGTATHLILQQLDLNQPINETI----------IKD
ADDA_ENTFA      IEGDLSKPKFLDTV----QAPSAAEIGTATHYLLQLIDLSKQPSYEE----------VRA
ADDA_LACCB      MRDLTAPAFLTETP----SGISPAAIGTATHLLLQLVDLAKPITMAS----------LRA
ADDA_LACH4      LQPIDTKPNFLYQ-----TKFTGAEIGTATHLILQYYDYTND-SADN----------LDQ
ADDA_LACAC      LQPIDTKPNFLYQ-----TKFTGAEIGTATHLILQYYDYTGDGSEKQ----------LDY
ADDA_LACJO      LQPIDETPVFLEK-----QKFTGAEIGTAMHLVLQYYDYQGDKTEIN----------LEQ
ADDA_LACDA      LQPIDTEPDFLFQ-----NTVSSAELGTASHLVLQYYDYAKG-DKNA----------IDS
ADDA_LACDB      LQPIDTEPDFLFQ-----NTVSSAELGTASHLVLQYYDYAKG-DKDA----------IDS
ADDA_STRMU      TKPKFELPQFSKKA-----KQDPTALGSSVHELMQRLHLSEQVSLED-------------
ADDA_STRA3      TSVDFKLPDFSTSK-----KQDPAALGSAVHELMQRIEMSSHVKMED-------------
ADDA_STRP3      SLSDFTLPHFSKKA-----KVEASHIGSALHQLMQVLPLSKPINQQT-------------
ADDA_STRPF      SLSDFTLPHFSKKA-----KVEASHIGSALHQLMQVLPLSKPINQQT-------------
ADDA_STRPM      SLSDFTLPHFSKKV-----KVEASHIGSALHQLMQVLPLSKPINQQT-------------
ADDA_STRP8      SLSDFTLPHFSKKA-----KVEASHIGSALHQLMQVLPLSKPINQQT-------------
ADDA_STRP1      SLSDFTLPHFSKKA-----KVEASHIGSALHQLMQVLPLSKPINQQT-------------
ADDA_STRPZ      SLSDFTLPHFSKKA-----KVEASHIGSALHQLMQVLPLSKPINQQT-------------
ADDA_STRS7      RPKSFDLPDFSKKK-----AVEPSQIGSSLHELMQRIPMSDQVTAGD-------------
ADDA_STRU0      TPTTFELPQFSKAK-----QVTSSQVGSALHELMQRIKITSHVTEKD-------------
ADDA_STRT2      TASTFELPDFGQKT-----KVTGAAVGSATHELMQRLTLSDTVTLQD-------------
ADDA_STRSY      PKRTFNLPDFSKKP-----KITGAQVGSAVHELMQRLDLSWLVTEDT-------------
ADDA_STRPI      KKISFDLPDFSTKE-----KVTGAEIGSATHELMQRIDLSQQLTLAS-------------
ADDA_STRR6      KKISFDLPDFSTKE-----KVTGAEIGSATHELMQRIDLSQQLTLAS-------------
ADDA_STRP4      KKISFDLPDFSTKE-----KVTGAEIGSATHELMQRIDLSQQLTLAS-------------
ADDA_STRSV      PQPSFELPDFGKKA-----KVTGAQVGSAVHELMQRIPLDSSPSMAV-------------
ADDA_LACLS      RVKNLDFSDFGSK------KITAAEIGSATHSFMQYADFS-QADLFS-------------
ADDA_LACLA      RVKKLDFSDFGPK------KVTAAEIGSATHSFMQYADFS-QADLFS-------------
ADDA_CARHZ      EDEVFLPGVYFEDG---------AMLGIVYHEFLRRIDFQGDLSASG----------LKA
ADDA_LACF3      EERAFENPAFITGAS--DQEPTGTAIGTATHLVFQKLPLTEPLDEGA----------VRA
                                                                            

ADDA_LEUMM      -IEKLRDELVENKRILP--SVAPLIEIDEILAFLQSDFAKQIIAHQKT---LHREATFAM
ADDA_OENOB      -LQQLIKENIPDQ------KTRQSIELDRIIWFANSEFGTEIKKSAST---LKREQTFAM
ADDA_DESHD      HIDSLIRREILSAE------QGGAVSVSQLKNLLDSTSGKRLWEAEE----VRREVPFTL
ADDA_LACP7      IQIAYQKGYLYREQPFVIGIPVREISTQKFVRTTQAQASSILSKNED----FSHANLCSC
ADDA_BACAH      QIAGMVNKELLTFE------QAEEIAVEKVISFFDSDLGKRVLAAKS----VEREVPFTM
ADDA_BACAN      QIAGMVNKELLTFE------QAEEIAIEKVISFFDSDLGKRVLAAKS----VEREVPFTM
ADDA_BACC7      QIAGMVNKELLTFE------QAEEIAIEKVISFFDSDLGKRVLAAKS----VEREVPFTM
ADDA_BACC4      QIAGMVNKELLTFE------QAEEIAIEKVISFFDSDLGKKVLAAKS----VEREVPFTM
