CLUSTAL format seed alignment for MF_01452

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ADDB_STAEQ      -MEFNTYIGRAGTGKSTAMLNQIKNKMKQDPLGDPIVLIAPTQSTFQLEQAFVNDSEL--
ADDB_STAES      -MEFNTYIGRAGTGKSTAMLNQIKNKMKQDPLGDPIVLIAPTQSTFQLEQAFVNDSEL--
ADDB_STAAB      -MTLHAYLGRAGTGKSTKMLTEIKQKMKADPLGDPIILIAPTQSTFQLEQAFVNDPEL--
ADDB_STAAR      -MTLHAYLGRAGTGKSTKMLTEIKQKMKADPLGDPIILIAPTQSTFQLEQAFVNDPEL--
ADDB_STAAW      -MTLHAYLGRAGTGKSTKMLTEIKQKMKADPLGDPIILIAPTQSTFQLEQAFVNDPEL--
ADDB_STAAS      -MTLHAYLGRAGTGKSTKMLTEIKQKMKADPLGDPIILIAPTQSTFQLEQAFVNDPEL--
ADDB_STAA1      -MTLHAYLGRAGTGKSTKMLTEIKQKMKADPLGDPIILIAPTQSTFQLEQAFVNDPEL--
ADDB_STAA2      -MTLHAYLGRAGTGKSTKMLTEIKQKMKADPLGDPIILIAPTQSTFQLEQAFVNDPEL--
ADDB_STAA9      -MTLHAYLGRAGTGKSTKMLTEIKQKMKADPLGDPIILIAPTQSTFQLEQAFVNDPEL--
ADDB_STAAM      -MTLHAYLGRAGTGKSTKMLTEIKQKMKADPLGDPIILIAPTQSTFQLEQAFVNDPEL--
ADDB_STAAN      -MTLHAYLGRAGTGKSTKMLTEIKQKMKADPLGDPIILIAPTQSTFQLEQAFVNDPEL--
ADDB_STAA3      -MTLHAYLGRAGTGKSTKMLTEIKQKMKADPLGDPIILIAPTQSTFQLEQAFVNDPEL--
ADDB_STAA8      -MTLHAYLGRAGTGKSTKMLTEIKQKMKADPLGDPIILIAPTQSTFQLEQAFVNDPEL--
ADDB_STAAT      -MTLHAYLGRAGTGKSTKMLTEIKQKMKADPLGDPIILIAPTQSTFQLEQAFVNDPEL--
ADDB_STAAC      -MTLHAYLGRAGTGKSTKMLTEIKQKMKADPLGDPIILIAPTQSTFQLEQAFVNDPEL--
ADDB_STAAE      -MTLHAYLGRAGTGKSTKMLTEIKQKMKADPLGDPIILIAPTQSTFQLEQAFVNDPEL--
ADDB_STAHJ      -MELNAYIGRAGTGKSHHMIDNIKQQMKEDPLGDPIVLIAPTQSTFQLEQAFVNDKEL--
ADDB_STAS1      -MELNAYIGRAGTGKSKAIIEEIKEKMKQDPLGDPIVLIAPTQNTFQLEQAFVNDKTL--
ADDB_STACT      MSQLNAYIGRAGTGKSHAMLDEIKTKMKQDPLGDPIIIIAPTQSTFQLEQDFVKDPEL--
ADDB_EXIS2      --MNYMHLGRAGTGKTTQLIERVIDQLTEQPLGPSIYFIVPDQMSFEMERRIATDPRL--
ADDB_LISMH      -MTLQIIAGRSGTGKTTHLMDEVGEKIKQN--SKTYIFIVPDQMTFQMETSFLNKENL--
ADDB_LISMO      -MTLQIIAGRSGTGKTTHLMDEVGEKIKQN--SKTYIFIVPDQMTFQMETSFLNKENL--
ADDB_LISMF      -MTLQIIAGRSGTGKTTYLMDEVSVKIKQN--SKTYIFIVPDQMTFQMETSFLNKENL--
ADDB_LISIN      -MTLQIIAGKAGTGKTTHLMDEVGEKIKKT--SKTYIFIVPDQMTFQMETSFLNKQNL--
ADDB_LISW6      -MTLQIIAGKSGTGKTTHLMDEVGKKIKKT--SKTYIFIVPDQMTFQMETSFLNKESL--
ADDB_LYSSC      -MTLRIVSGRSGTGKSVFIHQEIVEQLKSDPLGHPIFIIVPDQMSYSTEYELTNRHGL--
ADDB_BACHK      -MSLRFVIGRAGSGKSTLCLHEVQEELKQRPRGETILYLVPEQMTFQTQQALIGSEDV--
ADDB_BACCZ      -MSLRFVIGRAGSGKSTLCLHEVQEELKQRPRGETILYLVPEQMTFQTQQALIGSEDV--
ADDB_BACAN      -MSLRFVIGRAGSGKSTLCLHEVQEELKQRPRGETILYLVPEQMTFQTQQALIGSEDV--
ADDB_BACC0      -MSLRFVIGRAGSGKSTLCLHEVQEELKQRPRGETILYLVPEQMTFQTQQALIGSEDV--
ADDB_BACC7      -MSLRFVIGRAGSGKSTLCLHEVQEELKQRPRGETILYLVPEQMTFQTQQALIGSEDV--
ADDB_BACCQ      -MSLRFVIGRAGSGKSTLCLHEVQEELKQRPRGETILYLVPEQMTFQTQQALIGSEDV--
ADDB_BACC1      -MSLRFVIGRAGSGKSTLCLHEVQEELKQRPRGETILYLVPEQMTFQTQQALIGSEDV--
ADDB_BACAH      -MSLRFVIGRAGSGKSTLCLHEVQEELKQRPRGETILYLVPEQMTFQTQQALIGSEDV--
ADDB_BACC4      -MSLRFVIGRAGSGKSTLCLREVQEELKQRPRGKTILYLVPEQMTFQTQQALIGSEDV--
ADDB_BACCR      -MSLRFVIGRAGSGKSTLCLREVQEELKQRPRGKTILYLVPEQMTFQTQQALIGSEDV--
ADDB_BACC2      -MSLRFVIGRAGSGKSTLCLREVQEELKQRPRGKTILYLVPEQMTFQTQQALIGSEDV--
ADDB_BACMK      -MSLRFVIGRAGSGKSTLCLHEVQEELKQRPRGKTILYLVPEQMTFQTQQALIGSEDV--
ADDB_BACCN      -MSLRFVIGRAGSGKSTLCLREVQEELKERPRGKTILYLVPEQMTFQTQQALIGSEEV--
ADDB_BACSU      -MGAEFLVGRSGSGKTKLIINSIQDELRRAPFGKPIIFLVPDQMTFLMEYELAKTPDM--
ADDB_BACVZ      -MGVEFLVGRSGSGKTRLIIDSIQDELRREPFGKPIIFLVPDQMTFLMEYELAKTPDI--
ADDB_BACLD      -MGAVFLSGRSGSGKTTFILNEIREKLRDEPLGKPIIFLVPDQMTFLMEYELSKTPDL--
ADDB_BACP2      -MEIQFLAGRSGSGKTTAILEEIKEQLRLDPLGPPIIFLVPDQMTFLMEYELAKTSEA--
ADDB_GEOKA      -MSLRFLLGRSGSGKTAVCLEEIRRQLQEDPKGRAIVYLVPEQMTFQCEYALIHTEGV--
ADDB_GEOTN      -MSLRFLLGRSGSGKTTACLEEIRRQLQEDPKGRTIVYLVPEQMTFQCEYALIHTEGT--
ADDB_ANOFW      -MSVRFIIGRSGSGKTTMCLKEMIDQLAQKPDGDPIIYLVPEQMTFQSEYALMN-GSL--
ADDB_OCEIH      -MGMRFILGRSGTNKSEVILKEIKQKISTNPIGPSIFYIVPDQMTFQQEVALFSDSET--
ADDB_DESHY      -MSMRFIVGRAGTGKSTLCRQEIHKESQEHPEGLPLILLVPEQATHQMEMSLAHDPQS--
ADDB_DESHD      ---MRFIVGRAGTGKSTLCRQEIHKESQEHPEGLPLILLVPEQATHQMEMSLAHDPQS--
ADDB_SYMTH      ---MRFIIGGAGSGKSQRCLDELTQAAQAAPAGPPLILLVPEQATFQVEQALLGSGRL--
ADDB_MOOTA      -MALRLVLGRAGSGKTRLCLEEIKAILAEGPAGPALIILTPEQATLQMELDLHRAAGV--
ADDB_DESAP      -MALRFILGRAGTGKTRLCLEEIRKELRQAPDGPPLVFLVPEQATFQTEYALALTPGL--
ADDB_DESRM      -MSLRFIVGRAGSGKSHSCLEEVRQRLRQNQGESSIILLVPEQATFQYEYMLATTPEL--
ADDB_PELTS      -MSIRFIIGRAGAGKTRACLEAIRKELLARPYGPPLILLVPEQATFQIEYALAATPGL--
ADDB_HELMI      -MSLRFILGRAGTGKSRACLDEIAQELKGSPQGPPLLFLVPEQATFQTERALATMPGL--
ADDB_NATTJ      -MSVKFLLGRAGSGKTSYIIDSITEQLKAAPDGDPIIFLVPEQATFQMEQAILRRSDI--
ADDB_ALKMQ      -MAIRYIFGRAGRGKSYLALEEIKQKLQEEED-NKLFLLVPEQFTLQAERDLIRKQE---
ADDB_ALKOO      -MAIRYVFGRAGRGKSYFVLEEIKKRLEGEGH-HKLFLLVPEQFTLQAERDLIGKQA---
ADDB_CLOPE      -MGLKIIYGRAGTGKSTFCINQIKKKINNSPN-NKLILLVPEQFTFQTENKVLSAIG---
ADDB_CLOP1      -MGLKIIYGRAGTGKSTFCINQIKKKINNSPT-NKLILIVPEQFTFQTENKVLNAIG---
ADDB_CLOPS      -MGLKIIYGRAGTGKSTFCINQIKKKINNSPT-NKLILLVPEQFTFQTENKVLNAIG---
ADDB_CLOBB      -MSIRFIYGRAGSGKSLFCINQIKKLIDSDKE-KKIILLVPEQYTFTTENKVLNHIG---
ADDB_CLOBA      -MSIRFIYGRAGSGKSLFCINQIKKLIDSDKE-KKIILLVPEQYTFTTENKVLNYIG---
ADDB_CLOB8      -MSIRFVYGRSGTGKSKFCIDEIKNNIDKKLDFNKLILLVPEQYTFMTENKILHEIG---
ADDB_THEP3      -MGIRFIYGRAGTGKTYFCLREIKEKINDGNS-HPLILLVPEQFTFEAEKYLLETVE---
ADDB_THEPX      -MGIRFIYGRAGTGKTYFCLREIKEKINDGNS-HPLILLVPEQFTFEAEKYLLETVE---
ADDB_CALS4      -MSIRFIYGRAGSGKTYFCLEEIKHKLNDGAN-HPLILLVPEQFTFEAEKYLLDMIE---
ADDB_CLOD6      -MGLRFVLGRSGSGKSTYILDEIKKEAQKNET-TSIILLVPEQYTFEAENRVSKLFLGKE
ADDB_HUNT2      -MSLRFIYGRAGSGKTRFCLEEIKSRITSKAT-HPLVLLVPEQFTFQAERDLISVLG---
ADDB_RUMCH      -MGLQFIYGRAGSGKSFHCLNSIKTKQNKDSN-KKLVLIVPEQYTLQAERDLIKVLG---
ADDB_CLOBK      -MSLRFIYGRAGSGKSQYCLNSIKNRIEEDID-RPLILLVPEQFSFQAEKNLIEVLD---
ADDB_CLOBL      -MSLRFIYGRAGSGKSQYCLNSIKNRIEEDID-RPLILLVPEQFSFQAEKNLIEVLD---
ADDB_CLOBH      -MSLRFIYGRAGSGKSQYCLNSIKNRIEEDID-RPLILLVPEQFSFQAEKNLIEVLD---
ADDB_CLOB1      -MSLRFIYGRAGSGKSQYCLNSIKNRIEEDID-RPLILLVPEQFSFQAEKNLIEVLD---
ADDB_CLOBM      -MSLRFIYGRAGSGKSQYCLNSIKKRIEEDID-RPLILLVPEQFSFQAEKNLIEVLD---
ADDB_CLOK1      -MSIRFIYGRAGSGKSHYCLEDIKRRIQEVND-RNLILLVPEQFSFQAEKNLIKSIG---
ADDB_CLOTE      -MSLKFIYGRSGSGKSYYCFQDIKRKIEENSD-KKLILLVPEQFSFQSEKNLINYIG---
ADDB_CLONN      -MSFRFIYGRAGSGKSKFCIDDIEKRLQEDTN-KQLILIVPEQFSFQAEKSVVEKVK---
ADDB_CLOAB      -MSLRFIYGRAGSGKSQFCIESINTRIEKGGD-KPLILIVPEQFSFQSEKNILDLIG---
ADDB_LACP7      -MSLQFVIGGSGAGKSYQLYQRVIESSLKEPK-GKFLILVPEQFTLQTQKDLVTMHPK--
                        * :* .*:      :               :.* * :   :  .        

ADDB_STAEQ      -HGSLRTEVLHFERLSHRVFQEVGGLTEQRLSKAALEMMIFHIVQQHESDLKLYGSQAQY
ADDB_STAES      -HGSLRTEVLHFERLSHRVFQEVGGLTEQRLSKAALEMMIFHIVQQHESDLKLYGSQAQY
ADDB_STAAB      -NGSLRTEVLHFERLSHRIFQEVGSYSEQKLSKAATEMMIYNIVQEQQKYLKLYQSQAKY
ADDB_STAAR      -NGSLRTEVLHFERLSHRIFQEVGSYSEQKLSKAATEMMIYNIVQEQQKYLKLYQSQAKY
ADDB_STAAW      -NGSLRTEVLHFERLSHRIFQEVGSYSEQKLSKAATEMMIYNIVQEQQKYLKLYQSQAKY
ADDB_STAAS      -NGSLRTEVLHFERLSHRIFQEVGSYSEQKLSKAATEMMIYNIVQEQQKYLKLYQSQAKY
ADDB_STAA1      -NGSLRTEVLHFERLSHRIFQEVGSYSEQKLSKAATEMMIYNIVQEQQKYLKLYQSQAKY
ADDB_STAA2      -NGSLRTEVLHFERLSHRIFQEVGSYSEQKLSKAATEMMIYNIVQEQQKYLKLYQSQAKY
ADDB_STAA9      -NGSLRTEVLHFERLSHRIFQEVGSYSEQKLSKAATEMMIYNIVQEQQKYLKLYQSQAKY
ADDB_STAAM      -NGSLRTEVLHFERLSHRIFQEVGSYSEQKLSKAATEMMIYNIVQEQQKYLKLYQSQAKY
ADDB_STAAN      -NGSLRTEVLHFERLSHRIFQEVGSYSEQKLSKAATEMMIYNIVQEQQKYLKLYQSQAKY
ADDB_STAA3      -NGSLRTEVLHFERLSHRIFQEVGSYSEQKLSKAATEMMIYNIVQEQQKYLKLYQSQAKY
ADDB_STAA8      -NGSLRTEVLHFERLSHRIFQEVGSYSEQKLSKAATEMMIYNIVQEQQKYLKLYQSQAKY
ADDB_STAAT      -NGSLRTEVLHFERLSHRIFQEVGSYSEQKLSKAATEMMIYNIVQEQQKYLKLYQSQAKY
ADDB_STAAC      -NGSLRTEVLHFERLSHRIFQEVGSYSEQKLSKAATEMMIYNIVQEQQKYLKLYQSQAKY
ADDB_STAAE      -NGSLRTEVLHFERLSHRIFQEVGSYSEQKLSKAATEMMIYNIVQEQQKYLKLYQSQAKY
ADDB_STAHJ      -NGSLRTEVLHFERLSYRVFQEVGGLTEERLTQAATEMMIYDLVQQHKSELKLYQSQVNY
ADDB_STAS1      -NGSLRTEVLHFERLSYRVFQEVGGLMEQQLSKAGTEMMIYDIIQQHQSELRLYQSQVKY
ADDB_STACT      -NGSLRTEVLHFERLSHRIFQEIGGLTEEYASKGALEMMIFDILQSHRSELNLYQSQTKY
ADDB_EXIS2      -SGLVRMEVMSLRRFAFHMIRDYGNQVIPFLDETGTQLLLRQVVEEAEEELKIFKRTKNM
ADDB_LISMH      -AGMLGTQIFSFSRLAWKILQETGGLSKTFLSQTGIEMVIRKAALDQKDKLKIFSRATSR
ADDB_LISMO      -AGMLGTQIFSFSRLAWKILQETGGLSKTFLSQTGIEMVIRKAALDQKDKLKIFSRATSR
ADDB_LISMF      -EGMLGTQIFSFSRLAWKILQETGGLSKTFLSQTGIEMVIRKAALDQRDKLKIFSRATSR
ADDB_LISIN      -AGMLGTQIFSFSRLAWKILQETGGLSKTFLSQTGIEMVIRKAALDQKDKLKIFSRATSK
ADDB_LISW6      -SGMLGTQIFSFSRLAWKILQETGGLSKTFLSQTGIEMVIRKAALDQKDKLKIFSKATSR
ADDB_LYSSC      -QGLIRAQVMTFKRLAWLVLQETGGIARKEVNGYGYRMLIRKLLEEQKSEFSLFRQAAGK
ADDB_BACHK      -RGSIRAQVFSFSRLAWKVLQEVGGASRLHIDEAGVHMLLRKIVESRKDGLSVFQKAAEQ
ADDB_BACCZ      -RGSIRAQVFSFSRLAWKVLQEVGGASRLHIDEAGVHMLLRKIVESRKDGLSVFQKAAEQ
ADDB_BACAN      -RGSIRAQVFSFSRLAWKVLQEVGGASRLHIDEAGVHMLLRKIVESRKDGLSVFQKAAEQ
ADDB_BACC0      -RGSIRAQVFSFSRLAWKVLQEVGGASRLHIDEAGVHMLLRKIVESRKDGLSVFQKAAEQ
ADDB_BACC7      -RGSIRAQVFSFSRLAWKVLQEVGGASRLHIDEAGVHMLLRKIVESRKDGLSVFQKAAEQ
ADDB_BACCQ      -RGSIRAQVFSFSRLAWKVLQEVGGASRLHIDEAGVHMLLRKIVESRKDGLSVFQKAAEQ
ADDB_BACC1      -RGSIRAQVFSFSRLAWKVLQEVGGASRLHIDEAGVHMLLRKIVESRKDGLSVFQKAAEQ
ADDB_BACAH      -RGSIRAQVFSFSRLAWKVLQEVGGASRLHIDEAGVHMLLRKIVESRKDGLSVFQKAAEQ
ADDB_BACC4      -RGSIRAQVFSFSRLAWKVLQEVGGASRLHIDEAGVHMLLRKIVESRKDGLSVFQKAAEQ
ADDB_BACCR      -RGSIRAQVFSFSRLAWKVLQEVGGASRLHIDEAGVHMLLRKIVESRKDGLSVFQKAAEQ
ADDB_BACC2      -RGSIRAQVFSFSRLAWKVLQEVGGASRLHIDEAGVHMLLRKIVESRKDGLSVFQKAAEQ
ADDB_BACMK      -RGSIRAQVFSFSRLAWKVLQEVGGASRLHIDEAGVHMLLRKIVESRKDGLSVFQKAAEQ
ADDB_BACCN      -RASIRAQVFSFSRLAWKVLQEVGGASRLHIDEAGVHMLLRKIIESRKEGLYVFQKAAEQ
ADDB_BACSU      -GGMIRAQVFSFSRLAWRVLQHTGGMSRPFLTSTGVQMLLRKLIEEHKQEFKVYQKASDK
ADDB_BACVZ      -GGMIRAQVFSFSRLAWRVLQHTGGMNRPFVTTTGVQMLLRKLIEEHKHEFKVYQKASDK
ADDB_BACLD      -GGTIRAQVYSFSRLAWRVLQHTGGMNRPFLTGTGIQMLLRRLIEEHKGEFKVYQNASDK
ADDB_BACP2      -GGMIRAKVFSFTRLAWSILQQTGGANRQFVTSTGIQMLLRKVIEEQKDKFKVFKKASDK
ADDB_GEOKA      -GGMIRAQVFSFTRLAWRVLQETGGMTRYHIHDVGVQMMIRKIIEQRKQELKLFGRAADK
ADDB_GEOTN      -EGMIRAQVFSFPRLAWRVLQETGGMNRYHVHDVGVQMMIRKIIEQRKQELKLFGRAADK
ADDB_ANOFW      -KGMIRAQVFSFTRLAWRILQETGGMSRHHLTQTGVHMLLRKIVEQQKEQLTLFRKAADK
ADDB_OCEIH      -NGSIRAQIVSFSRLAWRVLQETGGGTKQFISSVGIQMMLRKIIEEKQGDWNAFQKALKK
ADDB_DESHY      -GGILRAQVLSFRRLGWRVFSEVGGGGKAVIGEVGKRMLLRRLLLNHRSDLRVFARSATR
ADDB_DESHD      -GGILRAQVLSFRRLGWRVFSEVGGGGKAVIGEVGKRMLLRRLLLNHRSDLRVFARSATR
ADDB_SYMTH      -KGIIRAQVLSFQRLAWRVSLKAGGLALPPLSDLGKQMVLRALLEKKRDDLRLFHQVADK
ADDB_MOOTA      -PGFSRVQVLSFRRLGWRVFQEAGGAARPHLGEMGKAMALRAVVSAHRDDLGLFAPLAGS
ADDB_DESAP      -SGMFRAQVLSFRRLAWRVFSEVGGAARPHVGDVGKRMMLARILARRRNELRLFGRAAGQ
ADDB_DESRM      -KGMIWAQVLSFRRLAFRVLQEMGGAARAHIDDLGKKMVLRRILEQRKSELKVFHRAAKQ
ADDB_PELTS      -SGFIRARVLSFRRLAYRVLREVGGAARAHIGELGKRMVLRRLLEQRRSELRVLGRSSGR
ADDB_HELMI      -GGTIRAQVFSFRRLAYRVLQEVGGSARIPIGDLGKRMILRNLLEKHKDELRLFHRSAGQ
ADDB_NATTJ      -SGFSRLHILSFQRLSQKVLEEQGGIAKADLSDTGKEMIIKNILLQRKDDLEILEKVAVK
ADDB_ALKMQ      LTGMMRAEVLSFTRLAHRVFSEVGGLTRVPINELGKNMILRKIADESLKELSIYQSIAKQ
ADDB_ALKOO      LKGIMRAEVLSFTRLTHYVFNEVGGITKIPINEIGKNMILRKIADESSKDLSIYKSIAKQ
ADDB_CLOPE      ERYVLNAEVLSFKRLAHNVFNECGGATRTIMGDAGKSMLIFKVLEDLGDNMTVFKNASRQ
ADDB_CLOP1      ERYVLNAEVLSFKRLAHNVFNECGGATRTIMGDAGKSMLIFKVLEDLGDNMTVFKNASRQ
ADDB_CLOPS      ERYVLNAEVLSFKRLAHNVFNECGGATRTIMGDAGKSMLIFKVLEDLGDNMTVFKNASRQ
ADDB_CLOBB      ERAALNTHVLSFRTMCQKVFEECGGRVKQIIKDTGKHMLINKVLNEKIDDLSYFKKMSRE
ADDB_CLOBA      ERAFLNTHVLSFRTMCQKVFEECGGRVKQIIKDTGKHMLINKVLNEKIDDLSYFKKMSRE
ADDB_CLOB8      ENAFFRTEVLSFKKMAHNIFEEYGGRVKEIIKESGRNMLIHRVINENIEFLDYFNRMSRE
ADDB_THEP3      KDRKMRAQVLSFKTLANRVFTEVGGLTRQHVNSCGRSMVIYKIMEDLKENLKVYYKASRQ
ADDB_THEPX      KDRKMRAQVLSFKTLANRVFTEVGGLTRQHVNSCGRSMVIYKIMEDLKENLKVYYKASRQ
ADDB_CALS4      RDEKMRAQVLSFKTLANRVFVEVGGLARQHMKACGKSMVIYKVLEENKEKLKVYSKASRQ
ADDB_CLOD6      KDKYLRVRVLSFKTLSNIVFSQVGGLTDVNINSSGKAMMVYRAIEDVSEELNVFSKSKSQ
ADDB_HUNT2      TGGILKTEVLSFSRIAYRTFNEAGGITYPHIHSAGKCMILYRILDKMKGSFRVFSKTADR
ADDB_RUMCH      TGGILKTEVLSFRRMAYRVLNEVGGITYPHIHPSGKNMIIYRILERLKDQFTIFHKSANC
ADDB_CLOBK      EKTGFKTQVLSFKRMAYRVFNEVGGITAKHMNESGKSMLLYNIIEDNKNNLKVFKKAAKR
ADDB_CLOBL      EKTGFKTQVLSFKRMAYRVFNEVGGITAKHMNESGKSMLLYNIIEDNKNNLKVFKKAAKR
ADDB_CLOBH      EKTGFKTQVLSFKRMAYRVFNEVGGITAKHMNESGKSMLLYNIIEDNKNNLKVFKKAAKR
ADDB_CLOB1      EKTGFKTQVLSFKRMAYRVFNEVGGITAKHMNESGKSMLLYNIIEDNKNNLKVFKKAAKR
ADDB_CLOBM      EKTGFKTQVLSFKRMAYRVFNEVGGITAKHMNESGKSMLLYNIIEDNKNNLKVFKKAAKR
ADDB_CLOK1      EKGTLKAQVLSFRRMAEKVFDEVGGGIKKYINDAGKNILLYKIIEENKNKLKVYKTSAKK
ADDB_CLOTE      ERAVSRAEVLSFKRMAYRVFNEVGGVTHRYMNESGKNMLLYSILNELTGELKIFNNAANK
ADDB_CLONN      GTGITNVKVTSFERIAYDVFNEVGGSTHKIINSSGKLMLIFNIINNLKDELKVFATAANQ
ADDB_CLOAB      EKSINRVKVISFKRLAYRIFDEVGGIAREHMNSSGKSMLFYHIMNTLKSEFRVFALSARQ
ADDB_LACP7      -KGIHNIDILSFLRLAFRIFEETGGNDRLVLEDTGKSMIVKKVMMEKRNDLILFGANVKK
                        :  :  :      . *.         .  : .                    

ADDB_STAEQ      YGLSEKLAEQIQDFKKYNVTPE-------HLNQLIENHSIQTRTKHKLEDISLIYKQLES
ADDB_STAES      YGLSEKLAEQIQDFKKYNVTPE-------HLNQLIENHSIQTRTKHKLEDISLIYKQLES
ADDB_STAAB      YGFSEKLTEQIQDFKKYAVTPE-------HLESFIADKNMQTRTKNKLEDIALIYREFEQ
ADDB_STAAR      YGFSEKLTEQIQDFKKYAVTPE-------HLESFIADKNMQTRTKNKLEDIALIYREFEQ
ADDB_STAAW      YGFSEKLTEQIQDFKKYAVTPE-------HLEHFIADKNMQTRTKNKLEDIALIYREFEQ
ADDB_STAAS      YGFSEKLTEQIQDFKKYAVTPE-------HLEHFIADKNMQTRTKNKLEDIALIYREFEQ
ADDB_STAA1      YGFSEKLTEQIQDFKKYAVTPE-------HLEHFIADKNMQTRTKNKLEDIALIYREFEQ
ADDB_STAA2      YGFSEKLTEQIQDFKKYAVTPE-------HLEHFIADKNMQTRTKNKLEDIALIYREFEQ
ADDB_STAA9      YGFSEKLTEQIQDFKKYAVTPE-------HLEHFIADKNMQTRTKNKLEDIALIYREFEQ
ADDB_STAAM      YGFSEKLTEQIQDFKKYAVTPE-------HLEHFIADKNMQTRTKNKLEDIALIYREFEQ
ADDB_STAAN      YGFSEKLTEQIQDFKKYAVTPE-------HLEHFIADKNMQTRTKNKLEDIALIYREFEQ
ADDB_STAA3      YGFSEKLTEQIQDFKKYAVTPE-------HLEHFIADKNMQTRTKNKLEDIALIYREFEQ
ADDB_STAA8      YGFSEKLTEQIQDFKKYAVTPE-------HLEHFIADKNMQTRTKNKLEDIALIYREFEQ
ADDB_STAAT      YGFSEKLTEQIQDFKKYAVTPE-------HLEHFIADKNMQTRTKNKLEDIALIYREFEQ
ADDB_STAAC      YGFSEKLTEQIQDFKKYAVTPE-------HLEHFIADKNMQTRTKNKLEDIALIYREFEQ
ADDB_STAAE      YGFSEKLTEQIQDFKKYAVTPE-------HLEHFIADKNMQTRTKNKLEDIALIYREFEQ
ADDB_STAHJ      YGFSEKLSEQIQDFKKYSVTPE-------HLHTFLQDNDLKTRTRHKLEDISLIYQYFEE
ADDB_STAS1      YGFSEKLYEQIQDFKKYAVSPQ-------QLETYIAENNLQTRTKHKLQDIALVYKHLED
ADDB_STACT      YGFSAKLSEQIQDFKKYAVSPE-------QLEQFISENPLQTRTQDKLHDIALVYRHLEE
ADDB_EXIS2      PGFYKGLDELIASFKRSLVNPD-------MLRQISGAS---PERSPKLNDLALIYERFTE
ADDB_LISMH      KGFYSELANLFKEMKQEEVSIEDMVQ-----SATNL----STSVNNKVHDISLIYQKYEE
ADDB_LISMO      KGFYSELANLFKEMKQEEVSIEDMVK-----SATNL----STSVNNKVHDISLIYQKYEE
ADDB_LISMF      KGFYAELANLFKEMKQEEVSIEDMVK-----SATNL----STSVNNKIHDISIIYQKYEE
ADDB_LISIN      KGFYSELAKLFKEMKQEEISVDELEK-----SAANL----STSVSSKVHDISLIYQKYEE
ADDB_LISW6      KGFYSELAKLFKEMKQEEVSVADLEN-----SAINM----SKSVTNKIHDISLIYQKYEE
ADDB_LYSSC      RGFTEEIETLLKEFSRYSVNSSVLAEVKESLKAIDA----PNTLQAKTNDLYVVLQALEE
ADDB_BACHK      NGFFEHLGSMIAEFKRYNVTPSNVYEMWQQLDAHSS-SAEQKLLANKVYDLQLLYDDFER
ADDB_BACCZ      NGFFEHLGSMIAEFKRYNVTPSNVYEMWQQLDAHSS-SAEQKLLANKVYDLQLLYDDFER
ADDB_BACAN      NGFFEHLGSMIAEFKRYNVTPSNVYEMWQQLDAHSS-SAEQKLLANKVYDLQLLYDDFER
ADDB_BACC0      NGFFEHLGSMIAEFKRYNVTPSNVYEMWQQLDAHSS-SAEQKLLANKVYDLQLLYDDFER
ADDB_BACC7      NGFFEHLGSMIAEFKRYNVTPSNVYEMWQQLDAHSS-SAEQKLLANKVYDLQLLYDDFER
ADDB_BACCQ      NGFFEHLGSMIAEFKRYNVTPSNVYEMWQQLDAHSS-SAEQKLLANKVYDLQLLYDDFER
ADDB_BACC1      NGFFEHLGSMIAEFKRYNVTPSNVYEMWQQLDAHSS-SAEQKLLANKVYDLQLLYDDFER
ADDB_BACAH      NGFFEHLGSMIAEFKRYNVTPSNVYEMWQQLDAHSS-SAEQKLLANKVYDLQLLYDDFER
ADDB_BACC4      NGFFEHLGSMIAEFKRYNVTPSNVYEMWQQLDAHSS-SAEQKLLANKVYDLQLLYDDFER
ADDB_BACCR      NGFFEHLGSMIAEFKRYNVTPSNVYEMWQQLDAHSS-SAEQKLLANKVYDLQLLYDDFER
ADDB_BACC2      NGFFEHLGSMIAEFKRYNVTPSNVYEMWQQLDAHSS-SAEQKLLANKVYDLQLLYDDFER
ADDB_BACMK      NGFFEHLGSMIAEFKRYNVTPSNVYEMWQQLDTHSS-SAEQKLLANKVYDLQLLYDDFER
ADDB_BACCN      NGFFEHLGGMIAEFKRYNITPSHVYEMWQQLDAHSS-SAEQKLLANKIYDLQLLYDDFER
ADDB_BACSU      SGFTAQVERMLTEFKRYCLEPEDIRRMAESGTA-SE-YRGERVLSEKLHDLSILYQQMEK
ADDB_BACVZ      TGFTEQVERMLTEFKRYCIEPEDVRRMAESGTA-SE-YRGERMLSEKLHDLGILYQQMER
ADDB_BACLD      SGFTEQVERMLTEFKRHCLPPQSIRDMMEGTGK-SE-YEDERILSDKLHDLYILYSKLEE
ADDB_BACP2      PGFVEQIEKTMAEFKRYCMLPEEIEKISVESML-SE-YTEERRAAEKLHDLHVLYQQMEE
ADDB_GEOKA      HGFIEQLNEMITECKRYCLTPGELRRHAKAFEDGPD-QPGRRLLADKLSDVALVYEELER
ADDB_GEOTN      SGFVEQLHEMIAECKRYCLTPDELRRHAGVLESGSG-QPGRRLLADKLSDVALVYEELER
ADDB_ANOFW      RGFIEQLEQMLTEYKRYCVTPATLKQTEEQLRRHA--TANETVLADKLKDTAMIFEQFEQ
ADDB_OCEIH      QGFLGQLETMLTELKRYEITPDDLRMQQSHLTDFVHQSPSEQGLTRKLSDLIYIYETFIY
ADDB_DESHY      PGMADLLAQAIAEFKIYRITPD-------QLRGIED---ADELLLQKTHELAFLYEELNK
ADDB_DESHD      PGMADLLAQAIAEFKIYRITPD-------QLRGIED---ADELLLQKTHELAFLYEELNK
ADDB_SYMTH      PGFIERVAGSIRELRSYRQGPESLRRQLSQLEAEGL---GETSLGAKLHDLALVMDELRS
ADDB_MOOTA      PGFIEQLAHTIAELKLYRVTPADLDRILERYRETGR---EQTILARKLRDLALVYRELET
ADDB_DESAP      YGFSGTLAGVLSELKTYLVTPEALEQAVRMLPGTA----ETDSLQAKLEDLRLLYTDFER
ADDB_DESRM      PGFADSLASALSELKLYRIEPQELQKGIQHMQEAP----GSAI-RDKLADLSLLYNDLEE
ADDB_PELTS      PGFADTLARTLGEMKTYCIGPDELARAAFDLREKG----GAALLADKLEDLAKLCFDLED
ADDB_HELMI      PGFADALAGALSELKLYNIDATSLDRCQTEVIERQ----GAGLLADKLHDLALLYGALKT
ADDB_NATTJ      SGFSEKLSRLISEARMYEITPEMLEQISQELDLIH--------LKQKLQEISQVFTDYET
ADDB_ALKMQ      DGFITKLNELICEMKQHDITPTELTMELNEIEEETI-------LKRKLEDITLLYQRFNN
ADDB_ALKOO      EGFITKLNDLICEMKQHDITPIELTMEFNEMEEDTL-------LKRKLNDIILLYQKFNN
ADDB_CLOPE      KGFIDIASKTITEFKKYNVNNEVLDLTINEIEDEN--------LKMKMEELKDVFNEFNS
ADDB_CLOP1      KGFIDIASKTITEFKKYNVNNEVLDLTINEIEDEN--------LKMKMEELKDVFNEFNS
ADDB_CLOPS      KGFIDIASKTITEFKKYNVNNEVLDLTINEIEDEN--------LKMKMEELKDVFNEFNS
ADDB_CLOBB      QGFNNIISELITEFKKYNIDIDALRDLTDKIDDNE--------LVEKIRELSLIYEEFNV
ADDB_CLOBA      QGFNNIISELITEFKKYNINIDALRDLTDKIDDNE--------LVEKIRELSLIYEEFNV
ADDB_CLOB8      QGFNEIISEVISEFKKYNISIDSIRAIDEKINDAE--------LYQKVKELMIIYEAFNL
ADDB_THEP3      QGFIKKISEVITEFKRFEVTPEKLMDTAESIQKEG--------LREKLRELSLIYGKFDE
ADDB_THEPX      QGFIKKISEVITEFKRFEVTPEKLMDTAESIQKEG--------LREKLRELSLIYGKFDE
ADDB_CALS4      QGFVKKISEAITEFKRFDVTPFQLIDASEKIEKLG--------LKEKLEDLALIYSSFEE
ADDB_CLOD6      SGFVSSITDMISEMKQYNISPEMLENISGELDNET--------LSLKLKDISKIYNSFEG
ADDB_HUNT2      QGFVNTLSTLITEFKKYNVTPEDLEKVSKELEEDNP-------VKEKLMELTAIYDLFEK
ADDB_RUMCH      KGFVNTLSTLITELKRYNVRAESFDEVLQGLADDNY-------LSHKLKEIKLIYSEFDS
ADDB_CLOBK      QGFITTISDIITEFKRYNITPEIILNNLENIEGDN--------LKYKMEDLALIFSQFET
ADDB_CLOBL      QGFITTISDIITEFKRYNITPEIILNNLENIEGDN--------LKYKMEDLALIFSQFET
ADDB_CLOBH      QGFITTISDIITEFKRYNITPEIILNNLENIEGDN--------LKYKMEDLALIFSQFET
ADDB_CLOB1      QGFITTISDIITEFKRYNITPEIILNNLENIEGDN--------LKYKMEDLALIFSQFET
ADDB_CLOBM      QGFITTISDIITEFKRYNITPEIILNNLENIEEDN--------LKYKMEDLALIFSQFET
ADDB_CLOK1      QGFVNLVSDIIGEFKKYNISPEFLKENLDSIENKS--------LKNKLEDIGMLFLEFQN
ADDB_CLOTE      NGFVSTLSDIITEFKRYNLTPEMIKEYLEVAEERED-----NILKGKLQDIYLIYSKFQD
ADDB_CLONN      EGFVNNISDIITELKRYDVTATELRATLNLIEDEF--------LKDKINDISYIFEQFQE
ADDB_CLOAB      KGFVNTIADTVSEFKKYELTTEVLRDTIDEIEDEE--------LKNKLHDLSLIYDEFNR
ADDB_LACP7      QGFVEEMKSIISELAQYSIHTDELQKMKEVAKGKP-------LLNHKLTDIMTIYQAYEE
                 *:       . .                                 *  :   :      