ADDA_BACMK      QIARMVNKELLTFE------QAEEIAIEKVISFFDSDLGKRVLAAKS----VEREVPFTM
ADDA_BACCN      QIAKMVNKEILTFE------QAEEISVERIVAFFESHLGKRVLEAKS----VEREVPFTM
ADDA_BACSU      TVHRLYEKELLTEE------QKDAIDIEEIVQFFHTEIGGQLIGAKW----KDREIPFSL
ADDA_BACLD      LLDRLVEKELLTED------QRAAIEEDDILAFFDTEIGQKLFGARR----VEREVPFNM
ADDA_BACP2      LLDSLQQRDLLTDE------QVQSINQEGIAAFFSTSIGQKLLKADW----VKREVSFSM
ADDA_GEOTN      QIIRLVEKELLSAE------QAETVDAAAIVAFFATDIGRRLCAARE----VYREVPFSL
ADDA_LISMH      LLRTMREKDILTDA------QIKAINIKQILDFFESPLGETMLQKKDL---VKREVPFSY
ADDA_LISMO      LLHTMREKDILTDV------QIKAINIKQILDFFESPLGETMLQKKDL---VKREVPFSY
ADDA_LISMF      LLQTMREKDILTEA------QLKAINIKQVLGFFESQLGKTMLQKKDL---VKREVPFSY
ADDA_LISW6      LLQSMQEKDILTEA------QIKAINIKQIMGFFDSPLGETVLQKSDQ---VKREVPFSY
ADDA_ANOFW      QIARMVNGEWLTEE------QATVIDVESIVAFFNTPIGKRMQRATR----LEREVPFYL
ADDA_OCEIH      NIEKMVLEEKLTRM------EADSINIRAVERFFHTEIASKIISGND----MHREVPFSI
ADDA_PELTS      QIEDMVWRELLTPE------QAAAVPAEKIAAFFAGPLGRRLLAGFQ----VLRELPFTM
ADDA_DESAP      QVAGLEEREFLTAT------EARAIDAEKLAGLFAGGLGRRLAGALW----VRREWPFCL
ADDA_HELMI      QADRLVKLELLSLE------QRQALNEEEILRFLESPLGHRLRKAKQ----VMREVPFTL
ADDA_THEP3      QIKDMVDREILTEE------QAKEVNIHKIEGFFKTSLGERMLSSK----NVKREVPFHI
ADDA_THEPX      QIKDMVDREILTEE------QAKEVNIHKIEGFFKTSLGERMLSSK----NVKREVPFHI
ADDA_CALS4      QIKDMVKNEILTEE------QAKEVDANKIERFFKTPLGKRLLKAK----EVRREVPFHI
ADDA_CLOBH      QINRLIEREFITYE------QSKVINPYKILKFCRGELGKRILNSN----NVNKEMPFSI
ADDA_CLOB1      QINRLIEREFITYE------QSKVISPYKILKFCRGELGKRILNSN----NVNKEMPFSI
ADDA_CLOBL      QINRLIEREFITYE------QSKVISPYKILKFCRGELGKRILNSN----NVNKEMPFSI
ADDA_CLOBM      QINRLIEREFITYE------QSKIINPYKILKFCRSELGKRMINSN----NINREMPFSI
ADDA_CLONN      QMETMVEKEFITKE------QADSVEAEKILNFFKSNIGKRLLKAE----NVRRETPFHM
ADDA_CLOD6      QIRGFVSKGIITEK------QASIVNPYKIYKFFASNIGKRMLNAE----IINREKSIYA
ADDA_CLOB8      QLHELFEKEFLLSE------ELKVINPTKILSFFRSDLGKKILDLNCRGEKIYREIPFYT
ADDA_CLOBB      QLNKLYDEELILQE------EYNSINPYKILSFFKSSLGKKMLYVYNEGGKVYREVPFYT
ADDA_CLOPE      EVLKMVKKELLTEE------EGKVVNVFKIQKFFKSDLGQRMLSSYKSGKKVYRELPFIT
ADDA_CLOPS      EVLKMVKKELLTEE------EGKVVNVFKIQKFFKSELGQRMLSSYKSGKKVYRELPFIT
ADDA_ACET2      QIEEMVAKDLLTPQ------QAQSVDAARIRRFLNSPLGKRMLASK----SINREVPFNI
ADDA_RUMCH      QVKIMVKKELLTEI------QAKSIDIMKISAFINSVIGKRMLKSV----KVYREVPFNI
ADDA_ALKOO      QIHWMVARELITEE------ESKVVDTKKILNYFYSPIGERMRKAK----KVYRESPFII
ADDA_ALKMQ      QIDLMVARELITEE------EAQVVNVGKIVNYFKSEIGKRMLGAE----KVYRESPFII
ADDA_SYNWW      QLGEMVEREILTSE------QLAVVEVNKIWRFFQTKLGQRVLQAK----WLFREAPFNL
ADDA_STAEQ      YIDRLIDKQLIDED------AKEDIRIDEIMHFIDGPLYMEIAQADN----VYTELPFVV
ADDA_STAES      YIDRLIDKQLIDED------AKEDIRIDEIMHFIDGPLYMEIAQADN----VYTELPFVV
ADDA_STAAN      YIDGLIDKHIIEAD------AKKDIRMDEIMTFINSELYSIIAEAEQ----VYRELPFVV
ADDA_STAA8      YIDGLIDKHIIEAD------AKKDIRMDEIMTFINSELYSIIAEAEQ----VYRELPFVV
ADDA_STAAB      YIDGLIDKHIIEAD------AKKDIRMDEIMTFINSELYSIIAEAEQ----VYRELPFVV
ADDA_STAS1      LVDHLIAQHIIPED------AKQDIRFDDIYNFIASDLYQLIAESDE----IYRELPFVV
ADDA_STAHJ      YINELIEKHIIEED------AKKDIQFEAVMNFIRSDLYMTITQADK----VYRELPFVV
ADDA_LEVBA      VIDQLVADQVLTAE------VAQRIQPELILRFFSSSVGQQVLAAPDQ---LHREVPFSL
ADDA_LACPL      TIDGLVANRVLTTN------VAKLIAVDTIVAFYQSALGSQILDNPAK---VHREVPFSL
ADDA_LACS1      LLAQLVEDKLITSE------VAKEINLNQIKVFYTSDLGRKVLKNKDK---VKRELPFAM
ADDA_PEDPA      KIGELVMNRVLDEQ------VANRIRISTILDFFDSDLGQLMINHPEN---VHREEAFSL
ADDA_ENTFA      VQERLVENKLILPA------IAEKMNLEQIVAFFDTALGKQLIQHHQT---VRREQPFSM
ADDA_LACCB      LRDQLTTKQVIAVD------VAKHIDLTALIRFFETDLGRLLLAKPQQ---VHREVPFSM
ADDA_LACH4      EIATLIEQKKLNPD------IVSSLNKDQIDWFVHGDFAKDFWKEPTN---LKREVDFSS
ADDA_LACAC      EIEELIKQKKLNPD------IVPSLHKDQIQWFVHSSFAKSFWKNPEN---LQREVDFSS
ADDA_LACJO      EIEELVELGKLNPL------MVPHLSKEALNWFVMSEFAAEFWQKPEK---LHRESQFSS
ADDA_LACDA      CIAGLVEKGRLSQT------LASMLDREALSWFVKSDFAKDFYQQPDR---LHREENFAT
ADDA_LACDB      CIAGLVEKGRLSQT------LASMLDREALSWFVKSDFAKDFYQQPDR---LHREENFAT
ADDA_STRMU      -ILTALAELSVEEN------VKKAIQVDKILHFFQTSQLGKLIQANAD--KVYREAPFAM
ADDA_STRA3      -IQKALTEVNAETS------VKAAIQIEKINYFFQETSLGKYIQEEVE--HLHREAPFAM
ADDA_STRP3      -LLDALRGIDSNEE------VKTALDLKKIESFFCDTSLGQFFQTYQK--HLYREAPFAI
ADDA_STRPF      -LLDALRGIDSNEE------VKTALDLKKIESFFCDTSLGQFFQTYQK--HLYREAPFAI
ADDA_STRPM      -LLDALREIDSNEE------VKTALDLKKIESFFCDTSLGQFFQTYQK--HLYREAPFAI
ADDA_STRP8      -LLDALRGIDSNEE------VKTALDLKKIESFFCDTSLGQFFQTYQK--HLYREAPFAI
ADDA_STRP1      -LLDALRGIDSNEE------VKTALDLKKIESFFCDTSLGQFFQTYQK--HLYREAPFAI
ADDA_STRPZ      -LLDALRGIDSNEE------VKTALDLKKIESFFCDTSLGQFFQTYQK--HLYREAPFAI
ADDA_STRS7      -IEQALQFVSADAE------VKARIDIKKVTSFFATTELGQLLQEHHQ--CLHREAPFAM
ADDA_STRU0      -IQQASQLVDAEAE------VMAKIDLHKVKSFFEATELGRLIQVHHD--KLYREAPFAM
ADDA_STRT2      -LTQALSRVSASDQ------VKARVQLEKLLGFF-DTELGKLILANRD--KLRREAPFAM
ADDA_STRSY      -VRAALEAVHAEQA------IKDKINVQMILDFF-DTDLGREILANTD--KLHREAPFAS
ADDA_STRPI      -LTETLKQVQTSQA------VRDKINLDKILAFF-DTVLGQEILANTD--HLYREQPFSM
ADDA_STRR6      -LTETLKQVQTSQA------VRDKINLDKILAFF-DTVLGQEILANTD--HLYREQPFSM
ADDA_STRP4      -LTETLKQVQTSQA------VRDKINLDKILAFF-DTALGQEIFANTD--HLYREQPFSM
ADDA_STRSV      -LRSALAQVQADDA------VKKQIQLSKIASFF-ETDLGRLLIENSD--RVRREAPFAM
ADDA_LACLS      -FQATLDEMGFDEK------IKNQIDITKILTLF-DTEFGKFLSENVD--KTVKEAPFSM
ADDA_LACLA      -FQATLDEMGFDEK------IKNQIDIAKILTLF-DTDFGQFLSENVD--KTVKEAPFSM
ADDA_CARHZ      QGETLVAEGVLPPE------SREMLDFTKIARIFATPLGQRILRARE----IYPEFPFTL
ADDA_LACF3      LIKSLTESGLIDNP-----QVAAGIDVAGVVSFYQTGLGQVITAHPEQ---VHREVPFSM
                                        :    .                              