ADDB_STAEQ      RMNGEFITT-EDSLQQFIEILSQS--QWIKKAEVFIDGFHNFSTLEYRIIEALVQHAKQV
ADDB_STAES      RMNGEFITT-EDSLQQFIEILSQS--QWIKKAEVFIDGFHNFSTLEYRIIEALVQHAKQV
ADDB_STAAB      RIQNEFITG-EDALQYFIDCMPKS--EWLKCADIYIDGFHNFSTIEYLIIKGLIKYAKSV
ADDB_STAAR      RIQNEFITG-EDALQYFIDCMPKS--EWLKRADIYIDGFHNFSTIEYLIIKGLIKYAKSV
ADDB_STAAW      RIQNEFITG-EDSLQYFIDCMPKS--EWLKRADIYIDGFHNFSTIEYLIIKGLIKYAKSV
ADDB_STAAS      RIQNEFITG-EDSLQYFIDCMPKS--EWLKRADIYIDGFHNFSTIEYLIIKGLIKYAKSV
ADDB_STAA1      RIQNEFITG-EDSLQYFIDCMPKS--EWLKRADIYIDGFHNFSTIEYLIIKGLIKYAKSV
ADDB_STAA2      RIQNEFITG-EDSLQYFIDCMPKS--EWLKRADIYIDGFHNFSTIEYLIIKGLIKYAKSV
ADDB_STAA9      RIQNEFITG-EDSLQYFIDCMPKS--EWLKRADIYIDGFHNFSTIEYLIIKGLIKYAKSV
ADDB_STAAM      RIQNEFITG-EDSLQYFIDCMPKS--EWLKRADIYIDGFHNFSTIEYLIIKGLIKYAKSV
ADDB_STAAN      RIQNEFITG-EDSLQYFIDCMPKS--EWLKRADIYIDGFHNFSTIEYLIIKGLIKYAKSV
ADDB_STAA3      RIQNEFITG-EDSLQYFIDCMPKS--EWLKRADIYIDGFHNFSTIEYLIIKGLIKYAKSV
ADDB_STAA8      RIQNEFITG-EDSLQYFIDCMPKS--EWLKRADIYIDGFHNFSTIEYLIIKGLIKYAKSV
ADDB_STAAT      RIQNEFITG-EDSLQYFIDCMPKS--EWLKRADIYIDGFHNFSTIEYLIIKGLIKYAKSV
ADDB_STAAC      RIQNEFITG-EDSLQYFIDCMPKS--EWLKRADIYIDGFHNFSTIEYLIIKGLIKYAKSV
ADDB_STAAE      RIQNEFITG-EDSLQYFIDCMPKS--EWLKRADIYIDGFHNFSTIEYLIIKGLIKYAKSV
ADDB_STAHJ      RINGEFITS-EDSLNHFIDILSQS--EWIKRAEVYIDGFHNFSTLEYQIIKALVQSAKKV
ADDB_STAS1      RINGEYVST-EDSLQRFIEMMDQS--EWLKRAEIYIDGFHNFSTLEYQIIQSLVKYAKKV
ADDB_STACT      RLADNFVSS-EDTLYKFIEKMDES--KWLKRAEIYIDGFHNFSTLEYQIIEKLAQCAKSV
ADDB_EXIS2      RISDKALHA-DDYFTTLIELLPKA--D-LSDVSVFVDGFYEFSLQEQQVLLRLMELTKDM
ADDB_LISMH      LLADKFLEN-EDYLRLLAEKIADS--DYLNRTEIVIDGFTSFSKQELTVIGELMRKCDKV
ADDB_LISMO      LLADKFLEN-EDYLRLLAEKIADS--DYLNQTEIVIDGFTSFSKQELTVIGELMRKCDKV
ADDB_LISMF      LLADKFLEN-EDYLRLLAEKITES--DYLNQTEIVIDGFTSFSQQELTVIGALMRKCDKV
ADDB_LISIN      LLAGKFLEN-EDYLRLLADKIIES--DYLNQTEIIIDGFTSFSKQELTVIEKLMQKCDKV
ADDB_LISW6      LLAGKFLEN-EDYLRLLADKIIES--DYLNQTEIIIDGFTSFSKQELTVIEKLMEKCDKV
ADDB_LYSSC      RLGTTYVDS-EGYYPILTEQLKYA--ETMKQATIYIDGFTAFTVRELELVRELLKVTKHV
ADDB_BACHK      ALIGKYLDS-EDYLQLLVEKLPQS--EYVKGAEIYIDGFHSFSPQELEIVRQLMICGARV
ADDB_BACCZ      ALIGKYLDS-EDYLQLLVEKLPQS--EYVKGAEIYIDGFHSFSPQELEIVRQLMICGARV
ADDB_BACAN      ALIGKYLDS-EDYLQLLVEKLPQS--EYVKGAEVYIDGFHSFSPQELEIVRQLMICGARV
ADDB_BACC0      ALIGKYLDS-EDYLQLLVEKLPQS--EYVKGAEVYIDGFHSFSPQELEIVRQLMICGARV
ADDB_BACC7      ALIGKYLDS-EDYLQLLVEKLPQS--EYVKGAEIYIDGFHSFSPQELEIVRQLMICGARV
ADDB_BACCQ      ALIGKYLDS-EDYLQLLVEKLPQS--EYVKGAEIYIDGFHSFSPQELEIVRQLMICGARV
ADDB_BACC1      ALIGKYLDS-EDYLQLLVEKLPQS--EYVKGAEIYIDGFHSFSPQELEIVRQLMICGARV
ADDB_BACAH      ALIGKYLDS-EDYLQLLVENLPQS--EYVKGAEVYIDGFHSFSPQELEIVRQLMICGARV
ADDB_BACC4      ALIGKYLDS-EDYLQLLVEKLPQS--EYVNGAEIYIDGFHSFSPQELEIVRQLMICGARV
ADDB_BACCR      ALIGKYLDS-EDYLQLLVEKLPQS--EYVNGAEIYIDGFHSFSPQELEIVRQLMICGARV
ADDB_BACC2      ALIGKYLDS-EDYLQLLVEKLPQS--EYVNGAEIYIDGFHSFSPQELEIVRQLMICGARV
ADDB_BACMK      ALIGKYLDS-EDYLQLLIEKLSDS--EYVKGAEIYIDGFHSFSPQELEIVRGLMRLGTRV
ADDB_BACCN      ALIGKYLDS-EDYLQLLIEKLPFS--EYVKDAEIYIDGFHSFSPQELEIIRQLMRCGARM
ADDB_BACSU      SLADQYLHS-EDYLTLLAEHIPLA--EDIKGAHIYVDGFYQFTPQEFRVLEQLMVHAEHI
ADDB_BACVZ      SLAGHYLHS-EDYLTLLAQQIPLA--DVVKGAHVYVDGFYQFTPQELRVLEQLIMHAEHV
ADDB_BACLD      NLENQYVQS-EDYLTLLAEQIPYA--EEIRNAAVYVDGFHQFTPQEMSVLEQLMVHAEEI
ADDB_BACP2      HLQDEYVHS-EDYLNLLAQQIPSA--EEIKGAHIYIDGFYQFTPQQLLVIEQLLLHAAKV
ADDB_GEOKA      SLIGHYLDS-EDYLRLLAEHIPRS--SYLRDADIYIDGFHHFAPQEYMIIEQLLRHCRRV
ADDB_GEOTN      SLLGHYLDS-EDYLRLLVEHIPRS--SYLHGADIYIDGFHHFSPQEYMVIEQLLHRCRRV
ADDB_ANOFW      QMAHHYVDS-EDYLRLLAEKIRHS--SYMKRARIYMDGFYEFTPQEYMVIEQLFIHCPHV
ADDB_OCEIH      ALQGTYVDS-EDQLQLLIQQIKQS--SILNNADIYIDGFHSFTPQEQSVLTELMKTSNSI
ADDB_DESHY      SLGTAARDP-DDELNLVAGKISQA--PFLQGAKIWVDGFKGFTPQELYVIQAMLGTAAEI
ADDB_DESHD      SLGTAARDP-DDELNLVAGKISQA--PFLQGAKIWVDGFKGFTPQELYVIQAMLGTAAEI
ADDB_SYMTH      YIEGRFTDP-DEYLTVLAARLEES--RLLEGAEVWVDGFNGFTPQELAVLGAVMRSARQV
ADDB_MOOTA      YLAGRYLDP-DDYLTLLAGRLPEA--AFIRGARVWVDGFNGFTPQEEAVLQALMAVAEQV
ADDB_DESAP      ELAGKYIDP-DDYLTLLAARLGES--PTLRAAEVWVDGFAGFTPQEYAVLEALLKAAARV
ADDB_DESRM      FLSGRFTDP-DDYLNLLAQRLPGS--RTVQGAEIFIDGFTGFTPQEYGVIEQMLGTADRV
ADDB_PELTS      YLAGRFTDP-DDYLNLLADCLELS--AEVRGTEVWVDGFSGFTPQEYRVLAALARTASRV
ADDB_HELMI      FLEGKYTDP-DDYLHLLAQRIPGS--VMLRDAEVWVDGFAGFTPQELSVLAALMSACRRV
ADDB_NATTJ      FLQHQGYHHQEDRLSKAGQKMEGNNISFLAGSTCYIDGFSGFTPQELKLLEGLLTKCSNI
ADDB_ALKMQ      YLKGQYVDN-EDHVNLLIENIERV--EFLEGAEIWIDGFQSFTPQIIRVIEKLAQKVANI
ADDB_ALKOO      YLRDRYVDN-EDNVNLLIENIEKV--QFLEGAEVWIDGFQSFTPQIFRVIEKLAEKVKNL
ADDB_CLOPE      RLHEGYVDE-EDQLLLLNEKLDGC--SLYDGAEIWIDEFSSFTPNQLSVIGKLLKRAKSV
ADDB_CLOP1      RLHEGYVDE-EDQLLLLNEKLDGC--SLYDGAEIWIDEFSSFTPNQLSVIGKLLKRAKSV
ADDB_CLOPS      RLHEGYVDE-EDQLLLLNEKLDGC--SLYDGAEIWIDEFSSFTPNQLSVIGKLLKKAKSV
ADDB_CLOBB      KMHSSYIDT-DDELTLLAKKLLAN--NIYANSEIWIDEFTTFTPQQLEIIRIISKTSV-V
ADDB_CLOBA      KMHSSYIDT-DDELTLLAKKLLAN--NIYANSEIWIDEFTTFTPQQLEIIRILSKASV-V
ADDB_CLOB8      KMHENYIDG-DDELTLLDKKLLES--SAYVDSEVWIDEFTSFTPQQLDIIKVLAKRCRRV
ADDB_THEP3      LLHQKYIDE-EDALTLLAEKLEYS--EQFKGAEFWIDGFTGFTPKQYKVLEKLLKKAARV
ADDB_THEPX      LLHQKYIDE-EDALTLLAEKLEYS--EQFKGAEFWIDGFTGFTPKQYKVLEKLLKKAARV
ADDB_CALS4      VLHKNYIDE-EDELDLLSKKLEKS--LQFEGAEFWIDGFTGFTPKQYKVIEKLLKKASRV
ADDB_CLOD6      KLHENYVDA-QDMLTSLTSKIELS--SYLDGACVYIDEFTGFTPNQYNVIKSILNKSKSV
ADDB_HUNT2      TIAERYRDP-DDDLTLAAKKLGSI--PLYDGAEIWIDGFTGFTPQEYQIIGQLMKKAQRV
ADDB_RUMCH      MLVDRYRDT-DDELTLLSSKLEGT--EIYAKSEIWIDGFAGFTPQEVEVISKLIQQAENV
ADDB_CLOBK      RLHKNYIDN-EDDLTILVEKLNKS--KQFDNAEIWIDEFSSFSPQEYSVLEKLLLKSYRI
ADDB_CLOBL      RLHKNYIDN-EDDLTILVEKLNKS--KQFDNAEIWIDEFSSFSPQEYSVLEKLLLKSYRI
ADDB_CLOBH      RLHKNYIDN-EDDLTILAEKLNKS--KQFDNAEIWIDEFSSFSPQEYSVLEKLLLKSYRI
ADDB_CLOB1      RLHKNYIDN-EDDLTILAEKLNKS--KQFDNAEIWIDEFSSFSPQEYSVLEKLLLKSYRI
ADDB_CLOBM      RLHKNYIDN-EDDLTILVEKLNKS--KQFDNAEIWIDEFSSFSPQEYSVLEKLLLKSYRI
ADDB_CLOK1      RLSKNYIDL-EDTLHILCEKLDKS--IIFKNSEVWIDEFSTFTPQEYSIIEKIMCSAYRV
ADDB_CLOTE      SIRKKFIDE-EENLTILADKLKES--KYFDGAYIWVDEFFNFTPQEYLVLEELLLKAEKV
ADDB_CLONN      SLHKNYIDS-EDELTLLYRKIDTS--KMFDGAEVWIDEFSSFTPQQYKILEKLMEKASRV
ADDB_CLOAB      LLYKNYIDP-DDDLTILKDKIKQS--TVLQGAEIWLDEFSSFIPQQYGIIEELLKKCSRV
ADDB_LACP7      FLQDKYINS-EEILDLLCDVIDDS--SFVNDSEICLDGFTGFTPSQYKLLSHLMKKAKSV
                 :        :         :              :* *  *      ::  :      :

ADDB_STAEQ      TVLLTTDGSH-----HPFSL----FRKPSEVLSHLEDIANRLNINLNKTYFNTF------
ADDB_STAES      TVLLTTDGSH-----HPFSL----FRKPSEVLSHLEDIANRLNINLNKTYFNTF------
ADDB_STAAB      TIILTTDGNH-----DQFSL----FRKPSEVLRHIEEIANELNISIERQYFKQS------
ADDB_STAAR      TIILTTDGNH-----DQFSL----FRKPSEVLRHIEEISNELNISIERQYFNQL------
ADDB_STAAW      TIILTTDGNH-----DQFSL----FRKPSEVLRHIEEIANELNISIERQYFNQL------
ADDB_STAAS      TIILTTDGNH-----DQFSL----FRKPSEVLRHIEEIANELNISIERQYFNQL------
ADDB_STAA1      TIILTTDGNH-----DQFSL----FRKPSEVLRHIEEIANELNISIERQYFNQL------
ADDB_STAA2      TIILTTDGNH-----DQFSL----FRKPSEVLRHIEEIANELNISIERQYFNQL------
ADDB_STAA9      TIILTTDGNH-----DQFSL----FRKPSEVLRHIEEIANELNISIERQYFNQL------
ADDB_STAAM      TIILTTDGNH-----DQFSL----FRKPSEVLRHIEEIANELNISIERQYFNQL------
ADDB_STAAN      TIILTTDGNH-----DQFSL----FRKPSEVLRHIEEIANELNISIERQYFNQL------
ADDB_STAA3      TIILTTDGNH-----DQFSL----FRKPSEVLRHIEEIANELNISIERQYFNQL------
ADDB_STAA8      TIILTTDGNH-----DQFSL----FRKPSEVLRHIEEIANELNISIERQYFNQL------
ADDB_STAAT      TIILTTDGNH-----DQFSL----FRKPSEVLRHIEEIANELNISIERQYFNQL------
ADDB_STAAC      TIILTTDGNH-----DQFSL----FRKPSEVLRHIEEIANELNISIERQYFNQL------
ADDB_STAAE      TIILTTDGNH-----DQFSL----FRKPSEVLRHIEEIANELNISIERQYFNQL------
ADDB_STAHJ      TVLLTTDGNE-----DPFSL----FRKPSEVLTHLKEIAKDLNIELQQQFFKQQ------
ADDB_STAS1      TIVLTTDGDR-----DLFSL----FRKPSESLTHIEEIANNLNIQLHSRQFLDV------
ADDB_STACT      SILLTTNGDK-----DPFSL----FRKTSSTLTHIEEIAQRQNIDFNLRRFTKQ------
ADDB_EXIS2      HLSFTLDVEDVY---TKQSE----FGVSQRCYMQLIEQMKERQIAHEDIYYGQT------
ADDB_LISMH      TVSLTLNVPEIQHGLDEYSM----FKASTEAYYALLELAKLNGTQVEENKFFLE------
ADDB_LISMO      TISLTLNVPEIQHGLDEYSM----FKASTEAYYALLELAKLNGTQVEENKFFLE------
ADDB_LISMF      TVSLALNVPEIKHGLDEYSM----FKASTEAYYALLELAKLNSINVEEDKFFLE------
ADDB_LISIN      TVSLTLNVPEIHKGLEDFSM----FKASTEAYFALLEMAKLNKIQVEPEKILLE------
ADDB_LISW6      TVSLTLNVPEIQKGLEEYNM----FKQSTEAYFALLEMAKLNKISVESDKLFLE------
ADDB_LYSSC      TVVLPFD--HIDEAFDEQAL----FHEAALTNQRLHDIANEEGIDVEPPLHFYY------
ADDB_BACHK      TITLTIDEKTLAQPVNELDL----FYETTLTYEKIKQVAREEKIEIEKTIPLME------
ADDB_BACCZ      TITLTIDEKTLAQPVNELDL----FYETTLTYEKIKQVAREEKIEIEKTIPLME------
ADDB_BACAN      TITLTIDEKTLAQPVNELDL----FYETTLTYEKIKQVAREEKIEIEKTIPLME------
ADDB_BACC0      TITLTIDEKTLAQPVNELDL----FYETTLTYEKIKQVAREEKIEIEKTIPLME------
ADDB_BACC7      TITLTIDEKTLAQPVNELDL----FYETTLTYEKIKQVAREEKIEIEKTIPLME------
ADDB_BACCQ      TITLTIDEKTLAQPVNELDL----FYETTLTYEKIKQVAREEKIEIEKTIPLME------
ADDB_BACC1      TITLTLDEKTLAQPVNELDL----FYETTLTYEKIKQVAREEKIEIEKTIPLME------
ADDB_BACAH      TITLTIDEKTLAQPVNELDL----FYETTLTYEKIKQVAREEKIEIEKTIPLME------
ADDB_BACC4      TITLTIDEKTLAQPVNELDL----FYETTLTYEKIKQVAREEKIEIEKTIPLME------
ADDB_BACCR      TITLTIDEKTLAQPVNELDL----FYETTLTYEKIKQVAREEKIEIEKTIPLME------
ADDB_BACC2      TITLTIDEKTLAQPVNELDL----FYETTLTYEKIKQVAREEKIEIEKTIPLME------
ADDB_BACMK      TITLTIDEKTLAQPVNELDL----FYETTLTYERIKQVAREEKIEVEKTIPLMK------
ADDB_BACCN      TITLTVDEKTFAQPVNELDL----FYETVLTYEKVKQVAREEKVVMEKTISLVE------
ADDB_BACSU      TFSLTADKPSYEREPHELEL----FRMTGKTYYRLHQKAKELNLDITYKELSGT------
ADDB_BACVZ      TFSLTADSPSAEQAPDELDL----FRMTGSTYYKLYQTAKELNADISCKELHGT------
ADDB_BACLD      TFSLTADKPFTANSPNDLHL----FRMTGKAYYDLYQKAKELGLDPSEVRLEET------
ADDB_BACP2      TAAFTVDQSYHDRQPNELDL----FRMTGKTYFQLYQLAKECGADISETIFERN------
ADDB_GEOKA      TVCLTIDRPYDDGMPDELHL----FYLPAQTYRQLRELALSNDIAIEEPIVLSA------
ADDB_GEOTN      TVCLTADRPYDVGMPDELDL----FYLPAQTYRQLRELALANDIMIESPVVLSV------
ADDB_ANOFW      TVALTLDAPYEQ-LPDDLHV----FRNTWRTYAQLRDIALQNGVPIEKVEQLRH------
ADDB_OCEIH      TVALTLDDPWKE-DASELDL----FYQPSQTYHVLKQLAWEAGVPVEDPIILDTLE----
ADDB_DESHY      TVSLPLDPELLKAGTPRFKPGEELFYEPRQTYQGLVDLAREAKASISHVFLTETHRFE--
ADDB_DESHD      TVSLPLDPELLKAGTPRFKPGEELFYEPRQTYQGLVDLAREAKASISHVFLTETHRFE--
ADDB_SYMTH      HISLCIPPGQLYKAGGHHSP-SDLFHPVLSTYDQLMQLAAESGVAVDPPLYL-NEPLR--
ADDB_MOOTA      TVTLCLDPTLRHRRLGET----ELFHPTGETYHRLRQLALAAGVRVEDDVCLAGTPPR--
ADDB_DESAP      NVALCLDP-----RSGRRED-LELFQVTRDTRARLAELARKNGVELERPVELAGPPAR--
ADDB_DESRM      HVALCFDPMYLQEPCDEL----EFFYPTVETYHTLLDMAGALRISLEPPIICGKETP---
ADDB_PELTS      NITLCADPAALSGKIDET----SLFFPVRETYDRLLKMALQERIPLERPLILGGNT----
ADDB_HELMI      NVALCLDPTELDEPCDLD----DPFFRTRETQAKLLQLAFDRGIVIEKALHLVPAPGQS-
ADDB_NATTJ      ELALTLPPQFTGKIDDEL----HLFHPTLKTYNQVWELAVNNDIEIKKSKHFPNENEEHR
ADDB_ALKMQ      TITFTME-------LNAKEKDKDLFHITQKTYLKVKTIAQKFNLD-EEVINLDIEERK--
ADDB_ALKOO      TITFTME-------LKSKESDQDLFHINRKTYLKIKSIAQRLGLE-EEIIDLDRNERP--
ADDB_CLOPE      NITLSID------EVNSLKGESDLFVATKNTEKRLMNLIQEEGIAFSGYINLNEDIPY--
ADDB_CLOP1      NITLSID------EVNSPKGESDLFVATKNTEKRLMNLIQEEGIAFNGYINLNEDISY--
ADDB_CLOPS      NITLSID------EVNSPKVESDLFVATKNTEKRLMNLIQEEGIAFNGYINLNEDIPY--
ADDB_CLOBB      NITLCMD----KIENSDAEDITNVFSSIENTENRILKLMEENNIGYLNPINLNSKLPY--
ADDB_CLOBA      NITLCMD----KIENSDVEDITNVFSSIENTENRLLKLMEENNIGYLNPINLNSKLPY--
ADDB_CLOB8      NITFCIDN---KSLNNNSEDITDVFNIIKSTENKILKIMKENNIAYDKPVNLNNAIPY--
ADDB_THEP3      SVTLTMD-----TSKD-SIDNTDLFYTTKKTEDKLLKICYENNISYEKPVDLNEGVPK--
ADDB_THEPX      SVTLTMD-----TSKD-SIDNTDLFYTTKKTEDKLLKICYENNISYEKPVDLNEGVPK--
ADDB_CALS4      SVTLTLD-----PSID-SIDPTHLFYTTKKTEEKLIKICETNGISVEEPVNLNKGIPK--
ADDB_CLOD6      NISLTVD-----DINYIGYSKSDMFSRTKFTYSKLTQLCNEEGIKILPQVNLNTGVIK--
ADDB_HUNT2      NISFCTD----CLDGDLND--TDIFSSIKTAYRKLVKMAKENGIPVEPSVVLNSKPLF--
ADDB_RUMCH      HITMCTD----ILFDDVQADLTDVFAAVKKSCKKFVSIAESYGVKILPPVCLNTPNLP--
ADDB_CLOBK      NITLCTD----YLNQGRFVDTTDVFSPIKNTENKLLQIIEDNNIKLDKPIALKCDPCA--
ADDB_CLOBL      NITLCTD----YLNQGRFVDTTDVFSPIKNTENKLLQIIEDNNIKLDKPIALKCDPCA--
ADDB_CLOBH      NITLCTD----YLNQGRFVDTTDVFSPIKNTENKLLQIIEDNNIKLDKPIALNCDPCA--
ADDB_CLOB1      NITLCTD----YLNQGRFVDTTDVFSPIKNTENKLLQIIEDNNIKLDKPIALKCDPCA--
ADDB_CLOBM      NITLCTD----YLNQGRFVDTTDVFSPIKNTENKLLQIIEDNNIKLDKPIALNCDPCA--
ADDB_CLOK1      NITLCMD----ALGEYSERESIDLFLPIKITERNILQIAEKNNIIYQKPVNLRCSPCY--
ADDB_CLOTE      NITLCTG----GLNEGERIDNLDLFLPVKNTEEKILEFVKRNNIKYEKPIKLNCDPCY--
ADDB_CLONN      NITLCMD----YYRVI---DGTDVFAPTKRTEEKLREILKEKDVKLDKPIILNNDDVN--
ADDB_CLOAB      NITLTMD----YDNAS---KDNDIFSVTQNTEKRLLKLAENNNISIEKPINLNGRPFY--
ADDB_LACP7      TVTITMDESQINRKQEEHQL----FYLSGKMAEKLTDLAITQKIEIKPPILVASENGG--
                   :                    *         .                         