ADDA_LEUMM      IMPANDIYD----------TLEDSAPVLIHGIIDGYFVDEASQTITLFDYKTDFVRNAQI
ADDA_OENOB      LIPAKQIYQ----------QVETSDPVLVHGIIDGYFISDG--LITLFDYKTDRFGK---
ADDA_DESHD      SLRL---------------RAQKE-PVLVQGIIDAVLLSHQEHEAQVMDFKTDNLAGVPD
ADDA_LACP7      PNSQ---------------DYENDDLVLIQGIIDVYFE--EEDGIVLVDYKTDAVGELG-
ADDA_BACAH      MLAAEEAY--------QDWQGESGESILVQGVIDCMIE--EEDGITLIDFKTDTIEGKFP
ADDA_BACAN      MLAAEEAY--------QDWQGESGESILVQGVIDCMIE--EEDGITLIDFKTDTIEGKFP
ADDA_BACC7      MLAAEEAY--------QDWQGQSGESILVQGVIDCMIE--EEDGITLIDFKTDTIEGKFP
ADDA_BACC4      MLAAEEAY--------QDWQGNSGESILVQGVIDCMIE--EEDGITLIDFKTDTIEGKFP
ADDA_BACMK      MLSAEEAY--------QDWQGKKGESILVQGVIDCMIE--EEDGITLIDFKTDTIEGKFP
ADDA_BACCN      MLSAKEAY--------QNWQGKSEETILVQGVIDCMIE--EDDGITLIDFKTDTIEGKFP
ADDA_BACSU      ALPAKEIY--------PDAHEA-DEPLLVQGIIDCLYE--TEDGLYLLDYKSDRIEGKFQ
ADDA_BACLD      TLSAKEVY--------PDLESA-DEPVLIQGIIDCLFE--TEDGFYLLDYKTDRIHGKYR
ADDA_BACP2      VLPVKEVY--------SHIDTE-GEPVLIQGMIDCLFE--TDGKLYLLDYKTDRVQGRYT
ADDA_GEOTN      GLPADELY--------GSEGMESGRRLLVQGVVDCVFA--DERGYVVIDYKTDEVTGRFA
ADDA_LISMH      LLPVSELY--------E--NVDIDERVLIQGVVDSMIE--EEETITLIDYKTDKIEGRYA
ADDA_LISMO      LLPVSELY--------E--KVDLDERVLIQGVVDSMIE--EEETITLIDYKTDKIEGRYA
ADDA_LISMF      LLPVSELY--------E--KVDIDERVLIQGVVDSMIE--EEETITLIDYKTDKIEGRYS
ADDA_LISW6      LLPVAKLY--------K--QSDLEEHVLIQGVVDSMIE--EEDAITLIDYKTDKIEGRYA
ADDA_ANOFW      AHEME------------------GETVVVQGVIDCVFE--DEHGLVLIDYKTDRVSWMND
ADDA_OCEIH      MLPASEVY--------ANWKDQSNEKVLIQGVIDCLLQ--ADTGWIILDYKTDFIEDNPT
ADDA_PELTS      AVQAAEIY--------PELVPYPGEAVLVQGVIDCLVD--EGDGYLLLDYKTGKRP--LG
ADDA_DESAP      VVPAHEIY--------PGLEGHPEERVMVQGIIDCLFA--EPDGLVLVDYKTDRVG--PG
ADDA_HELMI      ALPAAEIY--------PEKRAE-GESVIIQGVIDCLFE--EDDGWLLLDYKTDRCP--VG
ADDA_THEP3      KLSSREIY-------KDLPEEYENEFIQVQGIIDCFFE--EEDGLVLIDYKTDYVQE---
ADDA_THEPX      KLSSREIY-------KDLPEEYENEFIQVQGIIDCFFE--EEDGLVLIDYKTDYVQE---
ADDA_CALS4      KISSREIY-------RDLPEVYQEEFIAVQGIIDCFFE--EEGELVLIDYKTDYVEN---
ADDA_CLOBH      EIPALEIY------KELDKEIYKDEKLIIQGVIDCYFE--EEDGLVLLDYKTDYVND---
ADDA_CLOB1      EIPALEIY------KELDKEIYKDEKLIIQGVIDCYFE--EEDGLVLLDYKTDYVND---
ADDA_CLOBL      EIPALEIY------KELDKEIYKDEKLIIQGVIDCYFE--EEDGLVLLDYKTDYVND---
ADDA_CLOBM      EVPAVEIY------RELDKDIYKDEKLIIQGIIDCYFE--EEEGLVLLDYKTDYVND---
ADDA_CLONN      ELKSTEIY------ESLPKEIYENENIMIQGIIDCYFE--EEDGIVLLDYKSDYFKE---
ADDA_CLOD6      QVNMKDIYIYEKLINNDDKKLYDNESVMLRGIVDAYFE--EDNQIVLVDYKTDFVNE---
ADDA_CLOB8      EISSLEVD------KTL-DNIYKDEKIRLQGIIDCFFE--YKGDIILIDYKTDYIME---
ADDA_CLOBB      EISSLEID------ESL-PQKYANEKIRLQGIIDCFFK--CDDEIILLDYKTDYVE----
ADDA_CLOPE      EIPSSIIE------KNLDPKIYGEEKVRLQGIIDAFFK--EEDGYVLLDYKTDYVKE---
ADDA_CLOPS      EIPSSIIE------KNLDPKIYGEEKVRLQGIIDAFFE--EEDGYVLLDYKTDYVKE---
ADDA_ACET2      EIPCHELY------RDMEDEACHGETLLLQGVVDCYFE--EPDGIVLVDYKTDYVAP---
ADDA_RUMCH      ELPYKEIY------PQLPDVSDYEDKILLQGVVDCYFE--EEDHIVLIDYKTDYIPY---
ADDA_ALKOO      EKSAGEVI--------EGLSDDIEDKLLVQGIIDCYFE--EKDGLILIDYKNDIVLN---
ADDA_ALKMQ      EKSAKDVI--------HGLSENLEEKLLVQGVIDCYFE--EMDGLVLVDYKNDIVLN---
ADDA_SYNWW      LIAASEVF--------PALES--QEELLIQGIIDLYFY--EGEDIVLLDFKSDIVHH---
ADDA_STAEQ      NQIKVDGLT-----------SEDEDVSIIQGMIDLIYE--SDGQFYFVDYKTDAFNRRKG
ADDA_STAES      NQIKVDGLT-----------SEDEDVSIIQGMIDLIYE--SDGQFYFVDYKTDAFNRRKG
ADDA_STAAN      NQALVDQLP-----------QGDEDVSIIQGMIDLIFV--KDGVHYFVDYKTDAFNRRRG
ADDA_STAA8      NQALVDQLP-----------QGDEDVSIIQGMIDLIFV--KDGVHYFVDYKTDAFNRRRG
ADDA_STAAB      NQALVDQLP-----------QGDEDVSIIQGMIDLIFV--KDGVHYFVDYKTDAFNRRRG
ADDA_STAS1      NQNEVDHNK-----------HSEEDASIIQGMIDLIFV--KEGQYYFVDYKTDAFNRRRN
ADDA_STAHJ      NQARVDEMP-----------ESDEDVSIIQGMIDLIFL--KDDQYYFVDYKTDAFNKRRG
ADDA_LEVBA      LMPARSLF---------QDFQETDSQVLVHGIIDGYLT--TPAGVILFDYKTDHVNAQNQ
ADDA_LACPL      LIPARQIF---------DVDEHETGKVLIHGIIDGYLE--TADGLTLFDYKTDHVKRP--
ADDA_LACS1      IIPAGRLFS--------NVDNDVEQPILVHGIIDGLIE--LDDEVIIFDYKTDHHTSE--
ADDA_PEDPA      LLPAKGLFP--------KVKGDDD--VLIHGIIDAYFE--MEDRVILLDYKTDFVLPGSV
ADDA_ENTFA      LIEAEELIQ--------NYPETTQDDLLIHGIIDGYIE--LDNQCILYDYKTDHVKGTS-
ADDA_LACCB      LLPADQVFE--------ALADDPGEDVLIHGIIDGYVS--DEQGVTLFDYKTDHNPNT--
ADDA_LACH4      LLSARTLFK--------DFS-DPDAKILVHGTIDGYFV--AKNGIILFDYKTDHVNKTNI
ADDA_LACAC      LISAKNLFK--------DFS-DANAKILVHGTIDGYFV--SNDGIILFDYKTDHVNKSYL
ADDA_LACJO      LVNASELFN--------DFS-DSAAKILVHGTIDGYFE--TDEGLILFDYKTDFVDKTHE
ADDA_LACDA      ILSPKTLFK--------DFS-DFPGKILVHGTIDGYYE--AENGIILFDYKTDHVNPRKQ
ADDA_LACDB      ILSPKTLFK--------DFS-DFPGKILVHGTIDGYYE--AENGIILFDYKTDHVNPRKQ
ADDA_STRMU      LQADPASG----------------EDYVVRGIIDGYIL--FDNRIVLFDYKTDKFTNSQ-
ADDA_STRA3      LKEDPESG----------------EKFVVRGIIDGYLL--LENRIILFDYKTDKFVNPL-
ADDA_STRP3      LKVDPISQ----------------EEYVLRGIIDAYFL--FDDHIVLVDYKTDKYKQPI-
ADDA_STRPF      LKVDPISQ----------------EEYVLRGIIDAYFL--FDDHIVLVDYKTDKYKQPI-
ADDA_STRPM      LKVDPISQ----------------EEYVLRGIIDAYFL--FDDHIVLVDYKTDKYKQPI-
ADDA_STRP8      LKLDPISQ----------------EEYVLRGIIDAYFL--FDDHIVLVDYKTDKYKQPI-
ADDA_STRP1      LKLDPISQ----------------EEYVLRGIIDAYFL--FDDHIVLVDYKTDKYKQPI-
ADDA_STRPZ      LKLDPISQ----------------EEYVLRGIIDAYFL--FDDHIVLVDYKTDKYKQPI-
ADDA_STRS7      LKKDSLSQ----------------EQYVVRGIIDGYLL--FEDRIVLFDYKTDHYQHSA-
ADDA_STRU0      LKTDPQSQ----------------EKFVIRGIVDGFLL--LEDKIILFDYKTDHYKTPL-
ADDA_STRT2      LAEDPASK----------------EDFVVRGIIDGYLL--LEDRIVLFDYKTDHFTHPS-
ADDA_STRSY      LQTDSVSQ----------------ENFVLRGIIDGYLL--YDDHIVLFDYKTDKYDQPI-
ADDA_STRPI      LKRDQKSQ----------------EDFVVRGILDGYLL--YENKIVLFDYKTDRYDEPS-
ADDA_STRR6      LKRDQKSQ----------------EDFVVRGILDGYLL--YENKIVLFDYKTDRYDEPS-
ADDA_STRP4      LKRDQKSQ----------------EDFVVRGILDGYLL--YENKIVLFDYKTDRYDEPS-
ADDA_STRSV      LKRDEASG----------------QEFVLRGILDGYLL--FEDRIILFDYKTDKYKDSS-
ADDA_LACLS      LRTDEFAK----------------EQYIVRGICDGFVK--IADKIILFDYKTDRFTNVSA
ADDA_LACLA      LRTDEFAK----------------EQYIVRGICDGFVK--LTDKIVLFDYKTDRFTSSSA
ADDA_CARHZ      GVKAGEIYP---------EATGFSEKILVRGVIDLLALE--EDGFFIVDWKTDRVTGDI-
ADDA_LACF3      LLSAHDLFS--------GIGATDDSEVLIHGIIDGYVQ--HDDQIDLFDYKTDRISQAHP
                                            ::*  *            . *:*..       