ADDB_STAEQ      ------YRYNNDDLKNLENGFDALQFTPKHHQ-N-------HVKIFESSSMREEINEVAR
ADDB_STAES      ------YRYNNDDLKNLENGFDALQFTPKHHQ-N-------HVKIFESSSMREEINEVAR
ADDB_STAAB      ------YRFNNQDLKHLEQEFDALQINRVACQ-G-------HINILESATMREEINEIAR
ADDB_STAAR      ------YRFNNQDLKHLEQEFDALQINRVACQ-G-------HINILESATMREEINEIAR
ADDB_STAAW      ------YRFNNQDLKHLEQEFDVLQINRVACQ-G-------HINILESATMREEINEIAR
ADDB_STAAS      ------YRFNNQDLKHLEQEFDVLQINRVACQ-G-------HINILESATMREEINEIAR
ADDB_STAA1      ------YRFNNQDLKHLEQEFDVLQINRVACQ-G-------HINILESATMREEINEIAR
ADDB_STAA2      ------YRFNNQDLKHLEQEFDVLQINRVACQ-G-------HINILESATMREEINEIAR
ADDB_STAA9      ------YRFNNQDLKHLEQEFDVLQINRVACQ-G-------HINILESATMREEINEIAR
ADDB_STAAM      ------YRFNNQDLKHLEQEFDVLQINRVACQ-G-------HINILESATMREEINEIAR
ADDB_STAAN      ------YRFNNQDLKHLEQEFDVLQINRVACQ-G-------HINILESATMREEINEIAR
ADDB_STAA3      ------YRFNNQDLKHLEQEFDALQINRVACQ-G-------HINILESATMREEINEIAR
ADDB_STAA8      ------YRFNNQDLKHLEQEFDALQINRVACQ-G-------HINILESATMREEINEIAR
ADDB_STAAT      ------YRFNNQDLKHLEQEFDALQINRVACQ-G-------HINILESATMREEINEIAR
ADDB_STAAC      ------YRFNNQDLKHLEQEFDALQINRVACQ-G-------HINILESATMREEINEIAR
ADDB_STAAE      ------YRFNNQDLKHLEQEFDALQINRVACQ-G-------HINILESATMREEINEIAR
ADDB_STAHJ      ------YRFNNKDLIQLEQQFDALQINPIAYD-G-------SINILESSSIREEVNEVAR
ADDB_STAS1      ------QRFIHNDLKHLEQNFNALQFEPIPTE-G-------NVEILEASGMREEINEVAR
ADDB_STACT      ------ERFENRDLSHLEHSFNEVFFDKAAAE-G-------NINILETSNVREEVNAIAR
ADDB_EXIS2      ------VKFQSTGLRMLEQALLSPGYPPTDEEVT-------GVTVSAAVNRQVETEAAVR
ADDB_LISMH      -----NKRAKTESLAFLANTWGHNKFMSFKNEPQ-------NLKIHQANNRRAEIEGIAR
ADDB_LISMO      -----NKRAKTESLAFLANTWGHNKFMSFKNEPQ-------NLKIHQANNRRAEIEGIAR
ADDB_LISMF      -----NKRAKTESLAFLANAWGHNKFMAFKEEPH-------NLSVHQANNRRAEIEGVAR
ADDB_LISIN      -----NKRANSDSLAFLANAWGDNKYSSYEGGAN-------DLTIHQANNRRAEMEGVAR
ADDB_LISW6      -----NKRAKSDSLAFLADVWGNNKFVTFEEKPQ-------DLAIHQANNRRAEIEGIAR
ADDB_LYSSC      -----TQRFQSEDLQHVEANFA-NMVPHTKKTSG-------DVMVFEASNRRAEVHAIAR
ADDB_BACHK      -----QPRFHSPALAHLEAHYEARPNEKFNGEA--------SVTIHTAANLRAEVEGVAR
ADDB_BACCZ      -----QPRFHSPALAHLEKHYEARPNEKFHGEA--------SVTIRTAANLRAEVEGVAR
ADDB_BACAN      -----QPRFHSPALAHLEMHYEARPNEKFHGEA--------SVTIHTAANLRAEVEGVAR
ADDB_BACC0      -----QPRFHSPALAHLEMHYEARPNEKFHGEA--------SVTIHTAANLRAEVEGVAR
ADDB_BACC7      -----QPRFHSPALAHLEAHYEARPNEKFNGEA--------SVTIHTAANLRAEVEGVAR
ADDB_BACCQ      -----QPRFHSPALAHLEAHYEARPNEKFNGEA--------SVTIHTAANLRAEVEGVAR
ADDB_BACC1      -----QPRFHSPALAHLEAHYEARPNEKFNGEA--------SVTIHTAANLRAEVEGVAR
ADDB_BACAH      -----QPRFHSPALAHLEMHYEARPNEKFHGEA--------SVTIHTAANLRAEVEGVAR
ADDB_BACC4      -----QPRFHSPALAHLEAHYEARPNEKFNGEA--------SVTISTAANLRAEVEGVAR
ADDB_BACCR      -----QPRFHSPALAHLEAHYEARPNEKFNGEA--------SVTISTAANLRAEVEGVAR
ADDB_BACC2      -----QPRFHSPALAHLEAHYEARPNEKFNGQA--------SVTISTAANLRAEVEGVAR
ADDB_BACMK      -----QPRFHSQALAHLEMHYEARPNEKFHGEA--------SVTISTAANLRAEVEGVAR
ADDB_BACCN      -----QPRFHSPALAHLEAHYESRPNEKFYGET--------SIAIHTAANLRAEVEGVAR
ADDB_BACSU      -----ERHTKTPELAHLEAQYEARPAIPYAEKQE-------ALTVMQAANRRAELEGIAR
ADDB_BACVZ      -----KRHQHAPELACIESQYDVRPAAAYTGGQE-------AFTVMQAQNRRAELEGIAR
ADDB_BACLD      -----KRHRHHPELQHLERYFDERPAKPYPGQTE-------SLRIMQASNRRTEIEGIAR
ADDB_BACP2      -----HRHLYTPDLAYLEHQYEQRPVQPYQENTP-------HLTVSKSASKRAEIEGVAR
ADDB_GEOKA      -----NRRHEDRALVHLEAQFHRRPLLPYGAKTD-------AVHLYEASNRRAEIEAVAR
ADDB_GEOTN      -----NRRHQDKALAHLEEQFHRRPLLPYEAETD-------AICLYEAANRRAEIEAVAR
ADDB_ANOFW      -----NVRHKHEELRHLEAHYDDRPVCKWEKQTE-------AIIIGEATTRRAEIEGIAR
ADDB_OCEIH      -----GNFQNRPYFAHMEKYFDSRPAPAYEGEV--------PIEIFEAVHPRAEVEGIAQ
ADDB_DESHY      ----------KAGLKHLERFYNAYPTQTFPGGDDSTAPDPLGIALFPAANKRAEVEGVAR
ADDB_DESHD      ----------KAGLKHLERFYNAYPTQTFPGGDDSTAPDPLGIALFPAANKRAEVEGVAR
ADDB_SYMTH      -------FRGAPELAHVERYLFRQSAPAWPGAPE-------RIALVEAQNRREEVAAAAR
ADDB_MOOTA      -------FREAPALAHLEAHFGRWPLRPFRGDAA-------GIRLVAAANRRVEVEAAAR
ADDB_DESAP      -------FRANPALAHLEREFFRRPTKKFAGPPE-------NLRLVAAASRRAEVEGAAR
ADDB_DESRM      -----VRFQKDSAIAHLEKYYFRHPLQAS-DAAQ-------GVSLVACANRRAEVEAAAR
ADDB_PELTS      -----ARF-KSPAISHLEKYFFVRPAPPCLNCSE-------GVVLAAAANPKAEAEGVAR
ADDB_HELMI      -----APRFQHPELQHLESFYFRRPAPPWLGGTQ-------SLFVCAAANRRSEVEGAAR
ADDB_NATTJ      SASSLPRFKDNPALAHLEKEWGKNKINPYDSEPT-------GLSIVEGTNLRNEIDKIAR
ADDB_ALKMQ      ------VLPKEKEIAHIEREFNTYPYKQYADEIA-------NLEIFAGSNLYSEMENVAA
ADDB_ALKOO      ------VLPKVQEICHIEKELYAYPYQQYTGEIT-------HLDVFSGSNLYTEMENVAA
ADDB_CLOPE      ------RFKENKELAHIERQLYAYPFKQYRGKNN-------SLRLYRANNNYDEIEFVAK
ADDB_CLOP1      ------RFKENKELAHIERQLYAYPFKQYRGKNN-------SLRLYRANNNYDEIEFVAK
ADDB_CLOPS      ------RFKENKELAHIERQLYAYPFKQYRGENN-------SLRLYRANNNYDEIEFVAK
ADDB_CLOBB      ------RFKNSEELAHIEKYCITYPFKSYKGKNK-------DVRLYKANNTYDEIEKVAQ
ADDB_CLOBA      ------RFKNSEELSHIEKYCITYPFKSYKGKNK-------DVRLYKANNTYDEIEKVAK
ADDB_CLOB8      ------RFKGNLELDHIEKYFFSYPFNEYDKNPE-------SITLYKASNIYDEIERVSK
ADDB_THEP3      ------RFEKNEEMAFLEKHLFSYPYKIYSKDTK-------NISLFKAVNVYSEVEETAR
ADDB_THEPX      ------RFEKNEEMAFLEKHLFSYPYKIYSKDTK-------NISLFKAVNVYSEVEETAR
ADDB_CALS4      ------RFEHNKELAFLEKNFFSHPYEIYNEETK-------NISIFKATNMYSEVEEVAR
ADDB_CLOD6      ------RFEKVKELQHLERFYNAYPYKIYSNPTE-------NIKIKEFNNLYSEVEEIAR
ADDB_HUNT2      ------RFSQSPELSHLEQYLYAYPYKTYNEKTK-------DISLFSSVNIFAEVEACAR
ADDB_RUMCH      ------RFKDSRELQSLETNYCSYSYRAYQLPTQ-------DIELFESVNIYTEIEECAR
ADDB_CLOBK      ------RFKNSAELQHLEKNMFSFPYKEYKNETK-------DICMLKTLNQFTEIENTAK
ADDB_CLOBL      ------RFKNSAELQHLEKNMFSFPYKEYKNETK-------DICMLKTLNQFTEIENTAK
ADDB_CLOBH      ------RFKNSAELQHLEKNMFSFPYKEYKNETK-------DICMLKTLNQFTEIENTAK
ADDB_CLOB1      ------RFKNSAELQHLEKNMFSFPYKEYKNETK-------DICMLKTLNQFTEIENTAK
ADDB_CLOBM      ------RFKNSIELQHLEKNMFSFPYKEYKNETK-------DICMLKTLNQFTEIENTAK
ADDB_CLOK1      ------RFKNSTALQHLQHSLFSYPYKNYEKSTE-------DINIFKALNKYTEIDYIAR
ADDB_CLOTE      ------RFKNSKELSHMEKNLFAFPYKIHEKYTE-------DICVFQALNEYSEIEYTAR
ADDB_CLONN      ------RFKDSSELKYLEENYFKYPYKPYDKTTD-------DIKIIRALNPYSEVENIAK
ADDB_CLOAB      ------RFKNSPELSFLEKNLYSFPYEIYKKGPD-------KIEIFKTSNLYTEVEKIAR
ADDB_LACP7      ---YSYRFHNSMALSALEKNIFRYPYKSFTEEQD-------DISITAAKDPMAEARHAVI
                             :  :                         . :        *      

ADDB_STAEQ      RILKDVREADYKFRDIAILYRD-ESYAYLFESILPSYDIPFNIDTKKSMTHHPIMEMLRS
ADDB_STAES      RILKDVREADYKFRDIAILYRD-ESYAYLFESILPSYDIPFNIDTKKSMTHHPIMEMLRS
ADDB_STAAB      RIIVDIRDKQLRYQDIAILYRD-ESYAYLFDSILPLYNIPYNIDTKRSMTHHPVMEMIRS
ADDB_STAAR      RIIVDIRDKQLRYQDIAILYRD-ESYAYLFDSILPLYNIPYNIDTKRSMTHHPVMEMIRS
ADDB_STAAW      RIIVDIRDKQLRYQDIAILYRD-ESYAYLFDSILPLYNIPYNIDTKRSMTHHPVMEMIRS
ADDB_STAAS      RIIVDIRDKQLRYQDIAILYRD-ESYAYLFDSILPLYNIPYNIDTKRSMTHHPVMEMIRS
ADDB_STAA1      RIIVDIRDKQLRYQDIAILYRD-ESYAYLFDSILPLYNIPYNIDTKRSMTHHPVMEMIRS
ADDB_STAA2      RIIVDIRDKQLRYQDIAILYRD-ESYAYLFDSILPLYNIPYNIDTKRSMTHHPVMEMIRS
ADDB_STAA9      RIIVDIRDKQLRYQDIAILYRD-ESYAYLFDSILPLYNIPYNIDTKRSMTHHPVMEMIRS
ADDB_STAAM      RIIVDIRDKQLRYQDIAILYRD-ESYAYLFDSILPLYNIPYNIDTKRSMTHHPVMEMIRS
ADDB_STAAN      RIIVDIRDKQLRYQDIAILYRD-ESYAYLFDSILPLYNIPYNIDTKRSMTHHPVMEMIRS
ADDB_STAA3      RIIVDIRDKQLRYQDIAILYRD-ESYAYLFDSILPLYNIPYNIDTKRSMTHHPVMEMIRS
ADDB_STAA8      RIIVDIRDKQLRYQDIAILYRD-ESYAYLFDSILPLYNIPYNIDTKRSMTHHPVMEMIRS
ADDB_STAAT      RIIVDIRDKQLRYQDIAILYRD-ESYAYLFDSILPLYNIPYNIDTKRSMTHHPVMEMIRS
ADDB_STAAC      RIIVDIRDKQLRYQDIAILYRD-ESYAYLFDSILPLYNIPYNIDTKRSMTHHPVMEMIRS
ADDB_STAAE      RIIVDIRDKQLRYQDIAILYRD-ESYAYLFDSILPLYNIPYNIDTKRSMTHHPVMEMIRS
ADDB_STAHJ      QIIKDTRDKQYRYQDIAILYRD-EAYAYLFDSVLPQYDIPFNIDTKRSMTHHPIMEMVRS
ADDB_STAS1      RILRENREQGRRFQDIAILYRD-ESYAYLMESILPQYDIPYNIDVKSSMTHHPIMEMIRS
ADDB_STACT      DIIRKAREENIRFQDVAVLYRD-ETYAHLMESVFPEFDIPFNIDTKKSMTHHPVMEMIRS
ADDB_EXIS2      KAIQLVRHDGYRFKDIAFLVRHLEPYADHLERAFQLYDIPYFLDQRESMVHHPIVELVHA
ADDB_LISMH      EIRQLVLN-GYRYRDIAILTRNLGDYDVLCETVMEAYNIPTFIDKKRAMAKHPFIEFIRS
ADDB_LISMO      EIRQQALN-GYRYRDIAILTRNLGDYDVLCETVMEAYNIPTFIDKKRAMAKHPFIEFIRS
ADDB_LISMF      EIRQLTLN-GYRYQDMAILTRNLGDYDVLCETVMESYNIPIFIDKKRAMSKHPFIEFIRS
ADDB_LISIN      EIRQLALN-GYRYRDIAILTRNIGDYDILCETVMESFDIPIFIDKKRAMAKHPFIEFIRS
ADDB_LISW6      EIRQLTLK-GYRYQDMAILTRNISDYDVLCETVMESFDIPIFIDKKRAMAKHPFIEFIRS
ADDB_LYSSC      EITKLTREYGYRYQDIVLLYRQAELYDPLITSIFQQYEIPIFTNTKKTMLHHPLIELSRS
ADDB_BACHK      EIRRLVAEENYRYRDVAVLLRNGESYYDVMRTLFTDYNIPHFIDEKRPMSHHPLVECIRS
ADDB_BACCZ      EIRRLVADEDYRYRDIAVLLRNGESYYDVMRTLFTDYNIPHFIDEKRPMSHHPLVECIRS
ADDB_BACAN      EIRRLVAEENYRYRDIAVLLRNGESYYDVMRTLFTDYNIPHFIDEKRPMSHHPLVECIRS
ADDB_BACC0      EIRRLVAEENYRYRDIAVLLRNGESYYDVMRTLFTDYNIPHFIDEKRPMSHHPLVECIRS
ADDB_BACC7      EIRRLVADENYRYRDIAVLLRNGESYYDVMRTLFTDYNIPHFIDEKRPMSHHPLVECIRS
ADDB_BACCQ      EIRRLVADENYRYRDIAVLLRNGESYYDVMRTLFTDYNIPHFIDEKRPMSHHPLVECIRS
ADDB_BACC1      EIRRLVADEDYRYRDIAVLLRNGESYYDVMRTLFTDYNIPHFIDEKRPMSHHPLVECIRS
ADDB_BACAH      EIRRLVAEENYRYRDIAVLLRNGESYYDVMRTLFTDYNIPHFIDEKRPMSHHPLVECIRS
ADDB_BACC4      EIRKLVADEKYRYRDIAVLLRNGESYYDVMRTLFTDYNIPHFIDEKRPMSHHPLVECIRS
ADDB_BACCR      EIRKLVADEKYRYRDIAVLLRNGESYYDVMRTLFTDYNIPHFIDEKRPMSHHPLVECIRS
ADDB_BACC2      EIRKLVANEKYRYRDIAVLLRNGESYYDVMRTLFTDYNIPHFIDEKRPMSHHPLVECIRS
ADDB_BACMK      EIRRLVATEDYRYRDIAVLLRNGESYYDVMRTLFTDYNIPHFIDEKRPMSHHPLVECIRS
ADDB_BACCN      EIRRLVAEENYRYRDIAVLLRNGESYYDVLRTLFADYDIPHFIDEKRSMSHHPLVECIRS
ADDB_BACSU      EIHALVREKGYRYKDVAILARQPEDYKDMVKEVFADYEIPYFIDGKASMLNHPLIEFIRS
ADDB_BACVZ      EIQSLVRDGGYRYKDMAILIRQPEDYKDLLKEVFADYGLPYFIDGKASMQHHPLIEFIRS
ADDB_BACLD      EIHSLIRQGRFRLRDIAVIARNVEDYKDTIKEVFKDCELPFFIDGKESMQNHPLIELIRS
ADDB_BACP2      DILDLVREKGLRLRDISVVARHVDDYKDTLKEVFRDYDIPFFIDGNESMQYHPLIELIRS
ADDB_GEOKA      EIIRLVRDEGARYRDIALIIRQTEAYRDLVKTVFFDFGIPYFMDEKEPMHHHPLIELVRA
ADDB_GEOTN      EIIRLVRDEGARYRDIALIIRQTEAYRDLVKTVFFDFDIPYFMDEKEPMHYHPLIELVRA
ADDB_ANOFW      EIIRLVRDEGYRYRDIALLIRNVGDYRNVLKTVFADYRIPYFIDEKEPMLDHPFIEWLRA
ADDB_OCEIH      QVLELIRDNRYRYRDIALLIRQPEVYHDLIETIFNDYELPVFIDEKRPMLHHPLIELIRS
ADDB_DESHY      ELRRLAREEGRTWRDCSVVTRDLPGYQGIIEQVFNAHEIPYFLDHKRPVIHHPLLELLLS
ADDB_DESHD      ELRRLAREEGRTWRDCSVVTRDLPGYQGIIEQVFNAHEIPYFLDHKRPVIHHPLLELLLS
ADDB_SYMTH      EILRLVREEGLRFREIAVVARDLEGYGDLAATLFAEHGIPAFIDRRRTVAHHPLVELLRA
ADDB_MOOTA      EILRLAREENLSWRQMAVLVRDLEPYHDLIVNTFRDFNIPLFIDRRRPVGHHPLVELVRA
ADDB_DESAP      EILRLSRERGWRWRDVSLVVRNLADYHELVATVFADYGIPCFIDRKRPVRHHPLVELIRS
ADDB_DESRM      EIIRLCREEELSWRDIVVVLRDLTNYSDLINTIFNDHGIPVFIDEKRNVLHHPLVELIRS
ADDB_PELTS      EITALCRDRGYRYRDIVILLRDVDSYAGLISSIFADHGIPVFIDQKRPVMHHPMVELVRS
ADDB_HELMI      EIIRLCRDQGYRWRDVAVLLRDLESYYDSIESVFSDFGIPLFIDSKRPAPHHPLVELIRS
ADDB_NATTJ      EIKLLVRDHGMRYKDIAVIVRELESYEPVIKAVFNDYKIPHFLDRKEPVHHHPLVEFLRS
ADDB_ALKMQ      QIIHLVRNRGYRWNDIALVSGGLDQYSMILKRVFEEYHIPYFIDEKRSIMNNPMIELILS
ADDB_ALKOO      QIIHLVRDKGYRWKDIALVSAGLEEYSMILKRVFEEYSIPYFMDEKRSIMNNPIVELILS
ADDB_CLOPE      DILRLVREKQYRFKDISVICRDVDNYEKVVSAIFSEYEIPYYIDKKIDIASNPLIVFINS
ADDB_CLOP1      DILRLVREKQYRFKDISVICRDVDNYEKVVSAIFAEYEIPYYIDKKIDIASNPLIVFINS
ADDB_CLOPS      DILRLVREKQYRFKDISVICREVDNYEKVISAIFAEYEIPYYIDKKIDIASNPLIVFINS
ADDB_CLOBB      DIIRLVRDRNYRFRDISVVCRNIEDYNKIISVIFNDYEIPFFMDKKIKLLNNPLIILITS
ADDB_CLOBA      DIIRLVRDRNYRFRDISVVCRNIENYNKIISVIFNDYEIPFFMDQKIKLLNNPLIVLITS
ADDB_CLOB8      SITSLVRENGYRYRDISVVCRNIDDYEKIISVIFKDYNIPYFLDKKIQLLSNPLIVLISS
ADDB_THEP3      EIIRLVRDENLRYSDIVVTARDLKRYHKLIKTIFSHYGIPHFIDLKLDIKNNPIIVYITS
ADDB_THEPX      EIIRLVRDENLRYSDIVVTARDLKRYHKLIKTIFSHYGIPHFIDLKLDIKNNPIIVYITS
ADDB_CALS4      DIARLIRDEHMRYSDIVVATKDLKRYYKLVKAIFSHYGIPHFIDLKINITNNPIIVYVIS
ADDB_CLOD6      EIVHLVRDKNVRYRDITIATRDLNRYDFLVHSIFNEYNIPNFIDKKREAKSNPIVILIIS
ADDB_HUNT2      DIVRLCRDRGMRYREIAVVTGNLDGYEKLIEAVFSEYGIPCFIDRKVDIVNHPLVRLIMS
ADDB_RUMCH      DIIKQCRDNGMQFKDITVATRNLTGYENLIGVIFEQYNIPCFIDSKTEITNHPLVRMVLS
ADDB_CLOBK      DIIKLCIDKGCRFKDIAVITGDLEGYENIISSVFLQYNIPFFIDKKREINNNPIIVLILS
ADDB_CLOBL      DIIKLCIDKGCRFKDIAVITGDLEGYENIISSVFLQYNIPFFIDKKREINNNPIIVLILS
ADDB_CLOBH      DIIKLCIDKGCRFKDIAVITGDLEGYENIISSVFLQYNIPFFIDKKREINNNPIIVLILS
ADDB_CLOB1      DIIKLCIDKGCRFKDIAVITGDLEGYENIISSVFLQYNIPFFIDKKREINNNPIIVLILS
ADDB_CLOBM      DIIKLCRDKGCRFKDIAVITGDLEGYENIISSVFLQYNIPFFIDKKREINNNPIIVLILS
ADDB_CLOK1      DIVKACRDKNLRFKDMAVVTGDLDEYENLIKAVFNQYDIPYFIDKKREIIHNQIVILIIS
ADDB_CLOTE      DIIKLVRDNGFRYKDIAVITGDLEGYQSLIKAVFTEYGIPYFIDKKVEGDNNPLVIFILS
ADDB_CLONN      EIAKISMESNIRYRDIAVITRDLEGYEKIVKTIFDEYEIPYFIDKKKEIDDNPLIVLITS
ADDB_CLOAB      NIIEFVREDNVRFSDIAVVTGDLGSYEKTVSVIFKEYRIPFFIDRNKDIEDNTLIILIKS
ADDB_LACP7      EITRLLREEEYRYKDIAIVSGAMEVYGDIVKRELELAGIPCFVDHKKNILTNPVVEFLRS
                              :  .       *       :    :*   : .     : .:    :

ADDB_STAEQ      LLEVIRSNWHINAMLRLFKTNVLTSQFKRS---SYLIDLLENFVLERGIYG-KRWLDEDI
ADDB_STAES      LLEVIRSNWHINAMLRLFKTNVLTSQFKRS---SYLIDLLENFVLERGIYG-KRWLDEDI
ADDB_STAAB      LIEVIQSNWQVNPMLRLLKTDVLTASYLKS---AYLVDLLENFVLERGIYG-KRWLDDEL
ADDB_STAAR      LIEVIQSNWQINPMLRLLKTDVLTTSYLKS---AYLVDLLENFVLERGIYG-KRWLDDEL
ADDB_STAAW      LIEVIQSNWQVNPMLRLLKTDVLTASYLKS---AYLVDLLENFVLERGIYG-KRWLDDEL
ADDB_STAAS      LIEVIQSNWQVNPMLRLLKTDVLTASYLKS---AYLVDLLENFVLERGIYG-KRWLDDEL
ADDB_STAA1      LIEVIQSNWQVNPMLRLLKTDVLTASYLKS---AYLVDLLENFVLERGIYG-KRWLDDEL
ADDB_STAA2      LIEVIQSNWQVNPMLRLLKTDVLTASYLKS---AYLVDLLENFVLERGIYG-KRWLDDEL
ADDB_STAA9      LIEVIQSNWQVNPMLRLLKTDVLTASYLKS---AYLVDLLENFVLERGIYG-KRWLDDEL
ADDB_STAAM      LIEVIQSNWQVNPMLRLLKTDVLTASYLKS---AYLVDLLENFVLERGIYG-KRWLDDEL
ADDB_STAAN      LIEVIQSNWQVNPMLRLLKTDVLTASYLKS---AYLVDLLENFVLERGIYG-KRWLDDEL
ADDB_STAA3      LIEVIQSNWQVNPMLRLLKTDVLTASYLKS---AYLVDLLENFVLERGIYG-KRWLDDEL
ADDB_STAA8      LIEVIQSNWQVNPMLRLLKTDVLTASYLKS---AYLVDLLENFVLERGIYG-KRWLDDEL
ADDB_STAAT      LIEVIQSNWQVNPMLRLLKTDVLTASYLKS---AYLVDLLENFVLERGIYG-KRWLDDEL
ADDB_STAAC      LIEVIQSNWQVNPMLRLLKTDVLTASYLKS---AYLVDLLENFVLERGIYG-KRWLDDEL
ADDB_STAAE      LIEVIQSNWQVNPMLRLLKTDVLTASYLKS---AYLVDLLENFVLERGIYG-KRWLDDEL
ADDB_STAHJ      LLEVIQTNWNISPMMRLIKTNILTNHFKDS---AYLIDLLENFVVERGVYG-KRWLDEKL
ADDB_STAS1      LIEVIQTGWQFDPLMRLFKTNILTKKFKDS---QYLIDILENFVLERGIYG-KRWIDDKY
ADDB_STACT      LLEVIESKWSFEPLMRLFKTQVLTKKFKDN---RYLTDILENYVLERGIYG-QRWLDDKY
ADDB_EXIS2      VLEIVMTGYREESVFRLLKTELIPLPAEDP---RLALDRLETFVLERGIKG-SMWKKPWQ
ADDB_LISMH      SLDAILFNWKYEPIFQAVKTEFFFDITEKSSLNRRKADILENYVLENGIQNKWKWEKEGD
ADDB_LISMO      SLDAILFNWKYEPIFQAVKTEFFFDITEKSSLNRRKADILENYVLENGIQNKWKWEKEGD
ADDB_LISMF      SLDAILFNWKYEPIFQAVKTEFFFGVAEKSSVLRRKADILENYVLENGIQNKWKWEKEGD
ADDB_LISIN      SIDAILFNWKYEPIFQAVKTEFFFDVAENATIMRRKADILENYVLENGIQNKWKWEKEGD
ADDB_LISW6      SIDAILFNWKYEPIFQAVKTEFFFDVSENTSIMRRKADILENYVLENGIQNKWKWEKEGD
ADDB_LYSSC      ALEIMTSNWKYEPVFRSVKTDLFFPLQAELTIWRERADRLENYCLAQGIYGERWFE-EPR
ADDB_BACHK      ALEIISGNWRYDAVFRCVKTELLYPLDVRKETMREEMDEFENYCLAYGVQG-KRWTSEDP
ADDB_BACCZ      ALEIISGNWRYDAVFRCVKTELLYPLDVRKETMREEMDEFENYCLAYGVQG-KRWTSEDP
ADDB_BACAN      ALEIISGNWRYDAVFRCVKTELLYPLDVRKETMREEMDEFENYCLAYGVQG-KRWTSEDP
ADDB_BACC0      ALEIISGNWRYDAVFRCVKTELLYPLDVRKETMREEMDEFENYCLAYGVQG-KRWTSEDP
ADDB_BACC7      ALEIISGNWRYDAVFRCVKTELLYPLDVRKETMREEMDEFENYCLAYGVQG-KRWTSEDP
ADDB_BACCQ      ALEIISGNWRYDAVFRCVKTELLYPLDVRKETMREEMDEFENYCLAYGVQG-KRWTSEDP
ADDB_BACC1      ALEIISGNWRYDAVFRCVKTELLYPLDVRKETMREEMDEFENYCLAYGVQG-KRWTSEDP
ADDB_BACAH      ALEIISGNWRYDAVFRCVKTELLYPLDVRKETMREEMDEFENYCLAYGVQG-KRWTSEDP
ADDB_BACC4      ALEIISGNWRYDAVFRCVKTELLYPLDVRKETMREEMDEFENYCLAYGVQG-KRWTSEDP
ADDB_BACCR      ALEIISGNWRYDAVFRCVKTELLYPLDVRKEAMREEMDEFENYCLAYGVQG-KRWTAEDP
ADDB_BACC2      ALEIISGNWRYDAVFRCVKTELLYPLDVRKETMREEMDKFENYCLAYGVQG-KRWTSEDP
ADDB_BACMK      ALEIISGNWRYDAVFRCVKTELLYPLDVRKEAMREEMDEFENYCLAYGVQG-KRWTSEDP
ADDB_BACCN      ALEIISGNWRYDAVFRCVKTELLYPLDVKKEVMREEMDEFENYCLAYGVQG-KKWTADEP
ADDB_BACSU      SLDVLKGNWRYEAVFRCVKTELLFPLNEPKAKVREQVDQLENYCIAYGIKG-DRWTKGDR
ADDB_BACVZ      SLDVVKGNWRYEAVFRCAKTELLFPLDQPEQKIREQVDQLENYCIAYGIKG-ERWTSGER
ADDB_BACLD      TLDIIKGNWRYEAVFRCVKTELLFPEGQPKERLREQIDQLENYCIAYGIKG-DRWTSKDP
ADDB_BACP2      SLDVIKGNWRYEAVFRCVKTEFLFPLEITKNKAREQADQLENYCIAYGVKG-ERWTNGSR
ADDB_GEOKA      ALETVVTRWRYEAVFRAVKTDLLFPTDGDLHMWREAADKLENYVLAYGIKG-DKWTNNER
ADDB_GEOTN      ALETVVTRWRYEAVFRAVKTDLLFPVDGDLAMWREAADKLENYVLAHGVKG-EKWTSDER
ADDB_ANOFW      SMEAVRTNFRYEAVFRAVKTDFFFHLDQPVHDMRMAMDQLENYVLAFGIQG-DKWT--EH
ADDB_OCEIH      ILEVVQGNWRNDAIFRVLKTGLIPSADDEFPLTMDSIDQLENYVIEFGIRSRHQWIGENK
ADDB_DESHY      AIETVQKDWAYEPLFRCLKTDFFPCS-------KDRIDRLENYCLAYGIHG-SAWKGNRS
ADDB_DESHD      AIETVQKDWAYEPLFRCLKTDFFPCS-------KDRIDRLENYCLAYGIHG-SAWKGNRS
ADDB_SYMTH      ALEVVVQDWAYGPVFRYLKTDLTGVS-------RAEIDLLENYVIEHGIRG-RAWQQQEP
ADDB_MOOTA      ALEAVLEDWAYDPVFRYLKSDLVPVP-------REEIDLLENYVLAHGIRG-RRWRDSRP
ADDB_DESAP      ALETVTENWTYDPVFRYLKTDLVPVS-------RGDVDLLENYVLAHGIKG-AKWADPED
ADDB_DESRM      ALEVITQHWAYDPVFRYLKTDLIPVQ-------RDDVDRLENYVLAHGIRG-NRWNDNRD
ADDB_PELTS      ALEAVTEDWAFDPVFRYLKTDLVPLS-------REEVDLLENYVLAHGIRG-SRWTDGRP
ADDB_HELMI      ALEAVLRDWAYEPVFRYLKTDLVPLS-------RGETDRLENYVLAHGIRG-RRWRDREP
ADDB_NATTJ      SVETVISNWDYEPLFRMLKTGLLPIS-------SEEIFQVENYVLAHGISG-KDWKKQGK
ADDB_ALKMQ      SIEILSRGYQYEDVFSFLKTGFSDL-------TKDEVEQLENYVLQYGIRGKAYSEPFTK
ADDB_ALKOO      SIGILARGYQYEDVFRFLKTGFGDL-------NKDEVEELENYVLQYGIKGKDYAVPFTK
ADDB_CLOPE      AVDIISKNWTYESMFKYLKTGLIKEFRGIE--GAELIDELENYVLAYGIKGKKW----ME
ADDB_CLOP1      AVDIISKNWTYESMFKYLKTGLIKEFRGIE--GAELIDELENYVLAYGIKGKKW----ME
ADDB_CLOPS      AVDIISKNWTYESMFKYLKTGLIKEFRGIE--GAELIDELENYVLAYGIKGKKW----ME
ADDB_CLOBB      AFEVLLKNWSYESVFKYLKSGLTGF-------NTYDIDRLENFVLEHGIKSYKW----NE
ADDB_CLOBA      AFEVVLKNWSYESVFKYLKSGLTGF-------NIYDIDRLENFVLEHGIKSYKW----NE
ADDB_CLOB8      AFEILLKNWSYESVFKYLKSGLTGI-------DNSYIDRLENFILEYGVKGYKW----TS
ADDB_THEP3      LFEIYLKNWSYESVFRHLKTGFTNL-------NKEDISFLENYVLANGIKGGKW----KE
ADDB_THEPX      LFEIYLKNWSYESVFRHLKTGFTNL-------NKEDISFLENYVLANGIKGGKW----KE
ADDB_CALS4      IFEIYLKNWSYESVFRYLKTGFTGI-------DKEEINLLENYVLANGIKGNKW----KE
ADDB_CLOD6      ALEMKNRRYGYETMFRYLKSGLIGI-------DNDDINLLENYVLANGIKGKKWF---DE
ADDB_HUNT2      MLDIFIENWSYEAVFRYLKTGLTGI-------DRESIDRLENYVLACGIRGSCWTE--TE
ADDB_RUMCH      MLEIFTENWSYESVFRYLKSGLTGI-------DNTKIDILENYVLACGIRGSRWTQ--EA
ADDB_CLOBK      ALEVLSKNWTYESVFRYLKTGLLDI-------NNEEMDILENYVLANGIKGYQWTN--DK
ADDB_CLOBL      ALEVLSKNWTYESVFRYLKTGLLDI-------NNEEMDILENYVLANGIKGYQWTN--DK
ADDB_CLOBH      ALEVLSKNWTYESVFRYLKTGLLDI-------NNEEMDILENYVLANGIKGYQWTN--DK
ADDB_CLOB1      ALEVLSKNWTYESVFRYLKTGLLDI-------NNEEMDILENYVLANGIKGYQWTN--DK
ADDB_CLOBM      ALEVLSKNWTYESVFRYLKTGLLDI-------NNEEMDILENYVLANGIKGYQWTN--DK
ADDB_CLOK1      AVEILAKNWSYESVFRYLKTGLLDL-------EFDDIDILENYVLANGIRGRQWLD--TK
ADDB_CLOTE      SLEVLNKNWNYESVFRYLKAGLVDI-------KREEIDIIENYVLANGIRGKRWIE--EK
ADDB_CLONN      VIEIFNKSWSYEAMFRYLKTGLSNV-------SKEEVDLLENYVLAYGIRGKKKW---QS
ADDB_CLOAB      IIDIFVKNWSYETVFRYLKTGFADI-------EPDEIDILENYVLAAGIKGKKKWT--EE
ADDB_LACP7      ALDVVTHNFDYEAIFRFLKCGLTDFT-------MDEIDLFENYVIAFGIRGKYRYEHEWE
                 .      :    ::   *  .                 .*.: :  *: .         