ADDA_LEUMM      D---EDLTKLQARYKGQLHLYQQALQREYVG-YQVGDPQLIALNVGRVISVK--------
ADDA_OENOB      ----DYVSKLKERYSGQLNLYAAALSSIYPN-LKVERKVVVGLQGKRLIYL---------
ADDA_DESHD      P-----ELVLTQRYGLQLGLYALAVERLLK--VPVRECIIYATSLNREFVMQREAVQAAL
ADDA_LACP7      ------EEELIRRYQEQIRYYERALNQLLD--KTVKEKIIYSFSLGKEIRIKS-------
ADDA_BACAH      GGFEQAKPILETRYKVQLSLYAKALEKSLQ--HPVKEKCLYFFDGNHVIKVEE-------
ADDA_BACAN      GGFEQAKPILETRYKVQLSLYAKALEKSLQ--HPVKEKCLYFFDGNHVIKVEE-------
ADDA_BACC7      GGFDQAKPILEERYKVQLSLYAKALEKSLQ--HPVKEKCLYFFDGNHVIKVEE-------
ADDA_BACC4      GGFEQAKPILEDRYKVQLSLYAKALEKSLQ--HPVKEKCLYFFDGNHVVNIEE-------
ADDA_BACMK      GGFDQAKPTLEDRYKVQLSLYAKALEKSLK--HPVKEKCLYFFDGNHVVNIEE-------
ADDA_BACCN      GGFDQAKPILEERYKVQLSLYAKALEKTLQ--HPVKEKCLYFFDGNHVITIEE-------
ADDA_BACSU      HGFEGAAPILKKRYETQIQLYTKAVEQIAK--TKVKGCALYFFDGGHILTL---------
ADDA_BACLD      NGFEGAEPILRKRYETQIQLYARAVETMIK--MPLKGRALYFFDGGHVLLF---------
ADDA_BACP2      GGIDAAVPILKKRYETQIALYAKAVERLTN--RTLEEKILYFFDGNVEISL---------
ADDA_GEOTN      GQKEEATRFLLGRYGGQMRLYRRAIEQIWR--VPVAECYLYSFDGEYFLAVE--------
ADDA_LISMH      D-WNAAEKVMKERYHIQIKLYAEAIQAISG--KKVAAAYLYFFDGQHICQINTKEGL---
ADDA_LISMO      D-WNAAEKVMKERYHIQIKLYAEAIQAISG--KKVAAAYLYFFDGQHICQINTKEGL---
ADDA_LISMF      N-WEAAEKIMKERYHIQIKLYAKAIQAISG--KKVDAAYLYFFDGQHICQINTKEGF---
ADDA_LISW6      N-WEAAEKVMKERYQIQIKLYAEAIQAITG--KKVSNAYLYFFDGQHICQINIEEGF---
ADDA_ANOFW      P-----KQQLKRRYKGQLALYREAIEAIWK--REVTETYVYAFDGALLVPMEVD------
ADDA_OCEIH      S---QKEQELIHRYQTQMTLYRRAIEQIWK--QPVEQTYLYFFSQQLLIEVPYRD-----
ADDA_PELTS      RPEE-----AARRYCGQLNIYARAVESILG--RKVKEKYLYLFEPGLEIRCD--------
ADDA_DESAP      GEAA-----LADRYRGQLDLYARAVEAVLR--RRVKERYLFLVMTGSAQIIQ--------
ADDA_HELMI      MDRERWLQQLRDSYLGQVNLYHRAVESVLK--VKVKGRCLFLLSIGREMAL---------
ADDA_THEP3      ----GKVEEIKERYKVQIELYSKALENITG--KKVKEKYIYLFFNGNILEY---------
ADDA_THEPX      ----GKVEEIKERYKVQIELYSKALENITG--KKVKEKYIYLFFNGNILEY---------
ADDA_CALS4      ----GKIEEIRDKYRVQIDLYGKALEEITG--KKVKEKYIYLFFNDTIIKY---------
ADDA_CLOBH      ------IEEIKNRYEIQIKYYEEALNRITG--KNVKDKYLYLFSVDNYIKID--------
ADDA_CLOB1      ------IEEIKNRYEIQIKYYEEALNRITG--KNVKDKYLYLFSVDNYIKID--------
ADDA_CLOBL      ------IEEIKNRYEIQIKYYEEALNRITG--KNVKDKYLYLFSVDNYIKID--------
ADDA_CLOBM      ------IEEIKNRYEIQIKYYEEALNRITG--KNVKDKYLYLFSVDNYIKID--------
ADDA_CLONN      ----GQEEAIIKKYKVQIDYYARAIEELTG--KVVKEKYLYLFYGDKEVEIK--------
ADDA_CLOD6      ----ENINQIIEKYKKQLDLYADIIETLTG--KSVKEKCIYLFGVDEAVCY---------
ADDA_CLOB8      ----GHEDEFKEKYRKQLDYYSDAIFKLTG--KKVKYKYLYSFYLEKEIKII--------
ADDA_CLOBB      -----NEEEFKDKYKNQLSYYSEAIFKMTG--KKVDKKYLYSFYLEKEILI---------
ADDA_CLOPE      ----GEEENFINKYKIQINLYKDTLNKILG--EEVKEAYLYSFYLEKELKI---------