ADDB_STAEQ      FSIDQFSRMGRKSHQLTEGHQA------LYKEVIKLKKNVINKVLYFEQAMNEAH-----
ADDB_STAES      FSIDQFSRMGRKSHQLTEGHQA------LYKEVIKLKKNVINKVLYFEQAMNEAH-----
ADDB_STAAB      FNVEHFSKMGRKAHKLTEDERN------TFEQVVKLKKDVIDKILHFEKQMSQAA-----
ADDB_STAAR      FNVEHFSKMGRKAHKLTEDERN------TFEQVVKLKKDVIDKILHFEKQMSQAA-----
ADDB_STAAW      FNVEHFSKMGRKAHKLTEDERN------TFEQVVKLKKDVIDKILHFEKQMSQAE-----
ADDB_STAAS      FNVEHFSKMGRKAHKLTEDERN------TFEQVVKLKKDVIDKILHFEKQMSQAE-----
ADDB_STAA1      FNVEHFSKMGRKAHKLTEDERN------TFEQVVKLKKDVIDKILHFEKQMSQAE-----
ADDB_STAA2      FNVEHFSKMGRKAHKLTEDERN------TFEQVVKLKKDVIDKILHFEKQMSQAE-----
ADDB_STAA9      FNVEHFSKMGRKAHKLTEDERN------TFEQVVKLKKDVIDKILHFEKQMSQAE-----
ADDB_STAAM      FNVEHFSKMGRKAHKLTEDERN------TFEQVVKLKKDVIDKILHFEKQMSQAE-----
ADDB_STAAN      FNVEHFSKMGRKAHKLTEDERN------TFEQVVKLKKDVIDKILHFEKQMSQAE-----
ADDB_STAA3      FNVEHFSKMGRKAHKLTEDERN------TFEQVVKLKKDVIDKILHFEKQMSQAE-----
ADDB_STAA8      FNVEHFSKMGRKAHKLTEDERN------TFEQVVKLKKDVIDKILHFEKQMSQAE-----
ADDB_STAAT      FNVEHFSKMGRKAHKLTEDERN------TFEQVVKLKKDVIDKILHFEKQMSQAE-----
ADDB_STAAC      FNVEHFSKMGRKGHKLTEDERN------TFEQVVKLKKDVIDKILHFEKQMSQAE-----
ADDB_STAAE      FNVEHFSKMGRKGHKLTEDERN------TFEQVVKLKKDVIDKILHFEKQMSQAE-----
ADDB_STAHJ      FSIDNFTKMGRKEHKLTTEERE------DFEQVVHLKNDIIDKILTFEKAMNEAE-----
ADDB_STAS1      FDIEQFRKMGLKRQPLTDEERE------TFERVIQLKNDVMKKVMLFEEKINNAS-----
ADDB_STACT      FKIEQFNLMGLKRQPMTEETEA------DYQRVIDLKNYVIDKILRFEKALAEAD-----
ADDB_EXIS2      LKRRLADEISLTDAELQEEL-----------ELNEWRQFLVEAIEPLEKRFKASK-----
ADDB_LISMH      WVYRKIRGLSTNVLPQTDEEIH------MQSIINEMRSLIVNPLATLELNLRKAK-----
ADDB_LISMO      WIYRKIRGLSTNVLPQTDEEIH------MQSIINEMRNLIVNPLSTLELNLRKAK-----
ADDB_LISMF      WIYRKIRGLSTNVLPQTDGEIQ------TQSIINEMRSLIVNPLSTLELNLKKAK-----
ADDB_LISIN      WIYRKIRGLSTNVLPQTDEELA------TQSVINEMRNLIVEPLSTLENNITKAK-----
ADDB_LISW6      WIYRKIRGLSTNLLPQTDEELE------TQAIINEMRNLIVEPLSILENNLAKAR-----
ADDB_LYSSC      WFYKKYRGLEFHSRVQTDEERA------MQAEIEAIRDEIRQPLKSLQDKLSIAS-----
ADDB_BACHK      WMYRRYRSLDDTNGMITDSERE------MEEKINRLRDVVRTPVIRMQKRLKRAG-----
ADDB_BACCZ      WMYRRYRSLDDTNGMITDSERE------MEEKINRLRDVVRTPVIRMQKRLKRAG-----
ADDB_BACAN      WMYRRYRSLDDTNGMITDSERE------MEEKINRLRDVVRTPVIRMQKRLKRAG-----
ADDB_BACC0      WMYRRYRSLDDTNGMITDSERE------MEEKINRLRDVVRTPVIRMQKRLKRAG-----
ADDB_BACC7      WMYRRYRSLDDTDGMITDSERE------MEEKINRLRGVVRTPVIRMQKRLKRAG-----
ADDB_BACCQ      WMYRRYRSLDDTDGMITDSERE------MEEKINRLRGVVRTPVIRMQKRLKRAG-----
ADDB_BACC1      WMYRRYRSLDDTNGMITDSERE------MEEKINRLRDVVRTPVIRMQKRLKRAG-----
ADDB_BACAH      WMYRRYRSLDDTNGMITDSERE------MEEKINRLRDVVRTPVIRMQKRLKRAG-----
ADDB_BACC4      WMYRRYRSLDDTNGMITDSERE------MEEKINRLRDVVRTPVIRMQKRLKRAG-----
ADDB_BACCR      WMYRRYRSLDDTNGMITDSERE------MEEKINRLRDVVRTPVIRMQKRLKRAG-----
ADDB_BACC2      WMYRRYRSLDDTNGMITDSERE------MEEKINRLRDVVRTPVIRMQKRLKRAG-----
ADDB_BACMK      WMYRRYRSLDDASEMITDSERE------MEEKINRLRDVVRTPVIRMQKRLKRAG-----
ADDB_BACCN      WTYRRYRSLDEGNEVITDRERQ------MEEKMNRLREIVRTPIIRLQKRLKRAS-----
ADDB_BACSU      FQYRRFVSLDD-DFAQTDQEIE------MENMLNDTRDWIVPPLFQLQKRMKKAK-----
ADDB_BACVZ      FVYRRFVSLDE-DFAQTDQEIE------MEHMLNETKEWMAAPLVKLQNRMKKAK-----
ADDB_BACLD      FVYRRYASLDE-DFAKTDKEIE------TENMLNELKGWIVPPIHRLQKRLKKAE-----
ADDB_BACP2      FHYRRFQSLDE-DFRQTDQEIE------MEQMLNDVKEWITPPLYQLQKRLKNAQ-----
ADDB_GEOKA      WAYRRYQALDGLNVPQTDEERQ------FEDMLNEWREALAAPLRRLERRLRRAE-----
ADDB_GEOTN      WTYRRYQALDGLNVPQTDEERQ------FEDKLNEWREALAAPLRRLERRLRRAA-----
ADDB_ANOFW      WTYRKYKGLEGVHAPQTDEEKR------YEQQLNEWRKLVISPLLVLQKRLKQAK-----
ADDB_OCEIH      WKYQRFRGFDS--SAQTDRERE------LQESMNRYRDQVISAIATVDEQLRAAT-----
ADDB_DESHY      WSYYPDPNHKEET--------------AGLNETRQIIYDLFSPFDQAIRPHPEAGGPS--
ADDB_DESHD      WSYYPDPNHKEET--------------AGLNETRQIIYDLFSPFDQAIRPHPEAGGPS--
ADDB_SYMTH      WQYLRRYTLEEDAVPAGPAQQA------LLDEIHRIRRRATAPLLAFQRRLQRRGRPG--
ADDB_MOOTA      WQYGNSRDLETPS----PPGSA------AGETINAIRERASCHLRRFDGALRGRQ-----
ADDB_DESAP      WHYRRSDALNRPVPNGTGAPAPSDRDRYLREKVNRIRRRAARHLLDFQRRVQAAG-----
ADDB_DESRM      WTYRRQYTLGEDC--DIDDNEA-----EQLAQLNVVRYAAIEHINNFSKKVANCG-----
ADDB_PELTS      WEYRRELTLEEDP--GLNGSES-----VELEKVNRIRHQATADLLEFCRSFMQAK-----
ADDB_HELMI      WLFRRRLTLGEDALSEFSDQEL-----AELAEINGARDRARAALASFHKAVVGAK-----
ADDB_NATTJ      WNFIANFDLERENIAPSNRNKQ------YLSEINSIKGKVRDTLLEFDSKLRGINKSESL
ADDB_ALKMQ      GFEKKQIQQKDKEEGEKQIDEE------KKEKYNELRMRFIAPFAKFEKRIYRKK-----
ADDB_ALKOO      GFTNKKHEEIEQEESD-EIHEE------KI-KYNEFRERFIAPFLKFEKKIYRKK-----
ADDB_CLOPE      EWVNYSSSILKEEEI-SEENKQ------RLERLNDIRETIVTPLDEFNKQCKGKK-----
ADDB_CLOP1      EWVNYSSSILKEEEI-SEEDKQ------RLERLNDIRENIVTPLDEFNKQCKGKK-----
ADDB_CLOPS      EWVNYSSSILKEEEI-SEENKQ------RLERLNDIRETIVTPLDEFNKECKGKK-----
ADDB_CLOBB      EEIKKLKNISIENGA-TEEELT------IFNVMEEVRNSLIS----FHKLIEGKH-----
ADDB_CLOBA      EEIEKLKNIKIENGA-TEDELT------IFNLMEEVRNSLIS----FHKLIEGKH-----
ADDB_CLOB8      KEIVNEKWFRGNGEL-TDDKVL------IAEIMEEIRYPLMT----FHNKVNGKH-----
ADDB_THEP3      EWKYSFRNRLDKLFD-DQDEKE------ALEKVNTIKNGISEPLNKFYKDFSNAN-----
ADDB_THEPX      EWKYSFRNRLDKLFD-DQDEKE------ALEKVNTIKNGISEPLNKFYKDFSNAN-----
ADDB_CALS4      RWEYRIDYKTDSLLM-EEREKQ------IINKVNEVRERVYLPLEKFYTRFSHSK-----
ADDB_CLOD6      KWDYRITQSLSGQE--SEFELE------LKEKINEIKNRVLEPIVILQEKLRGKN-----
ADDB_HUNT2      EWKMVPELIPNEKSL--EEAKE------LLEDVNRIRAQVVAPLMEFRKKTKGRK-----
ADDB_RUMCH      DWNTSIEFRPDDGQK--PENDE------MLLNINKTRNEIREPLIRFRNRTKGRR-----
ADDB_CLOBK      PWEHK-SFSNYELED--QALKE------LLAKINDIRYKAMEPIVTLNKNFKSID-----
ADDB_CLOBL      PWEHK-SFSNYELED--QALKE------LLAKINDIRYKAMEPIVTLNKNFKSID-----
ADDB_CLOBH      PWEHK-FFSNYELED--QVEKE------LLAKINDIRYKAMEPIVTLNKNFKSID-----
ADDB_CLOB1      LWEYK-SFSNYELED--QVEKE------LLAKINDIRYKAMEPIVTLNKNFKSID-----
ADDB_CLOBM      PWEHK-SFSNYELED--QVEKE------LLAKINDIRYKAMEPIISLNKNLKNKE-----
ADDB_CLOK1      PWSFKINYGNFKEDDS-EEEQE------YLNKINCIRDKVREPILKLSNDIKGKK-----
ADDB_CLOTE      DWDYKILYGFNLTEEKEEEEEE------KLKKINEIRRKITEPLIEFHNNIKGEI-----
ADDB_CLONN      PWEYG--------------NEN------ILEKINEIRIKVSEPLIKFSSKLKGKS-----
ADDB_CLOAB      EWTYNVYGDALEGDIS-EESKE------KLSKVNEIKNRFLRPILNFRERVLRRN-----
ADDB_LACP7      RKYKTNYEVD-------------------LEKINYVRECILKEFTPLYETLTSKK-----
                                                                            

ADDB_STAEQ      ---------------TVKDYATSFYESLEY-FELPSQLMTQRDELELAGLTE---KAEEI
ADDB_STAES      ---------------TVKDYATSFYESLEY-FELPSQLMTQRDELELAGLTE---KAEEI
ADDB_STAAB      ---------------TVKDFATAFYESMEY-FELPNQLMTERDELDLNGYHE---KAEEI
ADDB_STAAR      ---------------TVKDFATAFYESMEY-FELPNQLMTERDELDLNGNHE---KAEEI
ADDB_STAAW      ---------------TVKDFATAFYESMEY-FELPNQLMTERDELDLNGNHE---KAEEI
ADDB_STAAS      ---------------TVKDFATAFYESMEY-FELPNQLMTERDELDLNGNHE---KAEEI
ADDB_STAA1      ---------------TVKDFATAFYESMEY-FELPNQLMTERDELDLNGNHE---KAEEI
ADDB_STAA2      ---------------TVKDFATAFYESMEY-FELPNQLMTERDELDLNGNHE---KAEEI
ADDB_STAA9      ---------------TVKDFATAFYESMEY-FELPNQLMTERDELDLNGNHE---KAEEI
ADDB_STAAM      ---------------TVKDFATAFYESMEY-FELPNQLMTERDELDLNGNHE---KAEEI
ADDB_STAAN      ---------------TVKDFATAFYESMEY-FELPNQLMTERDELDLNGNHE---KAEEI
ADDB_STAA3      ---------------TVKDFATAFYESMEY-FELPNQLMTERDELDLNGNHE---KAEEI
ADDB_STAA8      ---------------TVKDFATAFYESMEY-FELPNQLMTERDELDLNGNHE---KAEEI
ADDB_STAAT      ---------------TVKDFATAFYESMEY-FELPNQLMTERDELDLNGNHE---KAEEI
ADDB_STAAC      ---------------TVKDFATAFYESMEY-FELPNQLMTERDELDLNGNHE---KAEEI
ADDB_STAAE      ---------------TVKDFATAFYESMEY-FELPNQLMTERDELDLNGNHE---KAEEI
ADDB_STAHJ      ---------------NVRGFATAFYETMEA-FDLPKYLMTHRDQLDVDGRHE---EAEEI
ADDB_STAS1      ---------------TAIAFATAFYEAMEA-FDLPSQLMTDRDTLDVNGEHK---KAEEI
ADDB_STACT      ---------------TAETYAAAFYEAFEQ-FNLPSQLMTERDELDLAGEHQ---QAEEL
ADDB_EXIS2      ---------------TMSEYTRALYRFLEE-HHMTDRLTVWKQQALEVNELS---QAREH
ADDB_LISMH      ---------------TGMEFALALYHYLEQ-VNAVERLESWRQRAEEQGYLE---LAREH
ADDB_LISMO      ---------------TGMEFALALYHYLEQ-VNAVERLESWRQRAEEQGYLE---LAREH
ADDB_LISMF      ---------------TGMEFALALYHFLEQ-VNAVERLESWRQRAEEQGYLE---LAREH
ADDB_LISIN      ---------------TGIEFAMALYHYLEQ-VKAVEHLESWRQVAEENGYLE---LAREH
ADDB_LISW6      ---------------TGTEFAMALYHFLEQ-VKAVEHLESWRQTAEENGYLE---LAREH
ADDB_LYSSC      ---------------TGKDIATALFELVES-LQVYEKLQAMKDRELERGDAL---AASEH
ADDB_BACHK      ---------------TVMQMCEAVYLFLEE-LDVPKKLEALRIRAEESGDFL---FATDH
ADDB_BACCZ      ---------------TVMQMCEAVYLFLEE-LDVPKKLEALRIRAEESGDFL---FATDH
ADDB_BACAN      ---------------TVMQMCEAVYLFLEE-LDVPKKLEALRIRAEENGDFL---FATDH
ADDB_BACC0      ---------------TVMQMCEAVYLFLEE-LDVPKKLEALRIRAEESGDFL---FATDH
ADDB_BACC7      ---------------TVMQMCEAVYLFLEE-LDVPKKLEALRIRAEESGDFL---FATDH
ADDB_BACCQ      ---------------TVMQMCEAVYLFLEE-LDVPKKLEALRIRAEESGDFL---FATDH
ADDB_BACC1      ---------------TVMQMCEAVYLFLEE-LDVPKKLEALRIRAEESGDFL---FATDH
ADDB_BACAH      ---------------TVMQMCEAVYLFLEE-LDVPKKLEALRIRAEESGDFL---FATDH
ADDB_BACC4      ---------------TVMQMCEAVYLFLEE-LDVPKKLEELRIRAEESGDFL---FATDH
ADDB_BACCR      ---------------TVMQMCEAVYLFLEE-LDVPKKLEELRIRAEESGDFL---FATDH
ADDB_BACC2      ---------------TVMQMCEVVYLFLEE-LDVPKKLEELRIRAEESGDFL---FATDH
ADDB_BACMK      ---------------TVMQMCEAVYLFLEE-LDVPKKLEALRIRAEESGDFL---FATDH
ADDB_BACCN      ---------------TVMQMCEAVYLFLEE-LDVPKKLEQLRVRAEESGDFL---FATDH
ADDB_BACSU      ---------------TVQEKAEALYRYLEE-TDVPLKLDQERQRAEDDGRII---EAQQH
ADDB_BACVZ      ---------------TVQSMAEALYLFLED-TDVPLKLDRKRQRAEEAGNMI---EAQQH
ADDB_BACLD      ---------------TVREMAEAVYLYLEE-ADVPMKLEQERRLAEEGGRIA---ESRQH
ADDB_BACP2      ---------------KVRDMVEAVYVFLEE-IQVPDKLEKARLEAEEAGRLA---EAMQH
ADDB_GEOKA      ---------------DGRGFCMALYLFLEE-LQIPKKLEKMSAQAEADGRLV---EARQH
ADDB_GEOTN      ---------------DGRGLCTALYLFLEE-LQIPKKLEQMSAQAEADGRLV---EARQH
ADDB_ANOFW      ---------------TGREQCEALYAYAEH-LQIPQKLERLRDEAEERGDLS---VARHH
ADDB_OCEIH      ---------------TVKDLCIAMYQWLEE-LKIPDQLEVTRKYYDDQGLPE---KGREQ
ADDB_DESHY      --------------VTVAQITEAIYELLIR-LKVPEHLQEWAEAAHSRGDLA---EAQLQ
ADDB_DESHD      --------------VTVAQITEAIYELLIR-LKVPEHLQEWAEAAHSRGDLA---EAQLQ
ADDB_SYMTH      --------------PTVREITTYLFQLLDD-LKVARQLEAWKAEAEQRGDLE---TAREH
ADDB_MOOTA      --------------LTGREITAALFDLLQE-LGVPERLAAWSRQAAAAGDLD---AAQEH
ADDB_DESAP      ---------------TVRELTAALYDLLSD-LDVPGRIEEWSREAETEGRLE---AAREH
ADDB_DESRM      ---------------NVRQITTALFELLES-LSVAERMEAWAKEAEVAGRLI---EAKEH
ADDB_PELTS      ---------------NVREMSTALFNLLTG-LKVPEQLESWSRQAEKEGRLE---AAREH
ADDB_HELMI      ---------------AVRPITAALYQLLVD-LKAPEQISCWIAEAEAAGRIE---EAHAH
ADDB_NATTJ      SAQFKNQEAEEDNLLSVREISTYLWELIEQ-LQIEYQLEEWSLEAEERKDFV---EMQLH
ADDB_ALKMQ      ---------------KIGEITKALFEFMKE-LNIEDKLNQWIEELREEKYFE---YVNEN
ADDB_ALKOO      ---------------KVGHITKALFEFMKD-LNIEAKLDQWIEELREKKYFE---YVNEN
ADDB_CLOPE      ---------------TLKEFATILYEFLDSKLDIMDTLDKYVDYFKENDMAI---EAKEY
ADDB_CLOP1      ---------------TLKEFATILYEFLDSKLDVMDTIDKYVDYFKENDMAI---EAKEY
ADDB_CLOPS      ---------------TLKEFAIILYEFLDSKLNIMDTIDKYVEYFKENDMAI---EAKEY
ADDB_CLOBB      ---------------NVRDICKALYEFLLS-IKAFERIDEWIIKFEELKLED---KVKEY
ADDB_CLOBA      ---------------YVRDICKALYEFLLS-IKAFERIDEWIIKFEELKLED---KVKEY
ADDB_CLOB8      ---------------KVKDICSAIYEFLVD-VKVFDRINEWIKNFEELGLED---KVKEY
ADDB_THEP3      ---------------TVREACEILYNFLVE-RDIPQRIENLIREFKENKEFE---IANQY
ADDB_THEPX      ---------------TVREACEILYNFLVE-RDIPQRIENLIREFKENKEFE---IANQY
ADDB_CALS4      ---------------NVKEACEVLYDFLVE-NKLPEKIEKFIEEFKNRGEFD---TANQY
ADDB_CLOD6      ---------------RVKEICRYIYEFLLD-INMPETIESLIVNFKDKGELD---VANQY
ADDB_HUNT2      ---------------KASDFCASLYDFLCT-LGIPEKIEDAIEKFRESGNLN---LANEY
ADDB_RUMCH      ---------------TAGDFCAGIYEYLVE-IGVEQRIRNYIEKFTQSGQLR---LAGEY
ADDB_CLOBK      ---------------KAKEFCEVLYEFLCN-INLPDKIQNMIEDFKVEGEIE---KASEY
ADDB_CLOBL      ---------------KAKEFCEVLYEFLCN-INLPDKIQNMIEDFKVEGEIE---KASEY
ADDB_CLOBH      ---------------KAKEFCEVLYEFLCN-INLPDKIQNMIEDFKVEGEIE---KASEY
ADDB_CLOB1      ---------------KAKEFCEVLYEFLCN-INLPDKIQNMIEDFKVEGEIE---KASEY
ADDB_CLOBM      ---------------RAKEFCEVLYEFLCS-INLPDKIQNMIEDFRAEGEVE---KASEY
ADDB_CLOK1      ---------------KGRHICEELYNFLCE-LKIPEKVEELIIEFRNTDRLD---KANEY
ADDB_CLOTE      ---------------TPKKMCLELYNFLEK-MNISSKIESWIKYFKERNRLD---KINEY
ADDB_CLONN      ---------------KADEICSAVYNFLCS-IGVNETIEKWVYKFKNEGNQA---LAKEY
ADDB_CLOAB      ---------------NVAEICRALFEFLYD-INVPEAVEKMVNEFRESGRQI---LANEY
ADDB_LACP7      --------------SSVRECVNALYNLLCT-YHIEEKIHIFVEKFKAQGEKEDKLRAKEY
                                       .:            :                      

ADDB_STAEQ      DQVWNGLIQILDDLVTVFDDQEMTLQQFLDVFDIGLEQLEFVMIPQTLDQVSIGTMDLAK
ADDB_STAES      DQVWNGLIQILDDLVTVFDDQEMTLQQFLDVFDIGLEQLEFVMIPQTLDQVSIGTMDLAK
ADDB_STAAB      DQIWNGLIQILDDLVLVFGDEPMSMERFLEVFDIGLEQLEFVVIPQTLDQVSIGTMDLAK
ADDB_STAAR      DQIWNGLIQILDDLVLVFGDEPMSMERFLEVFDIGLEQLEFVMIPQTLDQVSIGTMDLAK
ADDB_STAAW      DQIWNGLIQILDDLVLVFGDEPMSMERFLEVFDIGLEQLEFVMIPQTLDQVSIGTMDLAK
ADDB_STAAS      DQIWNGLIQILDDLVLVFGDEPMSMERFLEVFDIGLEQLEFVMIPQTLDQVSIGTMDLAK
ADDB_STAA1      DQIWNGLIQILDDLVLVFGDEPMSMERFLEVFDIGLEQLEFVMIPQTLDQVSIGTMDLAK
ADDB_STAA2      DQIWNGLIQILDDLVLVFGDEPMSMERFLEVFDIGLEQLEFVMIPQTLDQVSIGTMDLAK
ADDB_STAA9      DQIWNGLIQILDDLVLVFGDEPMSMERFLEVFDIGLEQLEFVMIPQTLDQVSIGTMDLAK
ADDB_STAAM      DQIWNGLIQILDDLVLVFGDEPMSMERFLEVFDIGLEQLEFVMIPQTLDQVSIGTMDLAK
ADDB_STAAN      DQIWNGLIQILDDLVLVFGDEPMSMERFLEVFDIGLEQLEFVMIPQTLDQVSIGTMDLAK
ADDB_STAA3      DQIWNGLIQILDDLVLVFGDEPMSMERFLEVFDIGLEQLEFVMIPQTLDQVSIGTMDLAK
ADDB_STAA8      DQIWNGLIQILDDLVLVFGDEPMSMERFLEVFDIGLEQLEFVMIPQTLDQVSIGTMDLAK
ADDB_STAAT      DQIWNGLIQILDDLVLVFGDEPMSMERFLEVFDIGLEQLEFVMIPQTLDQVSIGTMDLAK
ADDB_STAAC      DQIWNGLIQILDDLVLVFGDEPMSMERFLEVFDIGLEQLEFVMIPQTLDQVSIGTMDLAK
ADDB_STAAE      DQIWNGLIQILDDLVLVFGDEPMSMERFLEVFDIGLEQLEFVMIPQTLDQVSIGTMDLAK
ADDB_STAHJ      DQIWNGLIQILDDLVTVFDNEEMTLKRFLEVFDIGLEQLEFVMIPQTLDQVSIGTMDLAK
ADDB_STAS1      DQIWNGLIQILDDLVTVFDDQSMSKTRFLELFDIGLEQLEFIMIPQTLDQVSIGTMDLAK
ADDB_STACT      DQVWNGFIQTLDDLATVFGNREMTQKRFLELFDVGLEQLEFVMIPQTLDQVSIGSMDLAK
ADDB_EXIS2      DQVYEAVLLLFEQLEAAAPEATLTTELFVQMVETGLESLRFSLVPPSLDQVIATDYVRGR
ADDB_LISMH      EQAWSSISALLDEFVEVLGEETLDLDSFTEIIGTGLDALEFSLLPPSLDQVVLSDMENAK
ADDB_LISMO      EQAWSSISALLDEFVEVLGEETLDLDSFTEIIGTGLDALEFSLLPPSLDQVVLSDMENAK
ADDB_LISMF      EQAWSAISALLDEFVEVLGKETLDLNSFVEIIATGLDALEFSLLPPSLDQVVLSDMENAK
ADDB_LISIN      EQAWSSISELLDEFVEVLGEEELDVNSFSEIITTGLDALEFSLLPPSLDQVVLADMENAK
ADDB_LISW6      EQAWSSVSELLDEFVEVLGEESLDINSFAEIVATGLDALEFSLLPPSLDQIVLSDMENAK
ADDB_LYSSC      EQAWNEWINVLDQFVYMFGEQEMSVEEAAKILDEGFDTLEFSRIPPTLDEVMVATVDLAR
ADDB_BACHK      EQVWEEVMNLLDTFVEMLGEEKMSLSMFTDVMSTGLEALQFANIPPSLDQVLIANIDRSR
ADDB_BACCZ      EQVWEEVMSLLDTFVEMLGEEKMSLSMFTDVMSTGLEALQFANIPPSLDQVLIANIDRSR
ADDB_BACAN      EQVWEEVMSLLDTFVEMLGEEKMSLSMFTDVMSTGLEALQFANIPPSLDQVLIANIDRSR
ADDB_BACC0      EQVWEEVMSLLDTFVEMLGEEKMSLSMFTDVMSTGLEALQFANIPPSLDQVLIANIDRSR
ADDB_BACC7      EQVWEEVMSLLDTFVEMLGEEKMSLSMFTDVMSTGLEALQFANIPPSLDQVLIANIDRSR
ADDB_BACCQ      EQVWEEVMSLLDTFVEMLGEEKMSLSMFTDVMSTGLEALQFANIPPSLDQVLIANIDRSR
ADDB_BACC1      EQVWEEVMSLLDTFVEMLGEEKMSLSMFTDVMSTGLEALQFANIPPSLDQVLIANIDRSR
ADDB_BACAH      EQVWEEVMSLLDTFVEMLGEEKMSLSMFTDVMSTGLEALQFANIPPSLDQVLIANIDRSR
ADDB_BACC4      EQVWEEVMSLLDTFVEMLGEEKMSLSMFTDVMSTGLEALQFANIPPSLDQVLIANIDHSR
ADDB_BACCR      EQVWEEVMSLLDTFVEMLGEEKMSLSMFTDVMSTGLEALQFANIPPSLDQVLIANIDHSR
ADDB_BACC2      EQVWEEVMSLLDTFVEMLGEEKMSLSMFTDVMSTGLEALQFANIPPSLDQVLIANIDHSR
ADDB_BACMK      EQVWEEVMSLLDTFVEMLGEEKMSLSMFTDVMTTGLEALQFANIPPSLDQVLVANIDHSR
ADDB_BACCN      DQVWEEVMNLLDTFVEMLGEESMSLSVFIDVMTTGLEALQFANIPPSLDQVLIANIDRSR
ADDB_BACSU      QQAWDAVIQLLEEFVEMMGDDEISLDLFQQMIEAGAESLTFSLIPPALDQVFVGNMDLSR
ADDB_BACVZ      GQAWDAVIQLLEEFAGMMGEDEISLALFQQMLETGTESLHFSLIPPALDQVFVGNMDLSR
ADDB_BACLD      EQVWDAVIQLLDEFVEMMGTERISFALFQQMIETGLESLKFALIPPALDQVFIGNMDLSR
ADDB_BACP2      GQVWDAVIQLMDEFVDMLGDEELSFPLFQQMIDTGLASLKFALIPPSLDQVFIGSMDLSR
ADDB_GEOKA      EQAWNAVVDLLDQYVEMLGTESLPLAEFVKIIEAGLDRLEFSLVPPAMDQVIVAQLDRSR
ADDB_GEOTN      EQAWNAVVDLLDQYVEMLGAEPLPLAEFAKIIEAGLDRLEFALVPPAIDQVIVAQLDRSR
ADDB_ANOFW      EQVWQAFIDLLDQYVEILGDETLSLETFLTIIETGFESLQFSLVPPATDQVLIAHFDRSR
ADDB_OCEIH      EQVWDAVIQLFDEMVEIAGEEKMDLSVFQVALDAGIETLQFSHVPPSMDHIIVGTIDRSR
ADDB_DESHY      NQIWDAVIQVLDELVAGLGEEVMDLSDFAMILTSGLENLQLGLIPPGYDQVLVGSLDRSR
ADDB_DESHD      NQIWDAVIQVLDELVAGLGEEVMDLSDFAMILTSGLENLQLGLIPPGYDQVLVGSLDRSR
ADDB_SYMTH      EQVWTRVLELFDQIVEGLGDQVLSPKVYLQVLSAGLDGLKLGLIPPGLDQVIVGTVERSR
ADDB_MOOTA      EQIWEGLMDLLEELVLALGDTSLELEEYAAILDTGLESLKLRLIPPALDQVVAGTLDRSR
ADDB_DESAP      RQLWDGVVELLDQVVETLGDEALTPEEYGRILDSGMDGLQLALIPPALDQVLVGSLERSR
ADDB_DESRM      AQIWDNVILLLDEIVEAMGEQELNLEEYLQVLEAGLESLKLGLIPPGLDQVVVGTLERSR
ADDB_PELTS      SLVWSGFTALLDQVVEALGDEVLEPGEYAAVIDAGLESLRLGLIPPGLDQVLVASLERSR
ADDB_HELMI      RQVWAAVIDLFDQIVESLGETPLDLATYAVVMEAGLDSLKLSLIPPELDQVFVGSLDRSR
ADDB_NATTJ      NQLWDTVIDLLDQMVTFLGEQKVTLSEYLQIIESGLANIKLGLLPATLDQVLVGTADRSR
ADDB_ALKMQ      TQIWNKIMEIFDQLTEILADESATLKEYGRILEAGFLACKVGVIPSTIDQVLVGSIERSK
ADDB_ALKOO      TQIWNKVMEILDQLTEILAEESTTLKEYGRILEAGFLACEVGVIPTTIDQVLVGSIERSK
ADDB_CLOPE      SEVRDIFIDVLEQAVDVLGNEVMDLNEFMKVLNIGLSQYEMGLIPVALDQVNIGDITRIK
ADDB_CLOP1      YEVRDIFIDVLEQAVDVLGNEVMDLNEFMKVLNIGLSQYEMGLIPVALDQVNIGDITRIK
ADDB_CLOPS      SEVRDIFIDVLEQAVDVLGNEVMDLDEFMKVLNIGLSQYEMGLIPVALDQVNIGDITRIK
ADDB_CLOBB      KQVESIVIDMLDQAVEVMGSDVVDTFEFFKILNSGFENEEIGVIPVALDQVNVGDIARIK
ADDB_CLOBA      KQVESIVIDMLDQAVEVMGSDVVDTFEFFKILNSGFENEEIGVIPVALDQVNVGDIARIK
ADDB_CLOB8      SQVESIVIDIIDQAVDVIGEERLEYSEFFRILSSGFANEEIGIIPVALDQVNIGDIARIK
ADDB_THEP3      SQIWDIVVDVLDQMVEVMGEEKINIDLFSKILDIGFEAYQIGSIPPALDEVLVTSVDRMK
ADDB_THEPX      SQIWDIVVDVLDQMVEVMGEEKINIDLFSKILDIGFEAYQIGSIPPALDEVLVTSVDRMK
ADDB_CALS4      AQIWDIVVDVLDQMVEVLGEEKISLEQFARLISIGFDEYQIASIPPALDEVLVTSVDRMK
ADDB_CLOD6      SQVWDIVVDILDQMVELMGDEIISLEKFIKLITLGFDEYELGLVPPSIDQVLVSSVDRMK
ADDB_HUNT2      SQVWNAVMEVFDHTVEVMGDETFGIEKFARILEIGFGECKIGLIPASLDQVLVGSLERSR
ADDB_RUMCH      QQVWNILMDVFDQAVEVMADETFGLEKFANVFKIGLAEYKISSIPASLDQVLVGSIEHIR
ADDB_CLOBK      NQIWNIVMEVLDQIVEVIGEEKISLKEFFKILQTGFSEYEIGLIPPTLDQVMVGSITRLR
ADDB_CLOBL      NQIWNIVMEVLDQIVEVIGEEKISLKEFFKILQTGFSEYEIGLIPPTLDQVMVGSITRLR
ADDB_CLOBH      NQIWNIVMEVLDQIVEVIGEEKISLKEFFKILQTGLSEYEIGLIPPTLDQVMVGSITRLR
ADDB_CLOB1      NQIWNIVMEVLDQIVEVIGEEKISLKEFFKILQTGLSEYEIGLIPPTLDQVMVGSITRLR
ADDB_CLOBM      NQIWNIVMEVLDQIVEAIGGEKISLKEFFKILQTGFSEYEIGLIPPTLDQVIVGSITRLR
ADDB_CLOK1      SQIWDIVVDVLDQIVDVLGEQSFGMEIFNEALEIGFSQYEIGVIPPALDQVLVSNITRIK
ADDB_CLOTE      KQIWDVAIGLMEQLVEVMKEEKLNSRTLENIFKSGFEQYELGIIPPSLDQVLVSSTKRLR
ADDB_CLONN      SQIWNMVIELLDQVVEVFKEEELQLKDFVKILSLGFKDYKMGLIPPSLDQVLVSDVERVR
ADDB_CLOAB      SQIWNIIIELMDQLVEVMGNEKVNLEQFSRILFIGIKEHKMGLIPSSLDQVLVGSIDRLK
ADDB_LACP7      EQIYRMVLEIFDRMVELLGEDVLPLKEFRDILDTGFREAKVGLIPPSIDQILVGDIERTR
                          ::                   .  *     .  :*   *.:        :

ADDB_STAEQ      VDNKKHIYMVGMNDGILPQTVSSSSLITDEEKKYVEDNAHVELSPTSDILQMDEAFVCYI
ADDB_STAES      VDNKKHIYMVGMNDGILPQTVSSSSLITDEEKKYVEDNAHVELSPTSDILQMDEAFVCYI
ADDB_STAAB      VDNKQHVYLVGMNDGTMPQPVTASSLITDEEKKYFEQQANVELSPTSDILQMDEAFVCYV
ADDB_STAAR      VDNKQHVYLVGMNDGTMPQPVTASSLITDEEKKYFEQQANVELSPTSDILQMDEAFVCYV
ADDB_STAAW      VDNKQHVFLVGMNDGTMPQPVTASSLITDEEKKYFEQQANVELSPTSDILQMDEAFVCYI
ADDB_STAAS      VDNKQHVFLVGMNDGTMPQPVTASSLITDEEKKYFEQQANVELSPTSDILQMDEAFVCYI
ADDB_STAA1      VDNKQHVYLVGMNDGTMPQPVTASSLITDEEKKYFEQQANVELSPTSDILQMDEAFVCYV
ADDB_STAA2      VDNKQHVYLVGMNDGTMPQPVTASSLITDEEKKYFEQQANVELSPTSDILQMDEAFVCYV
ADDB_STAA9      VDNKQHVYLVGMNDGTMPQPVTASSLITDEEKKYFEQQANVELSPTSDILQMDEAFVCYV
ADDB_STAAM      VDNKQHVYLVGMNDGTMPQPVTASSLITDEEKKYFEQQANVELSPTSDILQMDEAFVCYV
ADDB_STAAN      VDNKQHVYLVGMNDGTMPQPVTASSLITDEEKKYFEQQANVELSPTSDILQMDEAFVCYV
ADDB_STAA3      VDNKQHVYLVGMNDGTMPQPVTASSLITDEEKKYFEQQANVELSPTSDILQMDEAFVCYV
ADDB_STAA8      VDNKQHVYLVGMNDGTMPQPVTASSLITDEEKKYFEQQANVELSPTSDILQMDEAFVCYV
ADDB_STAAT      VDNKQHVYLVGMNDGTMPQPVTASSLITDEEKKYFEQQANVELSPTSDILQMDEAFVCYV
ADDB_STAAC      VDNKQHVYLVGMNDGTMPQPVTASSLITDEEKKYFEQQANVELSPTSDILQMDEAFVCYV
ADDB_STAAE      VDNKQHVYLVGMNDGTMPQPVTASSLITDEEKKYFEQQANVELSPTSDILQMDEAFVCYV
ADDB_STAHJ      VDNKKHIYMVGMNDGAMPQPVSSSSLITDEEKKVFEQQAQVELSPTSDILQMDEAFVCYI
ADDB_STAS1      VDNKQHVYLVGANDGVLPQTVTASSLITDEEKKYFQEQSSIELSPTADILQMDEAFVCYI
ADDB_STACT      VDNKKHIYMLGMNDGTMPQAISNSGLISDDEKKYFQEETQLELSPTADVLQMDEAFVCYI
ADDB_EXIS2      LQQVKVVFLLGANDGLIPLVEDQSKLLSEGDHDFLHDQG-IPVGKASLDVFDDELYYLYQ
ADDB_LISMH      LLDMKVIFAIGMNDGVMPLRQKDKGIFSDQDRDALRAED-SKLKPSAKNNIGEEDLLAYK
ADDB_LISMO      LLDMKVIFAIGMNDGVMPLRQKDKGIFSDQDRDALRAED-SKLKPSAKNNIGEEDLLAYK
ADDB_LISMF      LLDMKVIFAIGMNDGVMPLRQKDNGILSDQDRDALRAEV-SNLKPSAKNNIGEEDLLAYK
ADDB_LISIN      LLNMKVIFAIGMNDGVMPLRQKDKGILSDQDRDSLRVEN-SNLKPSAKNNIGEEDLLAYK
ADDB_LISW6      LLDMKVIFAIGMNDGIMPLRQKDKGILSDQDRDSLRAEN-SNLKPSAKNNIGEEDLLAYK
ADDB_LYSSC      LSNIKVAFVLGMNDGVYPTRMEYEGLLSDTEREWFSQIG-YELAPTSSNRLLQENFLFYR
ADDB_BACHK      LSNVKATFVIGVNEGVIPAAPMDEGMLSDEERDVLSAAG-IELAPTTRQTLLEEQFVMYQ
ADDB_BACCZ      LSNVKATFVIGVNEGVIPAAPMDEGMLSDEERDVLSAAG-IELAPTTRQTLLEEQFVMYQ
ADDB_BACAN      LSNVKATFVIGVNEGVIPAAPMDEGMLSDEERDVLSAAG-IELAPTTRQTLLEEQFVMYQ
ADDB_BACC0      LSNVKATFVIGVNEGVIPAAPMDEGMLSDEERDVLSAAG-IELAPTTRQTLLEEQFVMYQ
ADDB_BACC7      LSNVKATFVIGVNEGVIPAAPMDEGMLSDEERDVLSAAG-IELAPTTRQTLLEEQFVMYQ
ADDB_BACCQ      LSNVKATFVIGVNEGVIPAAPMDEGMLSDEERDVLSAAG-IELAPTTRQTLLEEQFVMYQ
ADDB_BACC1      LSNVKATFVIGVNEGVIPAAPMDEGMLSDEERDVLSAAG-IELAPTTRQTLLEEQFVMYQ
ADDB_BACAH      LSNVKATFVIGVNEGVIPAAPMDEGMLSDEERDVLSAAG-IELAPTTRQTLLEEQFVMYQ
ADDB_BACC4      LSDVKATFIIGVNEGVIPAAPMDEGMLSDEEREVLGAAG-IELAPTTRQTLLEEQFVMYQ
ADDB_BACCR      LSDVRATFIIGVNEGVIPVAPMDEGMLSDEEREVLGAAG-IELAPTTRQTLLEEQFVMYQ
ADDB_BACC2      LSDVKATFIIGVNEGVIPAAPMDEGMLSDEEREVLGAAG-IELAPTTRQTLLEEQFVMYQ
ADDB_BACMK      LSDIKATFIIGVNEGVIPAAPMDEGMLSDEERNVLTAAG-IELAPTTRQTLLEEQFVMYQ
ADDB_BACCN      LSNIRATFVIGANEGVMPATPTDEGMLSDEERDVLAAAG-VELAPTTRQTLLEEQFVLYQ
ADDB_BACSU      MYGTSCTFVLGANDGVLPARPDENGVLSDDDREWLKTIG-VELSSGGRERLLDEHFLIYM
ADDB_BACVZ      MYGTSCTFVIGANDGVLPARPDENGVLSDDDREWLKAVG-VELSSAGRERLLDEHFLIYM
ADDB_BACLD      MYGTKCTFLIGVNDGILPARPADDGVLSDEDREWLKRNG-AQLAATGREQLLDENFLIYM
ADDB_BACP2      MYQVKCMFIIGVNDGVIPARPSDESVLSEDDREWLKRAG-AELAETGKERLLDEQFLIYQ
ADDB_GEOKA      LIDIKYAFVIGANDGVIPAKVKEDGLMAEVEREQLRELG-VALAPGGREQLFYDPFFVYL
ADDB_GEOTN      LIDVKYAFIIGVNDGVIPAKVKDEGLVAEVEREQLRELG-VALAPGGREQLFYDPFFVYL
ADDB_ANOFW      LSNIRCTFLVGVNEGVIPMRKNDDGMLSETDRELLYHYS-LHVAPASRERMLDEPFLLYL
ADDB_OCEIH      MSNIRCAFLLGVNEGIWPMKPTSDGMIDEAERLLLEQNG-LKLADTSERQLLDDWFYMYL
ADDB_DESHY      NPETAVLFLLGANDGILPGKPSDEGVFDELERLRLESK-GIMLAPKGKVQVYEEQYFIYT
ADDB_DESHD      NPETAVLFLLGANDGILPGKPSDEGVFDELERLRLESK-GIMLAPKGKVQVYEEQYFIYT
ADDB_SYMTH      HAGVRATLILGATEKDFPPQPAEDAIFTDRERERLKQS-GLDVGPTSLERLFQEQFLTYV
ADDB_MOOTA      QPELQAAFVLGVGEGVLPARLPEDATFSDREREELRAA-GLELAPTGTLRLFHEEFLAYL
ADDB_DESAP      NPDIRAAFVLGVSEGVLPGRHGGTGLFTDREREVLLAA-GLEVAPDTRRKVYEEQYLVYI
ADDB_DESRM      NPNVKAALVLGISDGVLPARPVEEGLFSDYEREALREI-GLNLAPGARRKLFDEQYLIYT
ADDB_PELTS      NPEMRAAFVMGVNDGVLPARTFDQGIFSDLERERLKAA-GLELAPGGRRKFFEEQYLVYI
ADDB_HELMI      CPGIRAAFVLGVSEGVLPARPKDDGIFDDKERERIYALTGLELAPGSRRRLFDEEYHIYV
ADDB_NATTJ      YHEIKVLFMAGVSDGLYPAKIDDDGIIDDRERITLRQH-DVEFAPTTEQKLYQEQYLIYN
ADDB_ALKMQ      SHDIKALFVVGVNDGVLPFGQEDGGILLDHERESLVKKG-ISIGTTLESSLLEEQFMIYS
ADDB_ALKOO      SHDIKALFVIGVNDGILPSSREDGGILLDHERESLDKKG-LSIGNTLENALLEEQFTIYS
ADDB_CLOPE      SRGTKALYIIGVNDGVLPSASKEEGILSDNDREILLEKG-ISLASDTRTKIFEEQFLVYT
ADDB_CLOP1      SRGTKALYIIGVNDGVLPSASKEEGILSDNDREILLEKG-ISLASDTRTKIFEEQFLVYT
ADDB_CLOPS      SRGTKALYIIGVNDGVLPSASKEEGILSDNDREILLEKG-ISLASDTRTKIFEEQFLVYT
ADDB_CLOBB      GREVKALYIVGINDGILPAAHKDEGILSDRDRIELKEFG-VVLAADGRSKAFEEQFVVYT
ADDB_CLOBA      GREVKALYIVGINDGILPAAHKDEGILSDRDRIELKEFG-IVLAADGRSKAFEEQFVVYT
ADDB_CLOB8      GRDVKVLYIVGINDGVLPASKKEEGLLSDRDRTTLGEVG-INLSSTTRNKVFEEQYLLYM
ADDB_THEP3      SHNAKALFVIGANDGIFPASSFEEGILTDEDRQILTSYE-VELDRDTKAKVFEEQFLVYT
ADDB_THEPX      SHNAKALFVIGANDGIFPASSFEEGILTDEDRQILTSYE-VELDRDTKAKVFEEQFLVYT
ADDB_CALS4      SHNSKVLYLLGANDGVFPASSFEEGIFSDEERNLLSSLD-LELDRDTKAKVFEEQFLVYT
ADDB_CLOD6      NPDTKYLYLVGTTDGVFPLITKDSGILSDNDRESLGNKG-IEVDIDSKTRSFEEQFLVYK
ADDB_HUNT2      SHEIKALYILGANDGVFPPAVMEEGILSDQDRAVLNNAG-IELASDTRTQAFDGQYLIYR
ADDB_RUMCH      SHEIKALYILGTNDGVFPSAGMSEGVLSDADREVLDKRG-IELASDTKTRAFDEQYLIYR
ADDB_CLOBK      SHNINTLYIVGVNDGIFPSPLKEEGILSDDDREFLGDKG-LEIAKDTKSIAFEEQFLVYS
ADDB_CLOBL      SHNINTLYIVGVNDGIFPSPLKEEGILSDDDREFLGDKG-LEIAKDTKSIAFEEQFLVYS
ADDB_CLOBH      SHNINTLYIVGVNDGIFPSPLKEEGILSDDDRKFLGDKG-LEIAKDTKSIAFEEQFLVYS
ADDB_CLOB1      SHNINTLYIVGVNDGIFPSPLKEEGILSDDDRKFLGDKG-LEIAKDTKSIAFEEQFLVYS
ADDB_CLOBM      SHNINILYIVGVNDGIFPAPLKEEGILSDDDRQFLGDKG-LEIAKDTKSIAFEEQFLVYS
ADDB_CLOK1      SYNISALYIAGVNDGIFPVTISPEGIFTDQDRDELKQNG-LEIAPNTRSRAFEEQFLIYA
ADDB_CLOTE      SHEIKALYIVGTNDGVFPSVLDENGILSDLERENLRETG-LEVAKDTKSTAFEEQFLMYV
ADDB_CLONN      THEIKLLYIIGVNDGIFPAVSKDEGILSDSDRGSLKKIG-IEIAEDTKSKAFEEQYLIYR
ADDB_CLOAB      SHAIKILYIIGVNDGVFPSAAMEEGILSDRDREILNSKG-VELAKDTKTQAMEQRFLVYT
ADDB_LACP7      LKDIKALFFLGVNDGIVPKANPGGGILSDAERQLFADHE-IELSPTKRQTAYLTEFYLYL
                          *  :   *        . : ::  .       .               * 

ADDB_STAEQ      AMTRSQQSVTFSYSLMGNSGDEKEISPFLTQIKELFYD----------LEITNLQD----
ADDB_STAES      AMTRSQQSVTFSYSLMGNSGDEKEISPFLTQIKELFYD----------LEITNLQD----
ADDB_STAAB      AMTRAKGNVTFSYSLMGSSGDDKEISPFLNQIQSLFNQ----------LEITNLPQ----
ADDB_STAAR      AMTRAKGNVTFSYSLMGSSGDDKEISPFLNQIQSLFNQ----------LEITNIPQ----
ADDB_STAAW      AMTRARQDVTFSYSLMGSSGDDKEISPFLNQIQSLFNQ----------LEITNIPQ----
ADDB_STAAS      AMTRARQDVTFSYRLMGSSGDDKEISPFLNQIQSLFNQ----------LEITNIPQ----
ADDB_STAA1      AMTRAKGDVTFSYSLMGSSGDDKEISPFLNQIQSLFNQ----------LEITNIPQ----
ADDB_STAA2      AMTRAKGDVTFSYSLMGSSGDDKEISPFLNQIQSLFNQ----------LEITNIPQ----
ADDB_STAA9      AMTRAKGDVTFSYSLMGSSGDDKEISPFLNQIQSLFNQ----------LEITNIPQ----
ADDB_STAAM      AMTRAKGDVTFSYSLMGSSGDDKEISPFLNQIQSLFNQ----------LEITNIPQ----
ADDB_STAAN      AMTRAKGDVTFSYSLMGSSGDDKEISPFLNQIQSLFNQ----------LEITNIPQ----
ADDB_STAA3      AMTRAKGDVTFSYSLMGSSGDDKEISPFLNQIQSLFNQ----------LEITNIPQ----
ADDB_STAA8      AMTRAKGDVTFSYSLMGSSGDDKEISPFLNQIQSLFNQ----------LEITNIPQ----
ADDB_STAAT      AMTRAKGDVTFSYSLMGSSGDDKEISPFLNQIQSLFNQ----------LEITNIPQ----
ADDB_STAAC      AMTRAKGDVTFSYSLMGSSGDDKEISPFLNQIQSLFNQ----------LEITNIPQ----
ADDB_STAAE      AMTRAKGDVTFSYSLMGSSGDDKEISPFLNQIQSLFNQ----------LEITNIPQ----
ADDB_STAHJ      AMTRGSEQVTFSYSLMGAQGEDKEKSPFIDQIQGLFNG----------LEVMNIHY----
ADDB_STAS1      AMTRSRAHVTFSYALMGASGDVKEPSPFLHQIQQLYTN----------LEVQNIHH----
ADDB_STACT      AMTRASTHVTFSYSLMGLNNDDKEVSPFIQNIRDLYTN----------LDVLNVQY----
ADDB_EXIS2      GVTAPSESLHISYALVDEDGKALQPASIVKQIKHQLLQD-----RPVKTYFAEAGD----
ADDB_LISMH      IISLPSDKLFLSYPAADEEGKVLSESNYLRKIKGQ------FNELNESVYLTDPSL----
ADDB_LISMO      IISLPSDKLFLSYPAADEEGKVLSESNYLRKIKGQ------FNELNESVYLTDPSL----
ADDB_LISMF      IISLPSDKLFLSYPAADEEGKVLSESNYLRKIKGQ------FKKLSESVYLTDPGL----
ADDB_LISIN      IMSLPSDKLFLSYPAADEEGKVLSESNYLRKIKGQ------FKNLNESVYLTDPSL----
ADDB_LISW6      IISLPSDKLFLSYPAADEEGKVLSESNYLRKIKGQ------FKKLNEEVYLTDPSL----
ADDB_LYSSC      AASTPSNKLYLTYPTADEEGKALLSSLYIKKFIGNDKIAGLLSGVQAERVVMDPIE----
ADDB_BACHK      MVTRATEKLYISCPLADEEGKTLLASSFIKKIKRM------FPDVKDTFITNDVND----
ADDB_BACCZ      MVTRATEKLYISCPLADEEGKTLLASSFIKKIKRM------FPDVKDTFITNDVND----
ADDB_BACAN      MVTRATEKLYISCPLADEEGKTLLASSFIKKIKRM------FPDVKDTFITNDVND----
ADDB_BACC0      MVTRATEKLYISCPLADEEGKTLLASSFIKKIKRM------FPDVIDTFITNDVND----
ADDB_BACC7      MVTRATEKLYISCPLADEEGKTLLASSFIKKIKRM------FPDVKDTFITNDVND----
ADDB_BACCQ      MVTRATEKLYISCPLADEEGKTLLASSFIKKIKRM------FPDVKDTFITNDVND----
ADDB_BACC1      MVTRATEKLYISCPLADEEGKTLLASSFIKKIKRM------FPDVKDTFITNDVND----
ADDB_BACAH      MVTRATEKLYISCPLADEEGKTLLASSFIKKIKRM------FPNVKDTFITNDVND----
ADDB_BACC4      MVTRASEKLYISCPLADEEGKTLLASSFIKKIKRM------FPNVKDSFITNDVND----
ADDB_BACCR      MVTRASEKLYISCPLADEEGKTLLASSFIKKIKRM------FPNVKDSFISNDVND----
ADDB_BACC2      MVTRASERLYISCPLADEEGKTLLASSFIKKIKRM------FPNVKDSFITNDVND----
ADDB_BACMK      MVTRASEKLYISCPLADEEGKTLLASSFIKKIKRM------FPDVKESFITNDVND----
ADDB_BACCN      MVTRASEKLYISCPLADEEGKTLLASSFMKKIKRM------FPNVKETFVTNDVND----
ADDB_BACSU      AFSSPSDRLYVSYPIADAEGKTLLPSMIVKRLEEL------FPHHKERLLTNEPEQ----
ADDB_BACVZ      ALSSPSDRLYVSYPIADAEGKTLLPSIVVNRLGEL------FPDHQEKLSAADPEQ----
ADDB_BACLD      TLSSPSEKLYVSYPIADSEGKTLLPSTVVKRLNEL------FPDSEEKMLIHEPEQ----
ADDB_BACP2      ALSSPSHHLYLSYAASDAEGRSLLPSPLIKYCQEL------MPNHQQALYVLDPEL----
ADDB_GEOKA      ALVCPSRRLYVTYPLADGEGKALMPSPLIKQLTEL------FPHAPVHLCGNDPFD----
ADDB_GEOTN      ALACPSRRLYVTYPLADGEGKALMPSPLIKQLVQL------FPRVSVHLCGNDPFD----
ADDB_ANOFW      ALVSSSERLYVTYALSNEQEKTLLPSMFIKRLTDM------FPNVTKMQWGTDPFL----
ADDB_OCEIH      AFTVAKDRLKISYLLSDEEGKAKMPSQLIHRVEEL------FPATKNHILLQDPE-----
ADDB_DESHY      ALTRAREQLYISYPLTDEEGRGLTVSPVIHRLKMIFPGLP------EKYLSLDEE-----
ADDB_DESHD      ALTRAREQLYISYPLTDEEGRGLTVSPVIHRLKMIFPGLP------EKYLSLDEE-----
ADDB_SYMTH      ALTRGSDFLWISYPLADESGRAAAPSPVVGRMRRLFPELK------PRPAAPPAP-----
ADDB_MOOTA      ALTRSRRYLWLSYPLADAEGKALSPSPLVRRLRQLLPGLR------EETAGTELP-----
ADDB_DESAP      ALTRAGHYLWVSYPLADEEGGALAPSSVIPRLRELFPGLR------EETLALEPEG----
ADDB_DESRM      ALTRASSRLWLSYPQADDEGKALMPSPVIQRVKELLPLIQ------EEILPVEP------
ADDB_PELTS      ALTRSSERIYLSYPLADGEGRALMPSPIVARVKELLPDVE------ERVWPVEPN-----
ADDB_HELMI      ALTRASERCYLSYPLADAEGRAQLPSSVIARVRELFPQVT------ERTWLLEPGSLPTG
ADDB_NATTJ      VLTQPSQKLYLSYPAADSEGRTMSPSTIISDIQEMFPELF------QEYQNDGPE-----
ADDB_ALKMQ      AFSKPTEYLWVSYALADQEGKAMRQSILIDRFKKLFKNLR-----------IKSD-----
ADDB_ALKOO      ALSKPTEYLWISYALADQEGKAQRQSILIDRIKKLFRNLN-----------IQSD-----
ADDB_CLOPE      AFTIAEEYLVVTYPLADFEGKSQRPSIIVHRLKKILPNVK-----------EES------
ADDB_CLOP1      AFTIAEEYLVVTYPLADFEGKSQRPSIIVHRLKKILPNVK-----------EES------
ADDB_CLOPS      AFTIAEEYLVVTYPLADFEGKSQRPSIIVHRLKKILPNVK-----------EES------
ADDB_CLOBB      ALTIASEYLMLSYPMADFEGKSLRPSIIISRIKKILPNLV-----------EESSL----
ADDB_CLOBA      ALTIASEYLMLSYPMADFEGKSLRPSIIISRIKKILPNLV-----------EESSL----
ADDB_CLOB8      ALTISSEYLMLSYPMADFEGKSLRPSIVISRIKKIFPNLI-----------EESAI----
ADDB_THEP3      ALTSTSKFLRISYPIADHEGRSLRPSIIISRFKRIFPQIT-----------QFSNV----
ADDB_THEPX      ALTSTSKFLRISYPIADHEGRSLRPSIIISRFKRIFPQIT-----------QFSNV----
ADDB_CALS4      ALTSASEFLKISYPIADHEGRSLRPSIIISRLRRIFPKIK-----------VSTNI----
ADDB_CLOD6      ALTSTSKNLTITYPISDHEGKTLRPSIIISRLKKIFPNIE-----------NKSYL----
ADDB_HUNT2      ALTTAGNYLRISWSIADHEGRTLRPSLVVFRLRKLFLNIT-----------ETSN-----
ADDB_RUMCH      TLTTPKNYLRLSWPIADHEGRTMRPSTIISRMRKIFPKVT-----------EKSN-----
ADDB_CLOBK      TLTTPSKYLRLSYPIADGEGKTLRPSIIISRIKKIFANIC-----------EEND-----
ADDB_CLOBL      TLTTPSKYLRLSYPIADGEGKTLRPSIIISRIKKIFANIC-----------EEND-----
ADDB_CLOBH      TLTTPSKYLRLSYPIADGEGKTLRPSIIISRIKKIFTNIC-----------EEND-----
ADDB_CLOB1      TLTTPSKYLRLSYPIADGEGKTLRPSIIISRIKKIFTNIC-----------EEND-----
ADDB_CLOBM      TLTTPSKYLRLSYPIADGEGKTLRPSIIISRIKKIFTNIC-----------EEND-----
ADDB_CLOK1      TLTIVDKYLTLTYSMSDEEGKAKRPSVVISMIKKIFPKLQ-----------EKSN-----
ADDB_CLOTE      TLTTMSDYLRISYPIANEEGKTLRPSIVISRLRKIFPNLC-----------EKSN-----
ADDB_CLONN      TLTTTQKYLRICYSIADYEGKALRPSIIVSRFKSLFPKIA-----------EESD-----
ADDB_CLOAB      AITNSKEYLFLSYPIADYEGKTLRPSLIVNRVKTLFPKIV-----------EKSD-----
ADDB_LACP7      NLTKPQNKLYLYYSKLDVSGKSIRASYLLGKISKIFPKLK----------IYDADR----
                          .     . .      :  :                               

ADDB_STAEQ      ------------------------------------LHKAQPLLMMQHSHQTKIQLFEYL
ADDB_STAES      ------------------------------------LHKAQPLLMMQHSHQTKIQLFEYL
ADDB_STAAB      ------------------------------------YHEVNPLSLMQHAKQTKITLFEAL
ADDB_STAAR      ------------------------------------YHEVNPLSLMQHAKQTKITLFEAL
ADDB_STAAW      ------------------------------------YHEVNPLSLMQHAKQTKITLFEAL
ADDB_STAAS      ------------------------------------YHEVNPLSLMQHAKQTKITLFEAL
ADDB_STAA1      ------------------------------------YHEVNPLSLMQHAKQTKITLFEAL
ADDB_STAA2      ------------------------------------YHEVNPLSLMQHAKQTKITLFEAL
ADDB_STAA9      ------------------------------------YHEVNPLSLMQHAKQTKITLFEAL
ADDB_STAAM      ------------------------------------YHEVNPLSLMQHAKQTKITLFEAL
ADDB_STAAN      ------------------------------------YHEVNPLSLMQHAKQTKITLFEAL
ADDB_STAA3      ------------------------------------YHEVNPLSLMQHAKQTKITLFEAL
ADDB_STAA8      ------------------------------------YHEVNPLSLMQHAKQTKITLFEAL
ADDB_STAAT      ------------------------------------YHEVNPLSLMQHAKQTKITLFEAL
ADDB_STAAC      ------------------------------------YHEVNPLSLMQHAKQTKITLFEAL
ADDB_STAAE      ------------------------------------YHEVNPLSLMQHAKQTKITLFEAL
ADDB_STAHJ      ------------------------------------QHNAQPLSLMEHPHQTKVVLFESL
ADDB_STAS1      ------------------------------------QHQAEPLRLMEHPHQTKIALFESL
ADDB_STACT      ------------------------------------AAQHNPLTVMEHPHQTKIALFEEL
ADDB_EXIS2      ------------------------------------HAPDDQLQFVTSPERAAAAAAIEL
ADDB_LISMH      ------------------------------------LSDAEQSSYIRSKQATLGLLTSQL
ADDB_LISMO      ------------------------------------LSDAEQSSYIRSKQATLGLLTSQL
ADDB_LISMF      ------------------------------------LSDAEQSSYIRSKQATLGLLTSQL
ADDB_LISIN      ------------------------------------LNDKEQSSYIRSKQATLGLLTSQL
ADDB_LISW6      ------------------------------------LSDEEQSSYIRSKQATLGLLTSQL
ADDB_LYSSC      ------------------------------------LLDESALPYLRHPRTALAHLMVQL
ADDB_BACHK      ------------------------------------LSRSEQISFVATPEVTLSYVMQQL
ADDB_BACCZ      ------------------------------------LSRSEQILYVATPEVTLSYVMQQL
ADDB_BACAN      ------------------------------------LSRLEQISYVATPEVTLSYVMQQL
ADDB_BACC0      ------------------------------------LSRSEQISYVATPEVTLSYVMQQL
ADDB_BACC7      ------------------------------------LSRSEQISYVATPEVTLSYVMQQL
ADDB_BACCQ      ------------------------------------LSRSEQISYVATPEVTLSYVMQQL
ADDB_BACC1      ------------------------------------LSRSEQISYVATPEVTLSYVMQQL
ADDB_BACAH      ------------------------------------LSRSEQISYVATPEVTLSYVMQQL
ADDB_BACC4      ------------------------------------LSRSEQISYVATPEVTLSYVMQQL
ADDB_BACCR      ------------------------------------LSRSEQISYVATPEVTLSYVMQHL
ADDB_BACC2      ------------------------------------LSRSEQISYVATPEVTLSYVMQQL
ADDB_BACMK      ------------------------------------LSRSEQLSYVATPEVTLSYVMQQL
ADDB_BACCN      ------------------------------------LSRAAQISYVTTPEVTLSYVMQQL
ADDB_BACSU      ------------------------------------VSDEEQLMYVVNKSVAQSFTASQL
ADDB_BACVZ      ------------------------------------VSEEEQLQYLVNKQVAQTYTASQL
ADDB_BACLD      ------------------------------------LDDEAQLEFLVNKGIALSHLAGQL
ADDB_BACP2      ------------------------------------LEDDEQLKFVANEHVSLSYTISQL
ADDB_GEOKA      ------------------------------------APAEKAEAFVTAPRATQTYLISQL
ADDB_GEOTN      ------------------------------------APEEKPETFVTVPRATQTYLISQL
ADDB_ANOFW      ------------------------------------LPLQQQLAYVTNDVATLGPLVQQL
ADDB_OCEIH      -------------------------------------DESNTRRFVSTELKSRSALTAQL
ADDB_DESHY      -----------------------------------------EPGALPHPYALLPAYALHL
ADDB_DESHD      -----------------------------------------EPGALPHPYALLPAYALHL
ADDB_SYMTH      -------------------------------------DAEAAVAQVATPRQLAAAVARAL
ADDB_MOOTA      -------------------------------------GGDDDLVYLTTPRQAAGHLARLL
ADDB_DESAP      ------------------------------------TAPGADLPYVTAPGRTLGFLVTRL
ADDB_DESRM      ----------------------------------PCLGGDL--AFIANPSRSLSYLAAML
ADDB_PELTS      ----------------------------------AALLDDL--EFVTGPRRTLSYLASQM
ADDB_HELMI      AGLSGSAFAGAATAETAAMAQTALAARTTKEAAMSAVERELAEEYIVHPARSLSYLIPSL
ADDB_NATTJ      -------------------------------------NDEDFRQYIIDGKKAVSNLIKLI
ADDB_ALKMQ      ----------------------------------VVNDVDRQLHLITTPISTFKYMTENI
ADDB_ALKOO      ----------------------------------VVPTLNRQLHLITTPISTFKYMTESI
ADDB_CLOPE      -------------------------------EGFKLVDD--KYEKISAKIPTLNELMIAI
ADDB_CLOP1      -------------------------------EGFKLVDD--KYEKISAKLPTLNELMIAI
ADDB_CLOPS      -------------------------------EGFKLVND--KYDKISAKIPTLNELMIAI
ADDB_CLOBB      -------------------------------YDLSKGND--HFNKVISPIPTFNELIFAL
ADDB_CLOBA      -------------------------------YDLSKRSD--HFNKVISPIPTFNELIFAL
ADDB_CLOB8      -------------------------------YDLKILEN--KFGKIIAPIPTFNELIISM
ADDB_THEP3      -------------------------------IE--MDTDEENLHRVSSPDPTFNEMIKSF
ADDB_THEPX      -------------------------------IE--MDTDEENLHRVSSPDPTFNEMIKSF
ADDB_CALS4      -------------------------------VE--MDTDEENLNRVTVPLPTFNEMIKSF
ADDB_CLOD6      -------------------------------VEENKNTDKDILKKITVKSPTFNELINVI
ADDB_HUNT2      --------------------------------ILPSGSLEEEMELLSGNSPAFKSMVSAL
ADDB_RUMCH      --------------------------------IVKPSADKQHIDLIASPIPAFNQLVCAL
ADDB_CLOBK      --------------------------------IVKLNGEEEELKNISSAKPTFNYLISNL
ADDB_CLOBL      --------------------------------IVKLNGEEEELKNISSAKPTFNYLISNL
ADDB_CLOBH      --------------------------------IVKLNGEEEELKNISSAKPTFNYLISNL
ADDB_CLOB1      --------------------------------IVKLNGEEEELKNISSAKPTFNYLISNL
ADDB_CLOBM      --------------------------------IVKLNGEEEELKNISSAKPTFNYLISNL
ADDB_CLOK1      --------------------------------LLDASGYEGGIEAVNSPKVTFNMLISNI
ADDB_CLOTE      --------------------------------VIKE---EGDIEKISSPKPTFNEFISQL
ADDB_CLONN      --------------------------------NIAMDYEEENIDLISREIPTFNNLVSVL
ADDB_CLOAB      --------------------------------VIKIENDEESMKLISATVPTFNEMISSF
ADDB_LACP7      ---------------------------------------KSREDELLGTDQGLSYLISVL
                                                             :             :