ADDA_CLOPS      ----GEEEAFINKYKIQINLYKDTLNKILG--EEVKEAYLYSFYLEKELKISKE------
ADDA_ACET2      ----GNVETIRERYKVQILYYARALEMLTG--KKVKEKYIYLFWDGRILGF---------
ADDA_RUMCH      ----GDKQSVKEKYRLQISYYSRALEMLTL--KRVKERYIYLFSTGEIVEM---------
ADDA_ALKOO      ----GNIAAVVARYELQLSLYREALERITG--REVKETYLYLFDVDQGVRL---------
ADDA_ALKMQ      ----GDTASIMTRYDVQLMMYAEALERITG--KQVKETYLYLFDVDQGVKR---------
ADDA_SYNWW      ----KSEEEILAPYRVQLKLYKRALENITD--HRVKESYLYFFDLNRAIRV---------
ADDA_STAEQ      MSDEEIGNQLKEKYQIQMTYYRNTLETILK--RPVKGYLYFFKFGTLEIDD---------
ADDA_STAES      MSDEEIGNQLKEKYQIQMTYYRNTLETILK--RPVKGYLYFFKFGTLEIDD---------
ADDA_STAAN      MTDEEIGTQLKNKYKIQMKYYQNTLQTILN--KEVKGYLYFFKFGTLQL-----------
ADDA_STAA8      MTDEEIGTQLKNKYKIQMKYYQNTLQTILN--KEVKGYLYFFKFGTLQL-----------
ADDA_STAAB      MTDEEIGTQLKNKYKIQMKYYQNTLQTILN--KEVKGYLYFFKFGTLQL-----------
ADDA_STAS1      MSDEEIGAQLRERYKVQMNHYRNTLETILK--TDVKGFLYFFKFGQLSIEG---------
ADDA_STAHJ      MTDEEVGIQLRDKYKIQMKYYKNTLETILN--SKVYGYLYFFQFGQMSIEEDV-------
ADDA_LEVBA      A---ASIEKIVERYGGQVNLYAAALKQMTG--QPIVGQYLYLLAIGELVAVPEQQVRRLS
ADDA_LACPL      -------EDLKTRYAGQVKLYAAALASMYP--GKVTKQYLYSLPQQVFVPVN--------
ADDA_LACS1      -------DKLIENYRGQLNLYAMAVESMLN--KKVSQKIIYSLDLGKSIVL---------
ADDA_PEDPA      E---QGIEKVINRYQGQVNLYAQALGSILK--RPVNEKYLYLLSIGRLVEIQ--------
ADDA_ENTFA      P---QAISEIVERYRGQMNLYRRALQEATH--KEVSHVYLILLNGGVIIDMQTGNVVDFI
ADDA_LACCB      -------AVLVDRYRGQLNLYAQALQDLQP--KPVLHRYLVFLRTGTVVDLVASGAGK--
ADDA_LACH4      D---KSIELIKEKYTGQLRLYEQALNEFSE--KKVIGKYLILLDAKQVVEVK--------
ADDA_LACAC      D---KSINLIKEKYTGQLRLYEQAINEFGE--EKVIGKYLILLDAKQVVEVK--------
ADDA_LACJO      E---QAIDKIKKKYTGQLRLYEQALNEISEN-KKVIGKYLILLDARKVVPVD--------
ADDA_LACDA      E---EAIQKLKEKYQGQLRLYERALNESGR--LPVLKKYLVLLSCREIVEVD--------
ADDA_LACDB      D---EAIQKLKEKYQGQLRLYERALNESGR--LPVLKKYLVLLSCREIVEVD--------
ADDA_STRMU      --------AIKERYRGQMTLYAQALSQSYNI-QQVDSYLILLGGEKLEVVEI--------
ADDA_STRA3      --------ELKERYQGQMALYAEALKKSYEI-EKIDKYLILLGGKQLEVVKMD-------
ADDA_STRP3      --------ELKKRYQQQLELYAEALTQTYKL-PVTKRYLVLMGGGKPEIVEV--------
ADDA_STRPF      --------ELKKRYQQQLELYAEALTQTYKL-PVTKRYLVLMGGGKPEIVEV--------
ADDA_STRPM      --------ELKKRYQQQLELYAEALTQTYKL-PVTKRYLVLMGGGKPEIVEV--------
ADDA_STRP8      --------ELKKRYQQQLELYAEALTQTYKL-PVTKRYLVLMGGGKPEIVEV--------
ADDA_STRP1      --------ELKKRYQQQLELYAEALTQTYKL-PVTKRYLVLMGGGKPEIVEV--------
ADDA_STRPZ      --------ELKKRYQQQLELYAEALTQTYKL-PVTKRYLVLMGGGKPEIVEV--------
ADDA_STRS7      --------ELKQRYQQQMDLYAEALSQSYGI-ARIEKYLVLMGGSQLEVVRLDE------
ADDA_STRU0      --------EMKLKYQEQMALYAESLRKAYDI-STIESYLILMGKERIEIVECS-------