ADDB_STAEQ      RGWLDH----EDIDYRWLDAYLAIRDDD-QLNQGLDYLTTSLTYDNET----VQLNEILS
ADDB_STAES      RGWLDH----EDIDYRWLDAYLAIRDDD-QLNQGLDYLTTSLTYDNET----VQLNEILS
ADDB_STAAB      RAWLDD----EIVADSWLDAYQVIRDSD-HLNQGLDYLMSALTFDNET----VKLGETLS
ADDB_STAAR      RAWLDD----EIVADSWLDAYQVIRDSD-HLSQGLDYLMSALTFDNET----VKLGETLS
ADDB_STAAW      RAWLYD----EIVADSWLDAYQVIRDSD-HLNQGLDYLMSALTFDNET----VKLGETLS
ADDB_STAAS      RAWLYD----EIVADSWLDAYQVIRDSD-HLNQGLDYLMSALTFDNET----VKLGETLS
ADDB_STAA1      RAWLDD----EIVADSWLDAYQVIRDSD-HLNQGLDYLMSALTFDNET----VKLGETLS
ADDB_STAA2      RAWLDD----EIVADSWLDAYQVIRDSD-HLNQGLDYLMSALTFDNET----VKLGETLS
ADDB_STAA9      RAWLDD----EIVADSWLDAYQVIRDSD-HLNQGLDYLMSALTFDNET----VKLGETLS
ADDB_STAAM      RAWLDD----EIVADSWLDAYQVIRDSD-HLNQGLDYLMSALTFDNET----VKLGETLS
ADDB_STAAN      RAWLDD----EIVADSWLDAYQVIRDSD-HLNQGLDYLMSALTFDNET----VKLGETLS
ADDB_STAA3      RAWLYD----EIVADSWLDAYQVIRDSD-HLNQGLDYLMSALTFDNET----VKLGETLS
ADDB_STAA8      RAWLYD----EIVADSWLDAYQVIRDSD-HLNQGLDYLMSALTFDNET----VKLGETLS
ADDB_STAAT      RAWLYD----EIVADSWLDAYQVIRDSD-HLNQGLDYLMSALTFDNET----VKLGETLS
ADDB_STAAC      RAWLYD----EIVADSWLDAYQVIRDSD-HLNQGLDYLMSALTFDNET----VKLGETLS
ADDB_STAAE      RAWLYD----EIVADSWLDAYQVIRDSD-HLNQGLDYLMSALTFDNET----VKLGETLS
ADDB_STAHJ      KAWLEA----EMVADVWVDAYQVMRDND-KLNNGLEYLLTALTYDNET----VKLDEPLA
ADDB_STAS1      KAWLDD----ELVAETWLDTYQVMRNDT-RLNDGLTYLLSALTYDNQT----VQLNPSLS
ADDB_STACT      QSWLNH----ELTAETWLEAYQAMLHNE-RLSRGLQYLTSALTFDNKT----IQLNQSLS
ADDB_EXIS2      RRLQRR----YPIQPSWFDVYNRLLENG-RGRERMALFSNALFYQNQA----EPLPEDLA
ADDB_LISMH      QMYKRG----YTLSSVWWDAYNSYFENE-KESIMAKQVLSSLYYENKT----KPLQETTA
ADDB_LISMO      QMYKRG----YTLSSVWWDAYNSYFENE-KESIMAKQVLSSLYYENKT----KPLQETTA
ADDB_LISMF      QMYKRG----YPLSSVWWDAYNSYFENG-KESRMAKQVLSSLYYENKT----KPLQEKTA
ADDB_LISIN      QMYKRG----YPLSNVWWDAYNSYFEDS-KESEAAKQVLSSLYYENKT----KPLQETTA
ADDB_LISW6      QMYKRG----YPLSNVWWDAYNGYFEDT-KESKVAKQVLSSLYYENKT----KALHETTA
ADDB_LYSSC      RQAEHS----RELAPEWLALQKFYQQDP-YWALIFDRVHYPITHKNEA----EPLETYIT
ADDB_BACHK      QTWKRYG--FEGNLDFWWDVYNFYVTSD-EWKQKSSRVLSSLFYRNRA----QKLSTAVS
ADDB_BACCZ      QTWKRYG--FEGNLDFWWDVYNFYVTSD-EWKQKSSRVLSSLFYRNRA----QKLSTAVS
ADDB_BACAN      QTWKRYG--FEGNLDFWWDVYNFYVTSD-EWKQKSSRVLSSLFYRNRA----QKLSTAVS
ADDB_BACC0      QTWKRYG--FEGNLDFWWDVYNFYVTSD-EWKQKSSRVLSSLFYRNRA----QKLSTAVS
ADDB_BACC7      QTWKRYG--FEGNLDFWWDVYNFYVTSD-EWKQKSSRVLSSLFYRNRA----QKLSTAVS
ADDB_BACCQ      QTWKRYG--FEGNLDFWWDVYNFYVTSD-EWKQKSSRVLSSLFYRNRA----QKLSTAVS
ADDB_BACC1      QTWKRYG--FEGNLDFWWDVYNFYVTSD-EWKQKSSRVLSSLFYRNRA----QKLSTAVS
ADDB_BACAH      QTWKRYG--FEGNLDFWWDVYNFYVTSD-EWKQKSSRVLSSLFYRNRA----QKLSTAVS
ADDB_BACC4      QTWKRYG--FEGNLDFWWDVYNFYVTSD-EWKQKSSRVLSSLFYRNRA----KKLSTAVS
ADDB_BACCR      LTWKRYG--FEGNLDFWWDVYNFYVTSD-EWKQKSSRVLSSLFYRNRA----KKLSTAVS
ADDB_BACC2      QTWKRYG--FEGNLDFWWDVYNFYVTSD-EWKQKSSRVLSSLFYRNRA----KKLSTAVS
ADDB_BACMK      QTWKRYG--FEGNLDFWWDVYNFYVTSD-EWKQKSSRVLSSLFYRNRA----QKLSTDVS
ADDB_BACCN      QTWKRYG--FEGDLDFWWDVYNFYVTSD-EWKQKSNRVLSSLFYRNRA----KKLSTAVS
ADDB_BACSU      RLWTRE----YDISDVWWSTYNVLMSEQ-DRLQ-SKKLFSSLFFRNEV----KQLERSVS
ADDB_BACVZ      RLWTRE----YEISDVWWSAYNVLMKEP-DHRR-AKKLFSSLFFRNEA----KRLERPVS
ADDB_BACLD      GIWTRQ----YAISDVWWSTYNFLMNEP-DRIF-SQNILSSLFFRNKV----ENLNRHVS
ADDB_BACP2      QQWLNQ----YPISGVWWSVYNYLMTSP-NRDV-SKNIMSSLFFTNRA----KPLKPNVT
ADDB_GEOKA      RAWKRN----YGIDPLWWDVYNTFIGHR-DWKEQVRHAVSALFYTNGA----TPLKKQWS
ADDB_GEOTN      RAWKRN----YGIDPLWWDVYNVLISHP-EWRARVEQAVSGLFYTNQA----V-LKREWS
ADDB_ANOFW      EAWKRQ----YAIEPMWWDVYNAYVQHE-QWKERIAVVVRALFYENRA----KRLNKQLA
ADDB_OCEIH      AKFKKG----YPIDPIWWEVYQWYVEHH-PQGGTTHRVLQGLHYENKP----ESLQKDTV
ADDB_DESHY      QKLRQG----SSLSPLWQAIRLWFLSQT-AAFPQVQLLEKGLRDQNEE----GKLPQPLA
ADDB_DESHD      QKLRQG----SSLSPLWQAIRLWFLSQT-AAFPQVQLLEKGLRDQNEE----GKLPQPLA
ADDB_SYMTH      RRARSG----YAVEPHWLDLYQCIVLDP-DLHREGAAVLAAVGYEEWLRRRGTPVGRELA
ADDB_MOOTA      GRGRP-------LPPLWQEVYRWLHQDA-R-GQKMLGLLEGGGYRNQV----DPLEPELA
ADDB_DESAP      RDWKSG----VTVDPVWWSVFNWFAAHA-GWRERCAPVLAGLFYENRE----PRLDPELT
ADDB_DESRM      RETVAG----RLVDPVWQDVYSWFVQQP-QYQESCRRVLAGLYHVNQE----TSLPPSMG
ADDB_PELTS      REFKAG----RRIDPLWWDVYSWFAAG--EMREHCKRVLSGLFHSNRE----DRLPPAVS
ADDB_HELMI      REALAR----RPVPLVWWAVYSWLAERP-AWRELLARVLSGLWHKNRE----QDLPKPVS
ADDB_NATTJ      NKVGHP----EKLAEDKQQLLAYLINEH-PDLFYSTPEIKALDYKKSL----SPLTQEVI
ADDB_ALKMQ      RQNVD----DKAMADMWWDVYDWYSKEP-TWEDRRKLMVKGLFHQNQI----TYIGENKA
ADDB_ALKOO      RQNID----DKPMEDIWWDVYQWYSNES-QWDERRNLMVKGLFHENQI----SYIGEQKA
ADDB_CLOPE      RKNYDG---AEI-EDYWKYVYDWYLREP-KWKERIEYVRKGLEYTNLE----NNISKEKA
ADDB_CLOP1      RKNYDG---AEI-EDYWKYVYDWYLREP-KWKERIEYVRKGLEYTNLE----NNISKEKA
ADDB_CLOPS      RKNYDG---AEI-DDYWKYVYDWYLREP-KWKERIEYVRKGLEYTNLE----NNISKEKA
ADDB_CLOBB      RRELED---EEIDEEYWGEVYNWFKENE-DFKWKIENIFKGLRYSNTG----EKVSRNKL
ADDB_CLOBA      RRELED---EDIDEEYWGEVYNWFKENE-DFKWKIENTFKGLRYSNTG----EKVSRNKL
ADDB_CLOB8      RKDFDK---EYI-EPYWSEVYEWFKNND-EFRDKVKNIFKGLSYSNIG----DKVSKNKL
ADDB_THEP3      KEWDI----KDKINSLWLDVYNWYSNKE-VWRKRIEKVLEGFNYSNQV----RVIPSAKI
ADDB_THEPX      KEWDI----KDKINSLWLDVYNWYSNKE-VWRKRIEKVLEGFNYSNQV----RVIPSAKI
ADDB_CALS4      KKWNI----TGKIHPIWLEVYKWYRTKD-EWKKKLEDTLEGFVYDNQI----KRIPPLKI
ADDB_CLOD6      KNYDSDGYNTEEINSIWLDIYRYYLKDE-IYSSITKKVIKGLSYTNQV----HKIEEKKI
ADDB_HUNT2      RQKA----DGKEIKPVWQEAYRWFAVQD-EWRGKCEALRAAFQYKNLA----QPVSREKI
ADDB_RUMCH      RQKN----EGIEQGEIWREIFAWFSGQD-EWKQKCDAMINALKYRNIA----APVDKSKI
ADDB_CLOBK      RKDV----EGVKIDNIWGDTYKWYLENE-FWIEKLNRLIKGFDYTNQS----KYIETKKI
ADDB_CLOBL      RKDV----EGVKIDNIWGDTYKWYLENE-FWIEKLNRLIKGFDYTNQS----KYIETKKI
ADDB_CLOBH      RKDV----EGAKIDNIWGDTYKWYLENE-FWIEKLNRLIKGFDYTNQS----KYIETKKI
ADDB_CLOB1      RKDV----EGAKIDNIWGDTYKWYLENE-FWIEKLNRLIKGFDYTNQS----KYIETKKI
ADDB_CLOBM      RKDI----EGVKIDNIWGDIYKWYFENE-FWIEKLNRLVKGFDYTNQS----KYIETKKI
ADDB_CLOK1      RRNLG---HRENINSLWIDVYRWYREHE-IWNKRLDTVLGAFYYNNEI----KISDLVKI
ADDB_CLOTE      RVKE----EGLELSSIWLSVYDWFMNNK-EWKEKFINISQGFNHTNYA----EIVDTRRV
ADDB_CLONN      RRE-D---NKVKVSPFWSDVYKWYSENP-RWKETLDTVFSAISYTNAV----DDISEEKI
ADDB_CLOAB      RKEID---GEGEVSSIWHDVYRWYSKSD-EWTGKCNNMFKAISYTNQV----DYISEEKA
ADDB_LACP7      RDYEGE------QPKLWREVYHLYVSGQIKGRISLDKVLQGVFYQNYE----QGLTKEVA
                                                             :              

ADDB_STAEQ      QQLYGKTI---NASVSRFEGYQQCPFKHYASHGLRLNERTKYELQNFDLGDIFHSVLKYI
ADDB_STAES      QQLYGKTI---NASVSRFEGYQQCPFKHYASHGLRLNERTKYELQNFDLGDIFHSVLKYI
ADDB_STAAB      KDLYGKEI---NASVSRFEGYQQCPFKHYASHGLKLNERTKYELQNFDLGDIFHSVLKYI
ADDB_STAAR      KDLYGKEI---NASVSRFEGYQQCPFKHYASHGLKLNERTKYELQNFDLGDIFHSVLKYI
ADDB_STAAW      KDLYGKEI---NASVSRFEGYQQCPFKHYASHGLKLNERTKYELQNFDLGDIFHSVLKYI
ADDB_STAAS      KDLYGKEI---NASVSRFEGYQQCPFKHYASHGLKLNERTKYELQNFDLGDIFHSVLKYI
ADDB_STAA1      KDLYGKEI---NASVSRFEGYQQCPFKHYASHGLKLNERTKYELQNFDLGDIFHSVLKYI
ADDB_STAA2      KDLYGKEI---NASVSRFEGYQQCPFKHYASHGLKLNERTKYELQNFDLGDIFHSVLKYI
ADDB_STAA9      KDLYGKEI---NASVSRFEGYQQCPFKHYASHGLKLNERTKYELQNFDLGDIFHSVLKYI
ADDB_STAAM      KDLYGKEI---NASVSRFEGYQQCPFKHYASHGLKLNERTKYELQNFDLGDIFHSVLKYI
ADDB_STAAN      KDLYGKEI---NASVSRFEGYQQCPFKHYASHGLKLNERTKYELQNFDLGDIFHSVLKYI
ADDB_STAA3      KDLYGKEI---NASVSRFEGYQQCPFKHYASHGLKLNERTKYELQNFDLGDIFHSVLKYI
ADDB_STAA8      KDLYGKEI---NASVSRFEGYQQCPFKHYASHGLKLNERTKYELQNFDLGDIFHSVLKYI
ADDB_STAAT      KDLYGKEI---NASVSRFEGYQQCPFKHYASHGLKLNERTKYELQNFDLGDIFHSVLKYI
ADDB_STAAC      KDLYGKEI---NASVSRFEGYQQCPFKHYASHGLKLNERTKYELQNFDLGDIFHSVLKYI
ADDB_STAAE      KDLYGKEI---NASVSRFEGYQQCPFKHYASHGLKLNERTKYELQNFDLGDIFHSVLKYI
ADDB_STAHJ      ASLYGSTI---NASVSRFEGYNDCPFKHYANHGLRLNERTKYKLENFDLGNIFHTALKYI
ADDB_STAS1      KALYGSTI---NASVSRFEGYQACPFKHFASHGLRLNERTKYKLENFDLGDIFHRVLKFI
ADDB_STACT      KALYGDKI---NASVSRFEGYQQCPFKHYTSHGLRLNERTKYKLENFDLGDIFHSVLKYI
ADDB_EXIS2      RNLYGDTI---KASVSRFETYNACSYKHFARYGLRLKERKLYKFEAPDIGNLFHGALNDL
ADDB_LISMH      KNLFGETI---HASVSRMEKFFSCEFQHYAQYGLKLEERGHFQLQAVDMGEIFHGAMEWI
ADDB_LISMO      KNLFGETI---HASVSRMEKFFSCEFQHYAQYGLKLEERGHFQLQAVDMGEIFHGAMEWI
ADDB_LISMF      KNLFGETI---HASVSRMEKFFSCEFQHFAQYGLKLEERGHFQLQAVDMGEIFHGAMEWI
ADDB_LISIN      KNLFGENI---HASVSRMEKFFSCEFQHFAQYGLKLEERAHYKLQAVDMGEIFHGAMEWI
ADDB_LISW6      KNLFGENI---HASVSRMEKFFSCEFQHFAQYGLKLEERAHFKLQAVDMGEIFHGAMEWI
ADDB_LYSSC      QELYGQKL---TSSVSRIEKYFRCPFSHFTTYGLRLEERAEYRLETFAMGDLFHEALKWI
ADDB_BACHK      RDLYGDKI---KGSVSRMELFNRCAYAHFAQHGLSLRERDIFKLDAPDIGELFHAALKRI
ADDB_BACCZ      RDLYGDKI---KGSVSRMELFNRCAYAHFAQHGLSLRERDIFKLDAPDIGELFHAALKRI
ADDB_BACAN      RDLYGDKI---KGSVSRMELFNRCAYAHFAQHGLSLRERDIFKLDAPDIGELFHAALKRI
ADDB_BACC0      RDLYGDKI---KGSVSRMELFNRCAYAHFAQHGLSLRERDIFKLDAPDIGELFHAALKRI
ADDB_BACC7      RDLYGDKI---KGSVSRMELFNRCAYAHFAQHGLSLRERDIFKLDAPDIGELFHAALKRI
ADDB_BACCQ      RDLYGDKI---KGSVSRMELFNRCAYAHFAQHGLSLRERDIFKLDAPDIGELFHAALKRI
ADDB_BACC1      RDLYGDKI---KGSVSRMELFNRCAYAHFAQHGLSLRERDIFKLDAPDIGELFHAALKRI
ADDB_BACAH      RDLYGDKI---KGSVSRMELFNRCAYAHFAQHGLSLRERDIFKLDAPDIGELFHAALKRI
ADDB_BACC4      RDLYGDII---KGSVSRMELFNRCAYAHFAQHGLSLRERDIFKLDAPDIGELFHAALKKI
ADDB_BACCR      RDLYGDII---KGSVSRMELFNRCAYAHFAQHGLSLRERDIFKLDAPDIGELFHAALKKI
ADDB_BACC2      RDLYGDII---KGSVSRMELFNRCAYAHFAQHGLSLRERDIFKLDAPDIGELFHAALKKI
ADDB_BACMK      RDLYGDTI---KGSVSRMELFNRCAYAHFAQHGLSLRERDIFKLDAPDIGELFHAALKRI
ADDB_BACCN      RILYGDKI---KGSVSRMELFNRCAYAHFAQHGLSLRERDIFKLDAPDIGELFHAALKKI
ADDB_BACSU      RQLYGERI---QGSVSRMETFNACPFSHFASHGLHLKERQFFKLEAPDIGQLFHSSLKLI
ADDB_BACVZ      RQLYGEHI---KGSVSRMEAFNACQFSHFASHGLQLKERQFFKLDAPDIGQLFHSSLKLI
ADDB_BACLD      RDLYGEHI---QGSVSRMETFKACPFSHFASHGLKLKERQFFKLEAPDIGQLFHSALKLI
ADDB_BACP2      KELYGDHI---QGSVSRMEKFNACAFSHFASHGLKLKDRQFYKLEAPDIGQLFHSALKHI
ADDB_GEOKA      QRLYGKKI---QASVSRMEQFQKCPYAHFASHGLRLKERNVFRLEAPDVGQLFHAAIKQI
ADDB_GEOTN      RRLYGKKI---QASVSRMEQFQKCPYAHFASHGLRLKERNVFRLEAPDVGQLFHAAIKQI
ADDB_ANOFW      KELYGKKV---KASISRMETFNRCPFAHFAAHGLKLKERTVFQLKAPDMGQLFHQALKVI
ADDB_OCEIH      EQLYPKRI---QASVSRLETYYRCSYQHFAKYSLNLEERRTYKLDAPDIGQLFHEALKKI
ADDB_DESHY      RQLYGKRL---VTSVSRLELFARCPFAHFAQYGLKLKERSNYRLSPPDMGQFFHAVLHDY
ADDB_DESHD      RQLYGKRL---VTSVSRLELFARCPFAHFAQYGLKLKERSNYRLSPPDMGQFFHAVLHDY
ADDB_SYMTH      RLLYGDRL---VTSVSRLEAFLSCPFRHFAGYALRLQGRAEFTVSAPEFGLFYHAALSLF
ADDB_MOOTA      RGLYPRPL---RLSISQLETFAGCPFRYFLSYGLGLQERRLYQVDPAGMGQFYHAALKLF
ADDB_DESAP      PELYGSRL---VVSVSRLEEFRGCPFAHFARYALRLKERDVCRLAAPDIGLFFHAALKTF
ADDB_DESRM      RRLYGSRL---RASVSRLERFTTCPFSHFLSHGLKLKERSQFKLAAPDLGQFFHAALKLF
ADDB_PELTS      MALYGRPL---RASVSGLEKFRACPFAHFLSYGLKLKERAIFKLDAPDLGRFFHAALKLF
ADDB_HELMI      RRLFGDPL---RASVSRIERFLACPFSHFISHGLRLKERRIFRLAAPDLGEFFHAALKQF
ADDB_NATTJ      DKLYPNKI---ATSVSGLESFCQCPFRHFAEQNLRLKEREYFRLEPASLGLFYHAGLKLF
ADDB_ALKMQ      KSLYDNPI---KSSVSRLERFANCPFSHFVTYGLRPKERKEYQLSNPDIGRLFHDSMEQF
ADDB_ALKOO      RSLYEHPI---KSSVSRLERFANCPFSHFVTYGLRPKERKEYQLSNPDIGRLFHDSMENF
ADDB_CLOPE      KKLYEDNKNKISLSVSRLERYAQCPFAYYIQYGLKAKDRKIYEFTAPDLGSFMHEILDEF
ADDB_CLOP1      KKLYEDNKNKISLSVSRLERYAQCPFAYYIQYGLKAKDRKIYEFTAPDLGSFMHEILDEF
ADDB_CLOPS      KKLYEDNKNKISLSVSRLERYAQCPFAYYIQYGLKAKDRKIYEFTAPDLGSFMHEILDEF
ADDB_CLOBB      LSLYKNDLGKLSFSVSRLEKYAECPFSYFIQYGLKAKNRKVYEFTPPDLGSFVHDILDSF
ADDB_CLOBA      LSLYKNDLGKLSFSVSRLEKYAECPFSYFIQYGLKAKNRKVYEFTPPDLGSFVHDILDSF
ADDB_CLOB8      RKLYQNDLEKLVFSVSKLEKYAECPFSYFVQYGLKAKNRKVYEFTPPDLGSFVHEMLDSF
ADDB_THEP3      KRLYKDEI---NFSVSRLEKYAACPFAYFVQYGLKAKERKIYSFDPPDLGIFMHNVLNEV
ADDB_THEPX      KRLYKDEI---NFSVSRLEKYAACPFAYFVQYGLKAKERKIYSFDPPDLGIFMHNVLNEV
ADDB_CALS4      KKLYGEEM---EFSVSRLEKYAACPFAYFVQYGLKAKERKIYGFEPPDLGIFMHNVLNEI
ADDB_CLOD6      RSLYKSN----SLSISRLEKYAECPFAYFIQYGLKAKKRKEYSFTPPDLGTFIHNILDRF
ADDB_HUNT2      AALYGEPA---VSSVSRLEKYTACPFAFYVQYGLGAKERQIYSLRPPDVGTFMHAVIEKF
ADDB_RUMCH      RELYGKSP---YFTVSRLEKYTSCPFAFYVQYGLGARERKIYRMSPPDVGTFMHAVIERF
ADDB_CLOBK      RNLYGKPL---KISVSRVEKFSQCPFAYFVQYGLKAKDRKIFNLSYPDLGIFMHSILEKF
ADDB_CLOBL      RNLYGKPL---KISVSRVEKFSQCPFAYFVQYGLKAKDRKIFNLSYPDLGIFMHSILEKF
ADDB_CLOBH      RNLYGKPL---KISVSRVEKFSQCPFAYFVQYGLKAKDRKIFNLSYPDLGIFMHSILEKF
ADDB_CLOB1      RNLYGKPL---KISVSRVEKFSQCPFAYFVQYGLKAKDRKIFNLSYPDLGIFMHSILEKF
ADDB_CLOBM      RNLYGKPL---KISVSRVEKFSQCPFAYFVQYGLKAKDRKIFNLSYPDLGIFMHSILEKF
ADDB_CLOK1      RRLYGKHL---NMSVSRLEKFAQCPFGYFVQYGLKVKDRKMYSLSAPDLGSFMHGILERF
ADDB_CLOTE      RKLYGSKL---NMSVSRLEKFSQCPFAYFIRYGMNAKERKIYKVSTPDIGTLMHDVVESF
ADDB_CLONN      RKMYGNKL---YLTVSRLEKYAQCPFGYYIKYGLKAKERKIFALTPPDLGTFMHNVIDEF
ADDB_CLOAB      LKLYGGSL---KMSVSRLEKYIECPFSYYVQYGLNIKDRKIFSLTPPDLGSFMHKVIDRF
ADDB_LACP7      RKLYGETL---LGSVTRMEKYAACAFAHFLQYGLSLEERQEYKISMPDIGSLFHEALERF
                  ::         ::: .* :  * : .:    :  . *    .    .* : *  :   

ADDB_STAEQ      SDRIYGD---FKNLDTKNIQSLTKEALELILPKVQFNLLNSSAYYKYLSKKIGSIVETTL
ADDB_STAES      SDRIYGD---FKNLDTKNIQSLTKEALELILPKVQFNLLNSSAYYKYLSKKIGSIVETTL
ADDB_STAAB      SERINGD---FKQLDLKKIRQLTNEALEEILPKVQFNLLNSSAYYRYLSRRIGAIVETTL
ADDB_STAAR      SERINGD---FKQLDLKKIRQLTNEALEEILPKVQFNLLNSSAYYRYLSRRIGAIVETTL
ADDB_STAAW      SERINGD---FKQLDLKKIRQLTNEALEEILPKVQFNLLNSSAYYRYLSRRIGAIVETTL
ADDB_STAAS      SERINGD---FKQLDLKKIRQLTNEALEEILPKVQFNLLNSSAYYRYLSRRIGAIVETTL
ADDB_STAA1      SERINGD---FKQLDLKKIRQLTNEALEEILPKVQFNLLNSSAYYRYLSRRIGAIVETTL
ADDB_STAA2      SERINGD---FKQLDLKKIRQLTNEALEEILPKVQFNLLNSSAYYRYLSRRIGAIVETTL
ADDB_STAA9      SERINGD---FKQLDLKKIRQLTNEALEEILPKVQFNLLNSSAYYRYLSRRIGAIVETTL
ADDB_STAAM      SERINGD---FKQLDLKKIRQLTNEALEEILPKVQFNLLNSSAYYRYLSRRIGAIVETTL
ADDB_STAAN      SERINGD---FKQLDLKKIRQLTNEALEEILPKVQFNLLNSSAYYRYLSRRIGAIVETTL
ADDB_STAA3      SERINGD---FKQLDLKKIRQLTNEALEEILPKVQFNLLNSSAYYRYLSRRIGAIVETTL
ADDB_STAA8      SERINGD---FKQLDLKKIRQLTNEALEEILPKVQFNLLNSSAYYRYLSRRIGAIVETTL
ADDB_STAAT      SERINGD---FKQLDLKKIRQLTNEALEEILPKVQFNLLNSSAYYRYLSRRIGAIVETTL
ADDB_STAAC      SERINGD---FKQLDLKKIRQLTNEALEEILPKVQFNLLNSSAYYRYLSRRIGAIVETTL
ADDB_STAAE      SERINGD---FKQLDLKKIRQLTNEALEEILPKVQFNLLNSSAYYRYLSRRIGAIVETTL
ADDB_STAHJ      SDKVDGD---FKNLDNKKIHALTVEALENVLPQVQFNLMDSNAYYRYVSKRIGVIVESTL
ADDB_STAS1      SEKVNGD---FKNLNPKQIHKLTTEALSEILPEVQFNLLNSTAYYRYLSQRIGAIVETTL
ADDB_STACT      ADKIHGD---FRNLTDASIRKLTQEALENILPEVQYNLLNSSAYYRYMSVRIGAIVQSTL
ADDB_EXIS2      SMNIKASGKRWRELDDQSCSNLAKEAVEKVTPEIQNAILMSSNRFGYIKKKLTDVVEQTA
ADDB_LISMH      SAELKRNNLDWGNLTEEECKQMAKLAMTFLAPKIQHEILLSSKRMEYIQYKLLQIITRAT
ADDB_LISMO      SAELKRNNLDWGNLTEEECKQMAKLAMTFLAPKIQHEILLSSKRMEYIQYKLLQIITRAT
ADDB_LISMF      SAELKRNNLDWGSLTDQECRQMAKLAMTFLAPKIQHEILLSSKRMEYIQYKLLQIITRAT
ADDB_LISIN      SAELKRTNRDWGNLTEEECRQMAKLAMTFLAPKIQHEILLSSKRMEYIQYKLLQIITRAT
ADDB_LISW6      SAELKRNNQDWGNLTEEECRQMAKLAMTFLAPKIQHEILLSSKRMEYIQYKLLQIITRAT
ADDB_LYSSC      TEETHRLQLSWIRLTKQQIKQLARQAVEQIVPVFSHQILLSSARYRYIQRKLIRIVERTM
ADDB_BACHK      ADRLLRENRTWADLSIKECEHLSTVVIEEIAPLLQRQILLSSNRHFYLKQKLQQIIFRTS
ADDB_BACCZ      ADRLLRENRTWADLSIKECEHLSTVVIEEIAPLLQRQILLSSNRHFYLKQKLQQIIFRTS
ADDB_BACAN      ADRLLRENRTWADLSIKECEHLSAVVIEEIAPLLQRQILLSSNRHFYLKQKLQQIIFRTS
ADDB_BACC0      ADRLLRENRTWADLSIKECEHLSAVVIEEIAPLLQRQILLSSNRHFYLKQKLQQIIFRTS
ADDB_BACC7      ADRLLRENRTWADLSIKECEHLSAVVIEEIAPLLQRQILLSSNRHFYLKQKLQQIIFRTS
ADDB_BACCQ      ADRLLRENRTWADLSIKECEHLSAVVIEEIAPLLQRQILLSSNRHFYLKQKLQQIIFRTS
ADDB_BACC1      ADRLLRENRTWADLSIKECEHLSAVVIEEIAPLLQRQILLSSNRHFYLKQKLQQIIFRTS
ADDB_BACAH      ADRLLRENRTWADLSIKECEHLSTVVIEEIAPLLQRQILLSSNRHFYLKQKLQQIIFRTS
ADDB_BACC4      ADKLLRENRTWADLSIKECEHLSVLVIEEIAPLLQRQILLSSNRHFYLKQKLQQIIFRTS
ADDB_BACCR      ADKLLRENRTWADLSIKECEHLSVLVIEEIAPLLQRQILLSSNRHFYLKQKLQQIIFRTS
ADDB_BACC2      ADKLLRENRTWSDLSIKECEHLSVLVIEEIAPLLQRQILLSSNRHFYLKQKLQQIIFRTS
ADDB_BACMK      ADKLLRENRTWADLSIKECEHLSALVIEEIAPLLQRQILLSSNRHFYLKQKLQQIIFRTS
ADDB_BACCN      ADKLLREKRTWADLSIKECEHLSILVIEEIAPLLQRQILLSSNRHAYLKQKLQQIIFRTS
ADDB_BACSU      SDRLREQKLDWRDLTKEQCELFSYDAVERLAPKLQKEILLSSNRHYYVKEKLQKIVTRVS
ADDB_BACVZ      SDRLREQKLEWRDLTKDQCRNFSYEAVERLAPKLQKEILLSSNRHFYVKEKLQKIVTRVS
ADDB_BACLD      SDRLHELKLDWRDLTKAQCETLSSDAVERLAPKLQKEILLSSNRHHYVKQKLQKIIARVS
ADDB_BACP2      SDTLVEQKKDWKNLTKEDCVTYSRHAIEQLAPRLQKEILLSSNRHAYIKEKLQKILIRVS
ADDB_GEOKA      ADRLREQHLDWRELSRPDCERLSAEAVERIAPLIQQQVLSSSHRYEYMKRKLKHVVARTT
ADDB_GEOTN      ADRVREQHLDWKQLSRSECERLSAEAVERIAPLIQQQVLSSSNRYEYMKRKLKNVVARTT
ADDB_ANOFW      ADRLRQEQLPWSQLSKQQCEQLSYEAVEQIAPYIQQEVLLSTHRYRYMKKKLQTIMTKAT
ADDB_OCEIH      TEWIHAEGNDFSALTKSQSSHYANRAVTELSPVLQHQILHSSNRYAYIQKKLEEVIARAT
ADDB_DESHY      AIALRERGLDWGELSKEQSWQLVNETAEPIALQLQNKILLSNARYRYLTHKLKRTVHHAV
ADDB_DESHD      AIALRERGLDWGELSKEQSWQLVNETAEPIALQLQNKILLSNARYRYLTHKLKRTVHHAV
ADDB_SYMTH      VRELERDGLAWDTLTPDEAWRRMDSIIDRLAPRLQSEILLSSPQHRYLLRVIRRTLQSSL
ADDB_MOOTA      VEELGRRGLDWGRLSDNEAAAIISQVVDSLAPALQHEILSSSARYGYLRKKLEQTLQRVM
ADDB_DESAP      EDRLREAGMEWDALESADCTRLASAVVEELAPQLQSEVLLSSPRLRFLTGKLERVVERTA
ADDB_DESRM      AERIKALSLDWGQLSRGQIITITGEIVEELAPQLQNEILLSTARHRYLIKKLRRTLERAV
ADDB_PELTS      GDRVREQGLDWGQLDREQCQEMAGEVVDLLAPRLSSEILLSTARRRYLTGKLRRTVQRAA
ADDB_HELMI      GERLRRDRLDWGALPREELFRLTGEVVSDLAPQLQNEILLSTARHRYLTGRLQQTLSRAV
ADDB_NATTJ      WDKLQENNLTWHKLKTEEREALVSEIVEVLSERLKNRILLASERYKYFKKKLHELLSRAV
ADDB_ALKMQ      TKEMVNEEIQWKDLTKEKNDELVEKVIDEMVPDFEHGIMLSTHRYQYLVTRLKRISKRAM
ADDB_ALKOO      TKELVNEQIQWKDLTREQSDYFVEKVIDEMVPEFEHGIMLSTHRYQYLVTRLKRISKRAM
ADDB_CLOPE      TNEIKEKDLKWSDLSKENCRNIINSLVDNQVKNNKSSILNSSKRYSYFTDRFKRILTKSV
ADDB_CLOP1      TNEIKEKDLKWSDLSKENCRNIINSLVDNQVKNNKSSILNSSKRYSYFTDRFKRILTKSV
ADDB_CLOPS      TNEIKEKDLKWSDLSKENCKNIINSLVDNQVKNNKSSILNSSKRYSYFTDRFKRILTKSV
ADDB_CLOBB      TNKVKKEKIAWSDLDMIKCKNIVSELIDTKLKEDSGSILNSTNKYKYFSKRFKRVISKSV
ADDB_CLOBA      TNKVKKEKIAWSDLDMIKCKNIVSELIDTKLKEDSGSILNSTNKYKYFSKRFKRVISKSV
ADDB_CLOB8      TNKVREDGVLWSDLSNEKCKEIISNLIDKKLMDESNSILNSTKKFKYLAQRFKRVISKSV
ADDB_THEP3      SKALEKEDKTWEDLDREYCDEVVNIVVDNMLKGVSEHILKSSPRYEYLSKRLTRVLSNAV
ADDB_THEPX      SKALEKEDKTWEDLDREYCDEVVNIVVDNMLKGVSEHILKSSPRYEYLSKRLTRVLSNAV
ADDB_CALS4      AKALEKEELTWQEIDKEWCNDAVDIIVEEMVDKIPGYILKSSSRYRYLANRLKRVLSKAV
ADDB_CLOD6      SKELLQDNLTWRDIDEKYIELKIGIIVDEIILKIPGYILNSSERYKYLAYRLKNMLTTAI
ADDB_HUNT2      SRMVAKRNISWRDLDRDWCSEKVSEIVDEMLEKMQGSGIAASRRYTALTLRLKRVVARAV
ADDB_RUMCH      SKMVDENNYSWREFDRQWCSEQVSKIVDELLDSMKNTILGGSKRFKALAVRLKRVVTRAV
ADDB_CLOBK      SHELEKKGLEWGTMDLNWAEEEIDKLINEELDNKSLDILNSSKRYEYVTKSVKKILKRSI
ADDB_CLOBL      SHELEKKGLEWDTMDLNWAEEEIDKLINEELDNKSLDILNSSKRYEYVTKSVKKILKRSI
ADDB_CLOBH      SHELEKQGLEWDTMDLNWAEEEIDKLINEELDNKSLDILNSSKRYEYVTKSVKKILKRSI
ADDB_CLOB1      SHELEKQGLEWDTMDLNWAEEEIDKLINEELDNKSLDILNSSKRYEYVTKSVKKILKRSI
ADDB_CLOBM      SHELEKKGIDWDTMDLNWAEEEIDKLINEELDNKSLDILNSSKRYEYVTKSVKKILKRSI
ADDB_CLOK1      SIGLKQKSLTWENVDERCCEENINDLVDNVLYDNPNSILNSSKKYKHVTDKLKKTLTRSV
ADDB_CLOTE      SRHIEGKNISWEEIDRELCESFVSTMVDEKIKDMKGSILNSSPRYKHMTNRIKDILSKSM
ADDB_CLONN      SEVVDKSGFKWYEIEDKWCKDTVSEIVDRKAEESAGGIFTSSARYKYFTERLKRVLIKTI
ADDB_CLOAB      CETIKEENIDWNEVNDHICEEKIYKIVDQEIEGRGGSILNSSPRYSYIALRLKRILKRTV
ADDB_LACP7      SKALKELDISWHELPEDVRISLGERCVREAVENFGNGILESSKRSAYLATRVERILQRTT
                          :  .                        : ..     .   .        

ADDB_STAEQ      KALKYQGEYSKFVPQRFETGFRKSPKNKGELVAQPLITNQG--IPINIRGQIDRIDTYT-
ADDB_STAES      KALKYQGEYSKFVPQRFETGFRKSPKNKGELVAQPLITNQG--IPINIRGQIDRIDTYT-
ADDB_STAAB      SALKYQGTYSKFMPKHFETSFRRKPRTNDELIAQTLTTTQG--IPINIRGQIDRIDTYT-
ADDB_STAAR      SALKYQGTYSKFMPKHFETSFRRKPRTNDELIAQTLTTTQG--IPINIRGQIDRIDTYT-
ADDB_STAAW      SALKYQGTYSKFMPKHFETSFRRKPRTNDELIAQTLTTTQG--IPINIRGQIDRIDTYT-
ADDB_STAAS      SALKYQGTYSKFMPKHFETSFRRKPRTNDELIAQTLTTTQG--IPINIRGQIDRIDTYT-
ADDB_STAA1      SALKYQGTYSKFMPKHFETSFRRKPRTNDELIAQTLTTTQG--IPINIRGQIDRIDTYT-
ADDB_STAA2      SALKYQGTYSKFMPKHFETSFRRKPRTNDELIAQTLTTTQG--IPINIRGQIDRIDTYT-
ADDB_STAA9      SALKYQGTYSKFMPKHFETSFRRKPRTNDELIAQTLTTTQG--IPINIRGQIDRIDTYT-
ADDB_STAAM      SALKYQGTYSKFMPKHFETSFRRKPRTNDELIAQTLTTTQG--IPINIRGQIDRIDTYT-
ADDB_STAAN      SALKYQGTYSKFMPKHFETSFRRKPRTNDELIAQTLTTTQG--IPINIRGQIDRIDTYT-
ADDB_STAA3      SALKYQGTYSKFMPKHFETSFRRKPRTNDELIAQTLTTTQG--IPINIRGQIDRIDTYT-
ADDB_STAA8      SALKYQGTYSKFMPKHFETSFRRKPRTNDELIAQTLTTTQG--IPINIRGQIDRIDTYT-
ADDB_STAAT      SALKYQGTYSKFMPKHFETSFRRKPRTNDELIAQTLTTTQG--IPINIRGQIDRIDTYT-
ADDB_STAAC      SALKYQGTYSKFMPKHFETSFRRKPRTNDELIAQTLTTTQG--IPINIRGQIDRIDTYT-
ADDB_STAAE      SALKYQGTYSKFMPKHFETSFRRKPRTNDELIAQTLTTTQG--IPINIRGQIDRIDTYT-
ADDB_STAHJ      KALRYQNKNTKFKPQRFEAGFRKTPNNSEELIAQPLITKQG--IPVNIRGQIDRIDAYT-
ADDB_STAS1      TALKYQGSHTKFTPQRFEASFRRKPKDQSELLATPLQTKQG--IPINIRGQIDRIDTYQ-
ADDB_STACT      TALKYQGTFSKFRPQAFEKSFRKNPKSNEQLAAESLYTSQG--ISINIRGQIDRIDTFN-
ADDB_EXIS2      KMLVKQAERSEFEPDLFEISF-----GNAMFPPLRFTLPDG--TEIEFTGRIDRVDQAT-
ADDB_LISMH      TVLNEQAKSSAFRPVGLEVDFG----LKGDIPPLKIPLQSD--SELLLQGRIDRIDMAE-
ADDB_LISMO      TVLNEQAKSSAFRPVGLEVDFG----LKGDIPPLKIPLQSD--SELLLQGRIDRIDMAE-
ADDB_LISMF      TVLNEQAKSSAFRPVGLEVDFG----LKGDIPPLKISLQAN--SELLLQGRIDRIDMAE-
ADDB_LISIN      TVLNEQAKSSAFRPIGLEVDFG----LKGDIPPLKIPLQSD--SELLLQGRIDRIDAAE-
ADDB_LISW6      TVLNEQAKSSAFRPIGLEVDFG----LKGDIPSLKIPLKSE--SELLLQGRIDRIDVAE-
ADDB_LYSSC      MALTQHANVSHFKPIAIEASFGP--GQHEQLPPLEIDLTSG--KKMFMRGRIDRIDSAT-
ADDB_BACHK      IILREHAKSSGFVPVDLEVPFGM--GGTGSLPPMEFSLPNG--VKMEVVGRIDRVDKAE-
ADDB_BACCZ      IILREHAKSSGFVPVDLEVPFGM--GGTGSLPPMEFSLPNG--VKMEVVGRIDRVDKAE-
ADDB_BACAN      IILREHAKSSGFVPVDLEVPFGM--GGTGSLPPMEFSLPNG--VKMEVVGRIDRVDKAE-
ADDB_BACC0      IILREHAKSSGFVPVDLEVPFGM--GGTGSLPPMEFSLPNG--VKMEVVGRIDRVDKAE-
ADDB_BACC7      IILREHAKSSGFVPVDLEVPFGM--GGTGSLPPMEFSLPNG--VKMEVVGRIDRVDKAE-
ADDB_BACCQ      IILREHAKSSGFVPVDLEVPFGM--GGTGSLPPMEFSLPNG--VKMEVVGRIDRVDKAE-
ADDB_BACC1      IILREHAKSSGFVPVDLEVPFGM--GGTGSLPPMEFSLPNG--VKMEVVGRIDRVDKAE-
ADDB_BACAH      IILREHAKSSGFVPVDLEVPFGM--GGTGSLPPMEFSLPNG--VKMEVVGRIDRVDKAE-
ADDB_BACC4      IILREHAKSSGFVPVDLEVPFGM--GGTGSLPPMEFSLPNG--VKMEVVGRIDRVDKAE-
ADDB_BACCR      IILREHAKSSGFVPVDLEVPFGM--GGTGSLPPMEFSLPNG--VKMEVVGRIDRVDKAE-
ADDB_BACC2      IILREHAKSSGFVPVDLEVPFGM--GGTGSLPPMEFSLPNG--VKMEVVGRIDRVDKAE-
ADDB_BACMK      LILREHAKSSGFVPVDLEVPFGM--GGTGSLPPMEFALPNG--VKMEVVGRIDRVDKAE-
ADDB_BACCN      LVLREHAKASGFVPVDLEVPFGM--GGKDSLPPMEFTLSNG--VKMEVVGRIDRVDKAE-
ADDB_BACSU      GILSEHAKASGFVPIGLELGFG----GKGPLPPLTFQLKNG--CTMELVGRIDRVDKAE-
ADDB_BACVZ      GILSEHAKASGFVPVGLELGFG----GSGPLPPLTFTLKNG--CTMELVGRIDRVDKAE-
ADDB_BACLD      GILSEHAKASGFAPVGIELGFG----GKGPLPPMRFTLKNG--CTMELVGRIDRVDKAE-
ADDB_BACP2      SILSEHAKVSGFSPVGLELGFG----GQGPLPPFTFQLKNG--CTMELVGRIDRVDKAE-
ADDB_GEOKA      HVLSEHARASGFVPIGLELSFG----PNGDLPPLRFRLPDG--TVMELVGRIDRVDKAE-
ADDB_GEOTN      HVLSEHARASGFAPVGFELSFG----PGGDLPPLRFQLRDG--TVMELVGRIDRVDKAE-
ADDB_ANOFW      TVLSEHAKRSGFVPIGVELGFG----DGEPLPPLTFTLSDG--TVLQFVGRIDRVDQAM-
ADDB_OCEIH      FVLGEQARLSHFSPVGLELGFG---DGNNQIPSLSMLLENG--YELVLRGRIDRVDKAE-
ADDB_DESHY      RVLGEHARQGVFLPMELEVKFGPQ----EALPPLEVPLSGG--NSLLLRGQIDRIDGAV-
ADDB_DESHD      RVLGEHARQGVFLPMELEVKFGPQ----EALPPLEVPLSGG--NSLLLRGQIDRIDGAV-
ADDB_SYMTH      DYLSEHVLHGEFRPVAVEVPFGEEM---DGLPPVEVDLPGG--GRVLLRGRIDRVDALEG
ADDB_MOOTA      EVLNEHARRGEFRPLAVETSFGCR----GKLPPLQLDAGPG--RRVFLEGRVDRIDVAR-
ADDB_DESAP      GVMAAHARHSRFQPVAVEVAFGPG----RDVPGPAYPLPGG--GSVELAGRIDRVDVAH-
ADDB_DESRM      VTLAEHARRGSFRPVAVEIGFGDN----AELPAVQLDLADH--CQMEMAGRIDRIDSAC-
ADDB_PELTS      LVLAEHSRRSKFRPVGLELSFGPD----GDLPAPVFTLADG--SEMAVSGRIDRIEAAP-
ADDB_HELMI      IVLGEHARRGQFRPLALEVGFGPE----ELLPPVQVPLTGG--RWMDLVGRIDRIDGFF-
ADDB_NATTJ      EVLSWYSDDKGFYPVGSEIGFGKD----EPLSTLELELPSFPNKKVQLKGRIDRIDTGK-
ADDB_ALKMQ      WTLTDHVKKGEFVPMGHEIIFGLE----GDVPPIIIELANG--EKIYLEGRIDRVDLLND
ADDB_ALKOO      WTLTEHIKKGQFVPMGHEIIFGLE----GDIPPIVIELESG--EKIYLEGRIDRVDILND
ADDB_CLOPE      MVISEQMKRSDFEIYKNELAFGFS----KDVNSIKLDLPSG--ESFYLNGRIDRVDKLNL
ADDB_CLOP1      MVISEQMKRSDFEIYKNELAFGFS----KDVNSIKLDLPSG--ESFYLNGRIDRVDKLNL
ADDB_CLOPS      MVISEQMKRSDFEIYKNELAFGFS----KDVNSIKLDLPSG--ESFYLNGRIDRIDKLNL
ADDB_CLOBB      SVISEQMRRGEFEVFNNEFSFGSY----NDGEAIVLELPSN--EKVYLNGRIDRIDTLDL
ADDB_CLOBA      SVISEQMRRGEFEVFNNEFSFGSY----NDGEAIVLELPSN--EKVYLNGRIDRIDTLDL
ADDB_CLOB8      SVIASQIGKGEFEVFKTEFDFGSY----SSGEAITLDLNDN--EKVYLQGRIDRIDKLDL
ADDB_THEP3      WVISEHIKRSSFIPSGHEVAFGEN----QMYPPIKIILSNG--EEINLIGRIDRVDVFEK
ADDB_THEPX      WVISEHIKRSSFIPSGHEVAFGEN----QMYPPIKIILSNG--EEINLIGRIDRVDVFEK
ADDB_CALS4      WIISEHMKRSSFVPLGHEVAFGEN----QKYPPIKIVLSNG--EEIKLIGRIDRVDVLEK
ADDB_CLOD6      TIISQQIKQGSFEPIDYEVKFGDN----GKYPPIKMVLENG--QEVSLIGQIDRVDEFEE
ADDB_HUNT2      WLIAEHIRRSSFEPVAYEVGFGEN----GKYPPIVIELDSG--EKIHLTGRIDRVDALKT
ADDB_RUMCH      WLITEHIRRSSFEPVGYEVDFGDG----GAYPPMVIELDSG--EKIRLVGRIDRIDALRA
ADDB_CLOBK      WLIGEHIKRGNFKPSYYELSFDID----GDYPPIAMELHSG--EVINLIGRVDRVDLLQK
ADDB_CLOBL      WLIGEHIKRGNFKPSYYELSFDID----GDYPPIAMELHSG--EVINLIGRVDRVDLLQK
ADDB_CLOBH      WLIGEHIKRGNFKPSYYELSFDID----GDYPPIAMELHSG--EVVNLIGRVDRVDLLQK
ADDB_CLOB1      WLIGEHIKRGNFKPSYYELSFDID----GDYPPIAMELHSG--EVVNLIGRVDRVDLLQK
ADDB_CLOBM      WLIGEHIKRGNFKPSYYELSFDID----GDYPPIAMELHSG--EVVNLIGRVDRVDLLQK
ADDB_CLOK1      WLIAQHMKKGRFIPRAYELVFGEI----GDFPPISIELDSG--EKVSLTGKVDRVDTAKE
ADDB_CLOTE      EVISQQISRGDFKPSAYELAFGFN----GDFPPISIELSSG--EKVNLIGRIDRVDKLEN
ADDB_CLONN      LVIIEHLKRSGFQPIGHEVGFGND----EKYPPIEIELSSG--EKVKLIGRIDRVDKLDM
ADDB_CLOAB      RIVAEQFKRGSFKPVGYEVSFENG----GSYPPITVGLNDG--SEVVLTGRIDRIDMMEK
ADDB_LACP7      KTLTHQLQQGVFEPGSYEQYFSHA------------------DRYLNLRGRIDRVDLYE-
                  :        *     *  *                        . . *::**::    

ADDB_STAEQ      KGDHSYVNIIDYKSSESSATLDLTKVYYGLQMQMMTYMDIVLQ-NKERLGL--TDIVK--
ADDB_STAES      KGDHSYVNIIDYKSSESSATLDLTKVYYGLQMQMMTYMDIVLQ-NKERLGL--TDIVK--
ADDB_STAAB      KNDTSFVNIIDYKSSEGSATLDLTKVYYGMQMQMMTYMDIVLQ-NKQRLGL--TDIVK--
ADDB_STAAR      KNDTSFVNIIDYKSSEGSATLDLTKVYYGMQMQMMTYMDIVLQ-NKQRLGL--TDIVK--
ADDB_STAAW      KNDTSFVNIIDYKSSEGSATLDLTKVYYGMQMQMMTYMDIVLQ-NKQRLGL--TDIVK--
ADDB_STAAS      KNDTSFVNIIDYKSSEGSATLDLTKVYYGMQMQMMTYMDIVLQ-NKQRLGL--TDIVK--
ADDB_STAA1      KNDTSFVNIIDYKSSEGSATLDLTKVYYGMQMQMMTYMDIVLQ-NKQRLGL--TDIVK--
ADDB_STAA2      KNDTSFVNIIDYKSSEGSATLDLTKVYYGMQMQMMTYMDIVLQ-NKQRLGL--TDIVK--
ADDB_STAA9      KNDTSFVNIIDYKSSEGSATLDLTKVYYGMQMQMMTYMDIVLQ-NKQRLGL--TDIVK--
ADDB_STAAM      KNDTSFVNIIDYKSSEGSATLDLTKVYYGMQMQMMTYMDIVLQ-NKQRLGL--TDIVK--
ADDB_STAAN      KNDTSFVNIIDYKSSEGSATLDLTKVYYGMQMQMMTYMDIVLQ-NKQRLGL--TDIVK--
ADDB_STAA3      KNDTSFVNIIDYKSSEGSATLDLTKVYYGMQMQMMTYMDIVLQ-NKQRLGL--TDIVK--
ADDB_STAA8      KNDTSFVNIIDYKSSEGSATLDLTKVYYGMQMQMMTYMDIVLQ-NKQRLGL--TDIVK--
ADDB_STAAT      KNDTSFVNIIDYKSSEGSATLDLTKVYYGMQMQMMTYMDIVLQ-NKQRLGL--TDIVK--
ADDB_STAAC      KNDTSFVNIIDYKSSEGSATLDLTKVYYGMQMQMMTYMDIVLQ-NKQRLGL--TDIVK--
ADDB_STAAE      KNDTSFVNIIDYKSSEGSATLDLTKVYYGMQMQMMTYMDIVLQ-NKQRLGL--TDIVK--
ADDB_STAHJ      KDDKSYINIIDYKSSNPSAKLDLKKVYYGKQMQMMTYMDIALQ-NAQRLGL--SNEIK--
ADDB_STAS1      QGDESFVNIIDYKSSKYSGTLDLTKVYYGLQMQMMTYMDIVLQ-NKSRLGL--TDMTK--
ADDB_STACT      SKDRSFVNIIDYKSSGYSGTLDLTKVYYGLQMQMMTYMDVVLQ-NKERLNL--AETTE--
ADDB_EXIS2      IGDQLYVRIVDYKSS--AKELDFAEIYYGLAIQMLLYLKTVVE-QSE-VLF--NQQAK--
ADDB_LISMH      QDDRTFLRIIDYKSS--SHDLALTEVYYGLALQMLTYLDIVVTNAQKMI----GKTAE--
ADDB_LISMO      QDDRTFLRIIDYKSS--SHDLALTEVYYGLALQMLTYLDIVVTNAQKMI----GKTAE--
ADDB_LISMF      QEDRTFLRIIDYKSS--SHDLALTEVYYGLALQMLTYLDIVVTNAQKMI----GKTAE--
ADDB_LISIN      QDDRTFLRIIDYKSS--SHDLALTEVYYGLALQMLTYLDIVVTNAQKMI----GKTAE--
ADDB_LISW6      QDDRTFLRIIDYKSS--SHDLALTEVYYGLALQMLTYLDIVVTNAQKMI----GKTAE--
ADDB_LYSSC      IDDRSYLRIVDYKSS--ARDLDLNEVYYGLSLQVLTYLDVAMENSTYWL----PGETE--
ADDB_BACHK      DENGTFLRIIDYKSS--SKALDLTEVYYGLALQMLTYLDVVTSNAHTWMKK--GHAAS--
ADDB_BACCZ      DENGTFLRIIDYKSS--SKALDLTEVYYGLALQMLTYLDVVTSNAHTWMKK--GHAAS--
ADDB_BACAN      DENGTFLRIIDYKSS--SKALDLTEVYYGLALQMLTYLDVVTSNAQTWMKK--GGTAS--
ADDB_BACC0      DENGTFLRIIDYKSS--SKALDLTEVYYGLALQMLTYLDVVTSNAHTWMKK--GGTAS--
ADDB_BACC7      DENGTFLRIIDYKSS--SKALDLTEVYYGLALQMLTYLDVVTSNAHTWMKK--GGTAS--
ADDB_BACCQ      DENGTFLRIIDYKSS--SKALDLTEVYYGLALQMLTYLDVVTSNAHTWMKK--GGTAS--
ADDB_BACC1      DENGTFLRIIDYKSS--SKALDLTEVYYGLALQMLTYLDVVTSNAHTWMKK--GGTAS--
ADDB_BACAH      DENGTFLRIIDYKSS--SKSLDLTEVYYGLALQMLTYLDVVTSNAQTWMKK--GHAAS--
ADDB_BACC4      DENGTFLRIIDYKSS--SKVLDLTEVYYGLALQMLTYLDVVTSNAQTWMKK--GHAAS--
ADDB_BACCR      DENGTFLRIIDYKSS--SKALDLTEVYYGLALQMLTYLDVVTSNAQTWMKK--GHAAS--
ADDB_BACC2      DENGTFLRIIDYKSS--SKALDLTEVYYGLALQMLTYLDVVTSNAQMWMKK--GQAAS--
ADDB_BACMK      DESGTFLRIIDYKSS--SKALDLTEVYYGLALQMLTYLDVVTSNAHTWMKK--GSTAS--
ADDB_BACCN      DESGTFLRIIDYKSS--SKALDLTEVYYGLALQMLTYLDVVISNAGTWMKQ--GEVAS--
ADDB_BACSU      SSKGLLLRIVDYKSS--DKGLDLAEVYYGLALQMLTYLDLSITHSADWL----GMRAT--
ADDB_BACVZ      SSKGLLLRIVDYKSS--DRGLDLAEVYYGLALQMLTYLDLSITHSEDWL----GMKAT--
ADDB_BACLD      SSKGLLLRIVDYKSS--DKGLDLAEVYYGLALQMLTYLDLSITHSTDWL----GMKAS--
ADDB_BACP2      GSKGLFLRIVDYKSS--EKGLDLAEVYYGLALQMLTYLDLTITYSKEWL----GIEAT--
ADDB_GEOKA      SSQGVLLRIIDYKSS--AKTLDLTEVYYGLALQMLTYLDIVLTYAEQLV----GQPAL--
ADDB_GEOTN      SSQGVLLRIIDYKSS--AKTLDLTEVYYGLALQMFTYLDIVLTYAEQLV----GEPAL--
ADDB_ANOFW      SEQGVLLRVIDYKSK--QKTLDLTEVYYGLALQMLAYLDIVLEYAEKLV----GTSAF--
ADDB_OCEIH      LENNLYLRIIDYKSS--SKGLDLTEVYYGIALQMLAYLDVVLTHSEKWL----GQQAD--
ADDB_DESHY      LGHEIYLRIFDYKSR--EAHVSLNQIYHGLDLQLLAYLDAALQGAQILVSS--SGLAEGS
ADDB_DESHD      LGHEIYLRIFDYKSR--EAHVSLNQIYHGLDLQLLAYLDAALQGAQILVSS--SGLAEGS
ADDB_SYMTH      RDGRWYVRVIDYKSG--RRDLRLGDFYHGLTLQLLLYLMAVVEGGEPLLPG--TRV----
ADDB_MOOTA      RQGRPYLRVIDYKSS--PTTLDLTAVYYGLALQLPLYLRAALDAAPELLGE--AAE----
ADDB_DESAP      TDNAAYLRVIDYKAG--PRSLALDDVYYGLNLQLLVYLEAGLREAAALAGR--ECR----
ADDB_DESRM      EGGQHYYSLIDYKSG--QPDIKLADIVHGLKLQLLTYLDVALRYSKQLTQQ--EAL----
ADDB_PELTS      SDEGVYLRIIDFKSG--KVTVKLTDIYHGLKLQLLAYLDVALEHARTLTGG--NGL----
ADDB_HELMI      VGDASWLRVIDYKSN--RANLKLADIAHGLKLQLLAYLDVALRHGNRLLQG--CALGEDR
ADDB_NATTJ      KDGDLYLRVIDYKGK--SKNLELRDLYYGLDLQLAAYMTVAMRNSDKLTGD--QMF----
ADDB_ALKMQ      EEDGNYVKIIDYKSG--SKEFSLSDVYYGLQIQLMVYLDAILSSEEKKHQVEIH------
ADDB_ALKOO      E-DGNYVKIIDYKSG--SKEFSLSDVYYGFQIQLLVYLDAVLSSQSQKYQAEVH------
ADDB_CLOPE      D-GETYLRIIDYKTG--SKKFDLNKFYNGLQMQLLVYLDALINNSENIVENQAM------
ADDB_CLOP1      D-GETYLRIIDYKTG--SKKFDLNKFYNGLQMQLLVYLDALINNSENIVENQAM------
ADDB_CLOPS      D-GETYLRIIDYKTG--SKKFDLNKFYNGLQMQLLVYLDALINNSENIVENQAM------
ADDB_CLOBB      E-GSTYLRIVDYKTG--NKHFDLNEFYYGLQMQLLVYLDALLKNSEYILKKQAL------
ADDB_CLOBA      E-GSTYLRIVDYKTG--NKHFDLNQFYYGLQMQLLVYLDALIKNSEYILKKQAL------
ADDB_CLOB8      D-GETYIRIIDYKTG--AKKFDLNEIYYGLQVQLLVYLDALIKNSKYILDKQVK------
ADDB_THEP3      G-EESYIRIIDYKSG--NKELKLEDVFYGLELQLLIYLDAILESAD-KENTDIK------
ADDB_THEPX      G-EESYIRIIDYKSG--NKELKLEDVFYGLELQLLIYLDAILESAD-KENTDIK------
ADDB_CALS4      E-GETYVRIIDYKSG--DKTLDLSDVLYGLELQLLVYLDAILESAF-EGKANLS------
ADDB_CLOD6      G-ENKYIRIIDYKSG--NKSISLTEIYYGLQLQLLVYLDAILESAK-DEDMNIN------
ADDB_HUNT2      E-DGTYLRIVDYKSG--GKDFKLSDVFYGLQIQLITYLDALWESGEADENNPVL------
ADDB_RUMCH      E-NGTYLRIVDYKSG--EKDFKLSDVYYGLQMQLITYLDALWEYSDKSNGEKII------
ADDB_CLOBK      D-GATYLKIIDYKSG--IKEFKLSDVYYGLQLQLLIYLDAILTELAERSGINGE------
ADDB_CLOBL      D-GATYLKIIDYKSG--IKEFKLSDVYYGLQLQLLIYLDAILTELAERSGINGE------
ADDB_CLOBH      D-GATYLKIIDYKSG--AKEFKLSDVYYGLQLQLLIYLDAILTELAERSGINGE------
ADDB_CLOB1      D-GATYLKIIDYKSG--AKEFKLSDVYYGLQLQLLIYLDAILTELAERSGINGE------
ADDB_CLOBM      D-GATYLKIIDYKSG--TKEFKLSDVYYGLQLQLLIYLDAILTELAERFGIDGE------
ADDB_CLOK1      D-IITYIRIVDYKSG--TREFKLSDVYYGFQLQLLIYLDAILTEFDKMTKGKSI------
ADDB_CLOTE      E-DGTFIRIIDYKSG--KQDFNLSDIYYGLQIQLLVYLDALLQEIEDSAKKEVN------
ADDB_CLONN      E-KKDYYRIIDYKSG--NKDFSLSDVYYGLQLQLLTYLDAILTNEELKDREEAL------
ADDB_CLOAB      D-GSTYIRIVDYKSG--NKIFKLSDVYYGFDIQLLLYLNAILENENLDEEDKVL------
ADDB_LACP7      QDGKLYVKVIDYKSG--STSFDLMNLYYGLQLQLGVYLSAAMELMKEQYPNHEIH-----
                        :.*:*       . :  .  *  :*:  *:                      