ADDA_STRT2      --------ELKTRYQGQMSLYAKALSQAYQM-EKVDKYLILLGGKDLEVVEV--------
ADDA_STRSY      --------QLSQRYQAQMQLYAEALKKAYKI-DRVDCHLILLGGERIEVVEVNI------
ADDA_STRPI      --------QLVDRYRGQLALYEEALSRAYSI-ENIEKYLILLGKDEVQVVKV--------
ADDA_STRR6      --------QLVDRYRGQLALYEEALSRAYSI-ENIEKYLILLGKDEVQVVKV--------
ADDA_STRP4      --------QLVDRYRGQLALYEEALSRAYSI-ENIEKYLILLGKDEVQVVKV--------
ADDA_STRSV      --------ELIARYRGQLDLYAQALSRSYGI-SQIEKYLILLGGEQLQVVKVD-------
ADDA_LACLS      I------SEIKERYKDQMNLYSEALQKAYHV-NQIDKYLILLGGPRKVFVEKLDD-----
ADDA_LACLA      I------SEIKERYRDQMNLYSEALKKAYDV-NQVDKYLILLGGPQQVFVEKLDD-----
ADDA_CARHZ      ------LNERLKEYAGQLNLYARAVEEITG--KKVKEKYLYFINLEKEVRV---------
ADDA_LACF3      E---EDLQELADKYSGQLVLYADALTKMTGVPLEKIHRHLYFTRAKRVVTLSAPPSSHEP
                             *  *:  *   :                                   

ADDA_LEUMM      ------
ADDA_OENOB      ------
ADDA_DESHD      ESVVIV
ADDA_LACP7      ------
ADDA_BACAH      ------
ADDA_BACAN      ------
ADDA_BACC7      ------
ADDA_BACC4      ------
ADDA_BACMK      ------
ADDA_BACCN      ------
ADDA_BACSU      ------
ADDA_BACLD      ------
ADDA_BACP2      ------
ADDA_GEOTN      ------
ADDA_LISMH      ------
ADDA_LISMO      ------
ADDA_LISMF      ------
ADDA_LISW6      ------
ADDA_ANOFW      ------
ADDA_OCEIH      ------
ADDA_PELTS      ------
ADDA_DESAP      ------
ADDA_HELMI      ------
ADDA_THEP3      ------
ADDA_THEPX      ------
ADDA_CALS4      ------
ADDA_CLOBH      ------
ADDA_CLOB1      ------
ADDA_CLOBL      ------
ADDA_CLOBM      ------
ADDA_CLONN      ------
ADDA_CLOD6      ------
ADDA_CLOB8      ------
ADDA_CLOBB      ------
ADDA_CLOPE      ------
ADDA_CLOPS      ------
ADDA_ACET2      ------
ADDA_RUMCH      ------
ADDA_ALKOO      ------
ADDA_ALKMQ      ------
ADDA_SYNWW      ------
ADDA_STAEQ      ------
ADDA_STAES      ------
ADDA_STAAN      ------
ADDA_STAA8      ------
ADDA_STAAB      ------
ADDA_STAS1      ------
ADDA_STAHJ      ------
ADDA_LEVBA      E-----
ADDA_LACPL      ------
ADDA_LACS1      ------
ADDA_PEDPA      ------
ADDA_ENTFA      K-----
ADDA_LACCB      ------
ADDA_LACH4      ------
ADDA_LACAC      ------
ADDA_LACJO      ------
ADDA_LACDA      ------
ADDA_LACDB      ------
ADDA_STRMU      ------
ADDA_STRA3      ------
ADDA_STRP3      ------
ADDA_STRPF      ------
ADDA_STRPM      ------
ADDA_STRP8      ------
ADDA_STRP1      ------
ADDA_STRPZ      ------
ADDA_STRS7      ------
ADDA_STRU0      ------
ADDA_STRT2      ------
ADDA_STRSY      ------
ADDA_STRPI      ------
ADDA_STRR6      ------
ADDA_STRP4      ------
ADDA_STRSV      ------
ADDA_LACLS      ------
ADDA_LACLA      ------
ADDA_CARHZ      ------
ADDA_LACF3      KEEA--