ADDB_STAEQ      ------------------PGGLLYFHVHEPRIKFKSWADIDED-----QFQKDYIKNFKM
ADDB_STAES      ------------------PGGLLYFHVHEPRIKFKSWADIDED-----QFQKDYIKNFKM
ADDB_STAAB      ------------------PGGLLYFHVHEPRIKFKSWADIDED-----KLEQDLIKKFKL
ADDB_STAAR      ------------------PGGLLYFHVHEPRIKFKSWADIDED-----KLEQDLIKKFKL
ADDB_STAAW      ------------------PGGLLYFHVHEPRIKFKSWSDIDED-----KLEQDLIKKFKL
ADDB_STAAS      ------------------PGGLLYFHVHEPRIKFKSWSDIDED-----KLEQDLIKKFKL
ADDB_STAA1      ------------------PGGLLYFHVHEPRIKFKSWSDIDED-----KLEQDLIKKFKL
ADDB_STAA2      ------------------PGGLLYFHVHEPRIKFKSWSDIDED-----KLEQDLIKKFKL
ADDB_STAA9      ------------------PGGLLYFHVHEPRIKFKSWSDIDED-----KLEQDLIKKFKL
ADDB_STAAM      ------------------PGGLLYFHVHEPRIKFKSWSDIDED-----KLEQDLIKKFKL
ADDB_STAAN      ------------------PGGLLYFHVHEPRIKFKSWSDIDED-----KLEQDLIKKFKL
ADDB_STAA3      ------------------PGGLLYFHVHEPRIKFKSWSDIDED-----KLEQDLIKKFKL
ADDB_STAA8      ------------------PGGLLYFHVHEPRIKFKSWSDIDED-----KLEQDLIKKFKL
ADDB_STAAT      ------------------PGGLLYFHVHEPRIKFKSWSDIDED-----KLEQDLIKKFKL
ADDB_STAAC      ------------------PGGLLYFHVHEPRIKFKSWSDIDED-----KLEQDLIKKFKL
ADDB_STAAE      ------------------PGGLLYFHVHEPRIKFKSWSDIDED-----KLEQDLIKKFKL
ADDB_STAHJ      ------------------PGGLLYFHVHDERLSFKDWGELEDDALTQDKLEQAFLKEYKL
ADDB_STAS1      ------------------PGGLLYFHVHEPRIKL-AWNQLSED-----KRDTEFINSFKL
ADDB_STACT      ------------------PGGLLYFHVHEPRVNFANWAEMDED-----KRQEELLKSFKL
ADDB_EXIS2      ------------------PAGALYFHVKNPMMRGDLSADEIER-------NQLLLESYQM
ADDB_LISMH      ------------------PAGVLYFHMHNQYVQAEKELS-DEAIA------KELQKSSKM
ADDB_LISMO      ------------------PAGVLYFHMHNQYVQAEKELS-DEAIA------KELQKSSKM
ADDB_LISMF      ------------------PAGVLYFHMHNQYVQAEKELS-DEAIV------KELQKNSKM
ADDB_LISIN      ------------------PAGVLYFHMHNQYVQAEKELS-DEAIA------RELQKSSKM
ADDB_LISW6      ------------------PAGVLYFHMHNQFVQADKELS-DEAIA------KELQKSSKM
ADDB_LYSSC      ------------------PAGVLYVHVHNPMLKLDKDMT-DSEIE------EDRLKQYKM
ADDB_BACHK      ------------------PAGVLYFHIHNPIVEVKGDAS-EAEIE------KEILKKFKM
ADDB_BACCZ      ------------------PAGVLYFHIHNPIVEVKGDAS-EAEIE------KEILKKFKM
ADDB_BACAN      ------------------PAGVLYFHIHNPIVEVKGDAS-EAEIE------KEILKKFKM
ADDB_BACC0      ------------------PAGVLYFHIHNPIVEVKGDAS-EAEIE------KEILKKFKM
ADDB_BACC7      ------------------PAGVLYFHIHNPIVEVKGDAS-EAEIE------KEILKKFKM
ADDB_BACCQ      ------------------PAGVLYFHIHNPIVEVKGDAS-EAEIE------KEILKKFKM
ADDB_BACC1      ------------------PAGVLYFHIHNPIVEVKGDAS-EAEIE------KEILKKFKM
ADDB_BACAH      ------------------PAGVLYFHIHNPIVEVKGDAS-EAEIE------KEILKKFKM
ADDB_BACC4      ------------------PAGVLYFHIHNPIVEMKGDAS-EAEIE------KEILKKFKM
ADDB_BACCR      ------------------PAGVLYFHIHNPIVEMKGDAT-EAEIE------KEILKKFKM
ADDB_BACC2      ------------------PAGVLYFHIHNPIVEMKGDAS-EAEIE------KEILKKFKM
ADDB_BACMK      ------------------PAGVLYFHIHNPIVEMKGDAS-EEEIE------KEILKKFKM
ADDB_BACCN      ------------------PAGVLYFHIHNPLVEVKGDAS-EEEIE------KEILKKFKM
ADDB_BACSU      ------------------PAGVLYFHIHDPMIQSNLPLG-LDEIE------QEIFKKFKM
ADDB_BACVZ      ------------------PAGVLYFHIHDPMIQASLPMG-LDEIE------QEIFKKFKM
ADDB_BACLD      ------------------PAGVLYFHVHDPMIQASVPLG-LDEIE------KEIFKKFKM
ADDB_BACP2      ------------------PAGILYFHIHDPFIQAPIPLA-EDEIE------QEIFKKFKM
ADDB_GEOKA      ------------------PAGVLYFHIHNPIVQAKQWVDDEVEMA------KKLLEPFRM
ADDB_GEOTN      ------------------PAGVLYFHIHNPIIQAKQWLDNEMEVA------RKLLEPFRM
ADDB_ANOFW      ------------------PAGVLYFPIHNPMMKVNEWLD-EHELE------KKFLEQFKM
ADDB_OCEIH      ------------------PAGVLYFHVHNPMISAKGSMT-EADIE------EELFKQYKM
ADDB_DESHY      KGSEGSEGSEDSEDSTIHPAGFLYFPVLEPQLKSKTLLYP-EQLEK------DRIKAVKV
ADDB_DESHD      KGSEGSEGSEDSEDSTIHPAGFLYFPVLEPQLKSKTLLYP-EQLEK------DRIKAVKV
ADDB_SYMTH      ------------------PAGALYLPVYDPVEPVNAPVPP-DEVRP------LRRKRYQA
ADDB_MOOTA      ------------------PAGMLYFAVRNPLIRQRGPVGK-EAAAR------LRRQELKM
ADDB_DESAP      ------------------PAGAFYFRVQNPLLKGGTPVPP-AEVAP------RLLKAFRL
ADDB_DESRM      ------------------PAAMLYFSVRDPFVASTGPMTE-EEAEK------NLLKQLKM
ADDB_PELTS      ------------------PGAVLYFRIDDPLVNTDGPVPPGEEVER------EILKKLRM
ADDB_HELMI      PSSL-------SAATACHPGGMLYFGICDPLLSTGGPLTR-DEAER------AILKEAKM
ADDB_NATTJ      ------------------PGGMLYFGVENPVVPTDKPVSP-AQARD------KLKSTLKM
ADDB_ALKMQ      ------------------PGGIFYFKIDDPMVKTTEKVV-EEVEK-------EINKKLKM
ADDB_ALKOO      ------------------PGGIFYFKIDDPMVKTTEKAV-KEVEK-------EINKRLKM
ADDB_CLOPE      ------------------PGAILYFRIDDPILKSKGDLTEEEIKS-------EVLKELKL
ADDB_CLOP1      ------------------PGAILYFRIDDPILKSKGDLTEEEIKS-------EVLKELKL
ADDB_CLOPS      ------------------PGAILYFRIDDPILKSKGDLTEEEIKS-------EILKELKL
ADDB_CLOBB      ------------------PGAVLYFRVDDPIIKTKGDITTEELEK-------EVLSNLKM
ADDB_CLOBA      ------------------PGAVLYFKVDDPIIKTKGDITTEELEK-------EVLSNLKM
ADDB_CLOB8      ------------------PGAILYFKIDDPIIKSKKEMTDEEVEK-------EVLSALKM
ADDB_THEP3      ------------------PAGIFYFRIDDPIVKADKDITDEELQK-------EILKKLRL
ADDB_THEPX      ------------------PAGIFYFRIDDPIVKADKDITDEELQK-------EILKKLRL
ADDB_CALS4      ------------------PAGIFYFKIDDPIVRADKDISDEELYK-------EIMKRLRL
ADDB_CLOD6      ------------------PAAILYCRINNPIAKFNEDKDDEEIQE-------AILKELRM
ADDB_HUNT2      ------------------PGGVLYFKIDDPIIRGNGRMTEEEIEK-------AIMKQLRM
ADDB_RUMCH      ------------------PGGILYFRIDDPMIRCTDNSTPEEIET-------AIMKKLKM
ADDB_CLOBK      ------------------PGALLYLKLDDPIVKNTVDMSDEEIEK-------SIIKNLKM
ADDB_CLOBL      ------------------PGALLYLKLDDPIVKNTVDMSDEEIEK-------SIIKNLKM
ADDB_CLOBH      ------------------PGALLYLKLDDPIVKNTVDMSDEEIEK-------SIIKNLKM
ADDB_CLOB1      ------------------PGALLYLKLDDPIVKNTVDMSDEEIEK-------SIIKNLKM
ADDB_CLOBM      ------------------PGALLYLKLDDPIVKNIVDMSDKEIEK-------SIIKNLKM
ADDB_CLOK1      ------------------PAGLLYFKLEDPIVRTKENIPDHEIED-------RITKSLKM
ADDB_CLOTE      ------------------PAGILYFNMDDPLISTKKEITKEEAEK-------EILKKLKL
ADDB_CLONN      ------------------PGGVLYLKIDDPIIKGKRNLSEEEIQD-------EIMKALKM
ADDB_CLOAB      ------------------PGAILYFTMDDPIIKGKNNLTDEQIRE-------EIMKSLKM
ADDB_LACP7      ------------------PAGVFYYNLDDPIVTKSSSVE------------EDIEKKLAM
                                  *.. :*  : :                          .    

ADDB_STAEQ      SGLLNRDQEVLDALDIRLEPKY------N-SDIVPIALTAKGAINQRSSKVADENIIYQL
ADDB_STAES      SGLLNRDQEVLDALDIRLEPKY------N-SDIVPIALTAKGAINQRSSKVADENIIYQL
ADDB_STAAB      SGLVNADQTVIDALDIRLEPKF------T-SDIVPVGLNKDGSLSKRGSQVADEATIYKF
ADDB_STAAR      SGLVNADQTVIDALDIRLEPKF------T-SDIVPVGLNKDGSLSKRGSQVADEATIYKF
ADDB_STAAW      SGLVNADQTVIDALDIRLEPKF------T-SDIVPVGLNKDGSLSKRGSQVADEATIYKF
ADDB_STAAS      SGLVNADQTVIDALDIRLEPKF------T-SDIVPVGLNKDGSLSKRGSQVADEATIYKF
ADDB_STAA1      SGLVNADQTVIDALDIRLEPKF------T-SDIVPVGLNKDGSLSKRGSQVADEATIYKF
ADDB_STAA2      SGLVNADQTVIDALDIRLEPKF------T-SDIVPVGLNKDGSLSKRGSQVADEATIYKF
ADDB_STAA9      SGLVNADQTVIDALDIRLEPKF------T-SDIVPVGLNKDGSLSKRGSQVADEATIYKF
ADDB_STAAM      SGLVNADQTVIDALDIRLEPKF------T-SDIVPVGLNKDGSLSKRGSQVADEATIYKF
ADDB_STAAN      SGLVNADQTVIDALDIRLEPKF------T-SDIVPVGLNKDGSLSKRGSQVADEATIYKF
ADDB_STAA3      SGLVNADQTVIDALDIRLEPKF------T-SDIVPVGLNKDGSLSKRGSQVADEATIYKF
ADDB_STAA8      SGLVNADQTVIDALDIRLEPKF------T-SDIVPVGLNKDGSLSKRGSQVADEATIYKF
ADDB_STAAT      SGLVNADQTVIDALDIRLEPKF------T-SDIVPVGLNKDGSLSKRGSQVADEATIYKF
ADDB_STAAC      SGLVNADQTVIDALDIRLEPKF------T-SDIVPVGLNKDGSLSKRGSQVADEATIYKF
ADDB_STAAE      SGLVNADQTVIDALDIRLEPKF------T-SDIVPVGLNKDGSLSKRGSQVADEATIYKF
ADDB_STAHJ      RGLVNSDMDVVDALDIRLEEIG------K-SDIVPVSLKKDGSIGSRGSSVADETTIHKF
ADDB_STAS1      SGLLNSATSVLDAFDTRLEPSY------N-SDIVPLGLKKDGGIKS-NSKVADEQTIYKL
ADDB_STACT      NGLINSDPEVLDAEDTRLEPKF------K-SDIVPIDVGAKGNLNK-SSKVADSQTIYKF
ADDB_EXIS2      QGVIVENDEVLRAMDQIAYDER------KKSPLVKVTFTKTGLHKSHTKGVVKEEELTAL
ADDB_LISMH      KGLILSDPVAVSLMDTTLEKGK-------ASTIIPAEIKQNGELS-ARSRTATRAEFDKM
ADDB_LISMO      KGLILSDPVAVSLMDMTLEKGK-------ASTIIPAEIKQNGELS-ARSRTATRAEFDKM
ADDB_LISMF      KGLILSDPVAVSLMDTTLEKGK-------SSNIVPAEIKQNGELS-ARSKTATREEFDKM
ADDB_LISIN      KGLILSDPVAVSLMDTNLEKGK-------SSNIIPAEIKQNGELS-ARSRTATKAEFDKM
ADDB_LISW6      KGLILSDPVAVSLMDTSLEKGK-------SSNIIPAEIKQNGDLS-ARSRTATKEEFDKM
ADDB_LYSSC      KGLLSENAESILSMDEQLEESS------GHSKIIPVYMKKDGTPSESQSRIVPVNDMKRL
ADDB_BACHK      KGLVLGDADVVRLMDNKLSTG--------SSDIISAGLKKDGSFS-ARSSIASEQEFNVL
ADDB_BACCZ      KGLVLGDADVVRLMDNKLSTG--------SSDIISAGLKKDGSFS-ARSSIASEQEFNVL
ADDB_BACAN      KGLVLGDADVVRLMDNKLSTG--------SSDIISAGLKKDGSFS-ARSSIASEQEFNVL
ADDB_BACC0      KGLVLGDADVVRLMDNKLSTG--------SSDIISAGLKKDGSFS-ARSSIASEQEFNVL
ADDB_BACC7      KGLVLGDADVVRLMDNKLSTG--------SSDIISAGLKKDGSFS-ARSSIASEQEFNVL
ADDB_BACCQ      KGLVLGDADVVRLMDNKLSTG--------SSDIISAGLKKDGSFS-ARSSIASEQEFNVL
ADDB_BACC1      KGLVLGDADVVRLMDNKLSTG--------SSDIISAGLKKDGSFS-ARSSIASEQEFNVL
ADDB_BACAH      KGLVLGDADVVRLMDNKLSTG--------SSDIISAGLKKDGSFS-ARSSIASEQEFNVL
ADDB_BACC4      KGLVLGDADVVRLMDNKLSTG--------SSDIISAGLKKDGSFS-ARSSIASEQEFNVL
ADDB_BACCR      KGLVLGDADVVRLMDNKLSTG--------SSDIISAGLKKDGSFS-ARSSIASEQEFNVL
ADDB_BACC2      KGLVLGDADVVRLMDNKLSTG--------SSDIISAGLKKDGSFS-ARSSIASEQEFNVL
ADDB_BACMK      KGLVLGDADVVRLMDNKLSTG--------SSDIISAGLKKDGSFS-ARSSIASEQEFNVL
ADDB_BACCN      KGLVLGDADVVRLMDNKLSTG--------SSDIISAGLKKDGSFS-ARSNIASEQEFSVL
ADDB_BACSU      KGLLLGDQEVVRLMDTTLQEG--------RSNIINAGLKKDGSLR-SDSAAVGEKEFDLL
ADDB_BACVZ      KGLLLGDREAISLMDTTLEEG--------RSNIVNAGLKKDGSLR-SDSAAVSEQDFHLL
ADDB_BACLD      KGLLLGDQEAVKLMDTTLEQG--------RSNIISAGLKKDGSLR-SDSDVVAEEDFHVL
ADDB_BACP2      KGLLLEDVEAVKLMDQTLESG--------RSQVIQAGLKKDGSFR-SDSAVLSEDHFHIL
ADDB_GEOKA      RGLLLADVEAIRLMDGRTEDGQ-------WSLIVPAQLTKSGSIH-SRSSVASPSDFAAL
ADDB_GEOTN      RGLLLADAETIRLMDSQTENGQ-------WSLIVPAQLTRTGAIH-SRSSVASASDFAAL
ADDB_ANOFW      GGYVLADEKTVRLMDEHVEPGT-------SSLIIPVRLNKNGTFA-QHSKVLTEQQFTML
ADDB_OCEIH      QGLLLSNEEIVKMMDSSLETG--------SSQIVPAALKKNGGFY-SYSKIADQSTFETL
ADDB_DESHY      KGYLLADRQVLLAMDRDLE----------NSSLLGIKLTKSG-EFKKGSPILTEEQFALL
ADDB_DESHD      KGYLLADRQVLLAMDRDLE----------NSSLLGIKLTKSG-EFKKGSPILTEEQFALL
ADDB_SYMTH      RGLVSDDPAVIQAMD---A-A--------GLGLIQAKLKKDG-TVYKGAPVASPDQFRQL
ADDB_MOOTA      RGLLLDDVEVIKLMDREIA-A--------SPDLLPLRLNKDG-SLRKGAPVAGREEMALL
ADDB_DESAP      QGLVLDDPALLRLMDDAIG-S--------ESAIVPAGLKQDG-TVKKKPGVVSAAQLERL
ADDB_DESRM      KGLLLADPLVISKMDKELS-G--------QSDLLPVGLKKNG-DFYSNSRVITEEQFKLL
ADDB_PELTS      TGLVLADPKAVRLMDAGLD-G--------ISDLIPVQIKADG-SFAARSAVLTREQFALL
ADDB_HELMI      CGHVLADPAVVAAMDGQTRQG--------YSPLIPVGLKKEG-GFYSASSVLTMEQFALL
ADDB_NATTJ      RGYLIDDEEVLDLMTREDE-N--------SQDLLPYKLRTSSPGFYKNSKVLSEQEFLAV
ADDB_ALKMQ      KGLVLKDVNIIKKMDRSIGRS---------STIVPAGLTKDDEISKS-SSALPEEDFKAL
ADDB_ALKOO      KGLVLKDVNIIKKIDEDIGRS---------SSILPASLTKEGEISKT-SSALPEEDFKAL
ADDB_CLOPE      EGLLLDDVKVVKAMDNTLEPG-------THSLIIPANMKKAGDLGKN-KALITMEQFELL
ADDB_CLOP1      EGLLLDDVKVVKAMDNTLEPG-------THSLIIPANMKKAGDLGKN-KALITMEQFELL
ADDB_CLOPS      EGLLLDDVKVVKAMDNTLEPG-------THSLIIPANMKKAGDLGKN-KALITMEQFELL
ADDB_CLOBB      NGLILKDAKVVKAMDRGIETD-------GYSLVIPAALKKDGDFKAG-SEVVTEEQFNLL
ADDB_CLOBA      NGLILKDAKVVKAMDRGIETD-------GYSLVIPAALKKDGDFKAG-SEVVTEEQFTLL
ADDB_CLOB8      KGLVLKDARVVKAMDKDIE---------GYSLVIPASFKADGGFKAT-SDVVTEEEFRIL
ADDB_THEP3      DGLVLKDAEIIKEMDKSING---------TSYIIPASINKDGTIGKK-TKGATKEQFELL
ADDB_THEPX      DGLVLKDAEIIKEMDKSING---------TSYIIPASINKDGTIGKK-TKGATKEQFELL
ADDB_CALS4      EGFVLKSLDIIREMDKLIEG---------TSYVIPASINKDGTIGKN-TKGLTEEQFEIL
ADDB_CLOD6      KGLVVKDSHIVKEMDKSLIDGER-----KNSLVIPVGLTKDGNVGKS-TSAISYEDFKLL
ADDB_HUNT2      KGLLLADVKLIREMDKDIEGS---------SMIIPATVNKDGSLGKN-TSAATMEQFKLL
ADDB_RUMCH      KGLLLADVQLIKYMDNTIEGN---------SIIIPARINKGDVLGK--SSAATIEQFTVL
ADDB_CLOBK      KGLILNDPNVIRDMDNIISGI---------SDIIPVMVKKDGGVSEGRSSVATKEEFETL
ADDB_CLOBL      KGLILNDPNVIRDMDNIISGI---------SDIIPVMVKKDGGVSEGRSSVATKEEFETL
ADDB_CLOBH      KGLILNDPNVIRDMDNIISGI---------SDIIPVMVKKDGGVSEGRSSVATKEEFETL
ADDB_CLOB1      KGLILNDPNVIRDMDNIISGI---------SDIIPVMVKKDGGVSEGRSSVATKEEFETL
ADDB_CLOBM      KGLILNDPNIIKDMDNIISGI---------SDIIPVMVKKDGGVSEGRSSVATKEEFETL
ADDB_CLOK1      NGLLLNDVNVIRQMDTSMEKS---------SDIISVSIKKDGNLSKSKSSLATRKQFEIL
ADDB_CLOTE      KGLVLKDANIIKAMDNLISGY---------SDIISVRVNKDGSPSKN-SSVADLEDFQLL
ADDB_CLONN      KGLLLADEEVVKEMDRKIEGN---------SLIIPARINKDG--SLGKSSVGTEEQFRLL
ADDB_CLOAB      KGLLLSDPDVIKEMDREMEGS---------SIIIPASIKKDG--TLGRSSAATKEQFDIL
ADDB_LACP7      NGLVNASKVVVPLLDTSFCGDEGELAPSTKSTVIPVETGKDGTFTKR-SSVAKEEELITL
                 * :      :                     ::       .              :  .

ADDB_STAEQ      IEHNKKNFIETASHIMDGHTEVAPLKYKQVLPCQFCNYKSVCHVDGLIDSKRYRTVDESI
ADDB_STAES      IEHNKKNFIETASHIMDGHTEVAPLKYKQVLPCQFCNYKSVCHVDGLIDSKRYRTVDESI
ADDB_STAAB      IQHNKENFIETASNIMDGHTEVAPLKYKQKLPCAFCSYQSVCHVDGMIDSKRYRTVDETI
ADDB_STAAR      IQHNKENFIETASNIMDGHTEVAPLKYKQKLPCAFCSYQSVCHVDGMIDSKRYRTVDETI
ADDB_STAAW      IQHNKENFIETASNIMDGHTEVAPLKYKQKLPCAFCSYQSVCHVDGMIDSKRYRTVDETI
ADDB_STAAS      IQHNKENFIETASNIMDGHTEVAPLKYKQKLPCAFCSYQSVCHVDGMIDSKRYRTVDETI
ADDB_STAA1      IQHNKENFIETASNIMDGHTEVAPLKYKQKLPCAFCSYQSVCHVDGMIDSKRYRTVDETI
ADDB_STAA2      IQHNKENFIETASNIMDGHTEVAPLKYKQKLPCAFCSYQSVCHVDGMIDSKRYRTVDETI
ADDB_STAA9      IQHNKENFIETASNIMDGHTEVAPLKYKQKLPCAFCSYQSVCHVDGMIDSKRYRTVDETI
ADDB_STAAM      IQHNKENFIETASNIMDGHTEVAPLKYKQKLPCAFCSYQSVCHVDGMIDSKRYRTVDETI
ADDB_STAAN      IQHNKENFIETASNIMDGHTEVAPLKYKQKLPCAFCSYQSVCHVDGMIDSKRYRTVDETI
ADDB_STAA3      IQHNKENFIETASNIMDGHTEVAPLKYKQKLPCAFCSYQSVCHVDGMIDSKRYRTVDETI
ADDB_STAA8      IQHNKENFIETASNIMDGHTEVAPLKYKQKLPCAFCSYQSVCHVDGMIDSKRYRTVDETI
ADDB_STAAT      IQHNKENFIETASNIMDGHTEVAPLKYKQKLPCAFCSYQSVCHVDGMIDSKRYRTVDETI
ADDB_STAAC      IQHNKENFIETASNIMDGHTEVAPLKYKQKLPCAFCSYQSVCHVDGMIDSKRYRTVDETI
ADDB_STAAE      IQHNKENFIETASNIMDGHTEVAPLKYKQKLPCAFCSYQSVCHVDGMIDSKRYRTVDETI
ADDB_STAHJ      IKHNKDNFIKTATNIMEGHTEVAPLKFDDQLPCQFCNFQSVCHVDTIIDSKHYRHVEETI
ADDB_STAS1      IKHNKQNFIETASNIMDGHTEVAPMKYNQTLPCDFCNYKSVCHVDGMIDSKRYRTVDESI
ADDB_STACT      IEHNKNNFIQIASDIMDGHTQVAPMKYKQKLPCEYCNYRSVCHVDGMIDSKKYRTVDESI
ADDB_EXIS2      MDHAWDELKTSSQSMYAGDIAIDPFDYQERTPCTFCEYRSVCQFDQSLGNDYRQLNPLSE
ADDB_LISMH      RQFVRHKYQEAGNKILDGAVSINPYKLKERTPCQFCSFRSFCGFDPSLTSNQYRHLANEK
ADDB_LISMO      RQFVRHKYQEAGNKILDGAVSINPYKLKERTPCQFCSFRSFCGFDPSLTSNQYRHLANEK
ADDB_LISMF      RHFVRHKYQEAGNKILDGAVSINPYKLKERTPCQFCGFRSFCGFDPSLASNQYRHLTNEK
ADDB_LISIN      RRFVRQKYQEAGNKILDGAVSINPYKLKEKTPCQFCGFRSFCGFDPSLASNQYRHLTNEK
ADDB_LISW6      RHFVRHKYQEAGNKILDGAVSINPYKLKERTPCQFCGFRSFCGFDPSLTSNQYRHLTNEK
ADDB_LYSSC      QHFVRRKHQEAGNGILSGDTAISPYKLKSKTACDYCQFAAVCQFDPSDGKQNYRQLMQAK
ADDB_BACHK      QKYVHHTFENIGKDITEGVIDIAPYKKGNKAACTFCNFKSVCQFDESLEDNQFRTLKDMK
ADDB_BACCZ      QKYVHHTFENIGKDITEGVIDIAPYKKGNKAACTFCNFKSVCQFDESLEDNQFRTLKDMK
ADDB_BACAN      QKYVHHTFENIGKDITEGVIDIAPYKKGNKAACTFCNFKSVCQFDESLEDNQFRTLKDMK
ADDB_BACC0      QKYVHHTFENIGKDITEGVIDIAPYKKGNKAACTFCNFKSVCQFDESLEDNQFRTLKDMK
ADDB_BACC7      QKYVHHTFENIGKDITEGVIDIAPYKKGNKAACTFCNFKSVCQFDESLEDNQFRTLKDMK
ADDB_BACCQ      QKYVHHTFENIGKDITEGVIDIAPYKKGNKAACTFCNFKSVCQFDESLEDNQFRTLKDMK
ADDB_BACC1      QKYVHHTFENIGKDITEGVIDIAPYKKGNKAACTFCNFKSVCQFDESLEDNQFRTLKDMK
ADDB_BACAH      QKYVHHTFKNIGKDITEGVIDIAPYKKGNKAACTFCNFKSVCQFDESLEDNQFRTLKDMK
ADDB_BACC4      QKYVHHTFENIGKDITEGVIDIAPYKMGNKAACTFCNFKSVCQFDESLEDNQFRSLKDMK
ADDB_BACCR      QKYVHHTFENIGKDITEGVIDIAPYKMGNKAACTFCNFKSVCQFDESLEDNQFRSLKDMK
ADDB_BACC2      QKYVHHTFENIGKDITEGVIDIAPYKMGNKAACTFCNFKSVCQFDESLEDNQFRTLKDMK
ADDB_BACMK      QKYVHHSFENIGKDITEGVIDIAPYKKGNKAACTFCNFKSVCQFDESLEDNQFRTLKDMK
ADDB_BACCN      QKYVHHTFETIGKDITEGVIDIAPYKMGNKAACTFCHFRSVCQFDESLEDNQFRTLKDMK
ADDB_BACSU      TKHVRRTFQEAGEQITDGRVSIEPYKMKNKTPCTYCAFKSVCQFDESLEENEYRPLKAEK
ADDB_BACVZ      TDHVRRTFEQAGEAITDGLVSITPYKLKDKTPCTYCAFQSVCQFDESLKENEYRSLKAEK
ADDB_BACLD      RRHIRRTFQQAGEEITDGKVSIEPYKLKDRTPCTYCSYRSFCQFDESLEENEYRILKPEK
ADDB_BACP2      TQHVRRTFEEAGERITNGEVAINPYKLKDQTPCRFCSFKSICQFDESIEDNDFRVLTSEK
ADDB_GEOKA      RQHVRRLFIDIGGQIADGVVSIAPYKLKDKTACEFCVFKPVCQFDEALSGNEYRKLAPQT
ADDB_GEOTN      RQHVRRLFVDIGGQIADGVVSIAPYKLKNKTACEFCAFKPVCQFDEALSGNGYRKLTPQT
ADDB_ANOFW      RQHVRRFIVDVGEQMIEGVTHIAPYKQKNKTACQYCEFRDVCQFDEGVDAEQYRVLTPKN
ADDB_OCEIH      QNHIHQLLKSAGIDITNGSVDVNPYQHKQQKACTYCPFHSVCQFDPVLEENNYRKFADIK
ADDB_DESHY      RKHLQHFLRCSGEALLEGDISITPYRQGKHTACQFCSYKPLCHFDPYLPENNYRNLPVIQ
ADDB_DESHD      RKHLQHFLRCSGEALLEGDISITPYRQGKHTACQFCSYKPLCHFDPYLPENNYRNLPVIQ
ADDB_SYMTH      FAHLRRVVRACGEQILQGEAAIAPYRLGPHTACQYCAYRPVCQFDPAVEPQGYRRLEKMD
ADDB_MOOTA      LDLALARAAELAGAILSGRVEISPYRRGQETACDFCPYRPVCAFDPQIPGSGYRRLGNLP
ADDB_DESAP      QEHVRRVVAETAAEIQAGVVAIAPYRKGQANACRYCAFKPVCAFDPLLESNRYRQLRALT
ADDB_DESRM      RNYLEFKLKSIGQQMVSGDIAISPYQRGKEKACRYCIFKSVCQFDPLLEDNLFRLLADQE
ADDB_PELTS      RSYLRFQLASAGSEIIGGTVEIAPYRKGRYRSCQSCPFRPVCQFDLLVDGNVYRSIKDED
ADDB_HELMI      RQYLQSIVARVGEAILDGLVSIRPHRRDDRLACSFCPYKSVCQFDLLLQDNDYRLLIDDP
ADDB_NATTJ      LNYTESKLVELAERVLSGEIAPYPYKDGGYSACTYCPYLAVCQFDLNYKEHKFWNVPAKG
ADDB_ALKMQ      LNHVRRLVKEIGEEMLKGNVKIEPFKKGGDTSCKYCDYIAICQFDNSFHDNQYKNIKELK
ADDB_ALKOO      LKHVRGLVKEIGEEMLKGNVKIEPFKKGGDTSCKYCAYISICQFDHSFHENQYKTIKELK
ADDB_CLOPE      RKYVNEKMVEICQNMIEGKIDIEPCKENKNIVCDYCNYSHICQFDSSLEDNRYKVIPKKK
ADDB_CLOP1      RKYVNEKMVEICQNMIEGKIDIEPCKENKNIVCDYCNYSHICQFDSSLEDNRYKVIPKKK
ADDB_CLOPS      RKYVNEKMVEICQNMIEGKIDIEPCKENKNIVCDYCNYSHICQFDSSLEDNRYKVIPKKK
ADDB_CLOBB      REYVNKKMIDLCEDMLCGDIKIQPTKDSDGSHCEFCDFSSICQFDSSIEDNKYKIIMKKS
ADDB_CLOBA      REYVNKKMIDLCEDMLCGDIKIQPTKDSDGSHCEFCDFSSICQFDSSIEDNKYKIIMKKS
ADDB_CLOB8      REYVNRKMIEICEEMLSGDIKIQPTKNSNIAHCEYCDFSSICQFDTEIKDNKYKIIINKS
ADDB_THEP3      RKHVKNMIKDLAEQMINGNISITPYRKGKETACKYCPYSSVCKFETNFEGNKYMFIKEQK
ADDB_THEPX      RKHVKNMIKDLAEQMINGNISITPYRKGKETACKYCPYSSVCKFETNFEGNKYMFIKEQK
ADDB_CALS4      RKFVKKKSKKLAEEMLQGDISILPYKKEKETACQYCPYSSICKFETNFKGNDYRRIE-SK
ADDB_CLOD6      RKYVRHAIKDLCEEMLSGEIRIAPYKHKDGTSCDFCDYSAICQFDSTIKDNKYKNLNNKS
ADDB_HUNT2      RKYVRKLLKNLCEEIMKGNVSINPYKKKGTTSCKYCSFLPVCQFDTTMKENTFKLLYDKK
ADDB_RUMCH      RSYVKQLLKDMCSELMKGNVPISPYKKKKLTSCSYCNYSSVCQFDQSQKENSFRMLHDRE
ADDB_CLOBK      RKYVRYTIIEICEEMLEGNIEIKPYKKKDGSSCDYCIYSSVCKFDTNIRGNKYNILIDKK
ADDB_CLOBL      RKYVRYTIIEICEEMLEGNIEIKPYKKKDGSSCDYCIYSSVCKFDTNIRGNKYNILIDKK
ADDB_CLOBH      RKYVRYTIIEICEEMLEGNIEIKPYKKKDGSSCDYCIYSSVCKFDTNIRGNKYNILIDKK
ADDB_CLOB1      RKYVRYTIIEICEEMLEGNIEIKPYKKKDGSSCDYCIYSSVCKFDTNIRGNKYNILIDKK
ADDB_CLOBM      RKYVRYTIIEICEEMLEGNIEIKPYKKKDGSSCDYCIYSSVCKFDTEIRGNKYNILIDKK
ADDB_CLOK1      RKYVRSTIADLCKKILTGNIEVTPYKNKTKNGCSYCEYSAICQFDTSIKGNKYRIIEDKS
ADDB_CLOTE      RDYVRKLIVELCEEMLEGNISIKPYKKNNYTPCGFCDYSAICQFDTSIKGSQYRFINDKK
ADDB_CLONN      REHVKKNLIKACEDMLKGDIKIRPIRSKNADACTYCLYSSICEFDTNFEDNEFKVVQEKK
ADDB_CLOAB      IEHVRNLVVKNCENLLMGDIRIKPYKKGKEKPCDYCMYSSICRFDTMFDGNNYRYVKEKS
ADDB_LACP7      TDYIKDLMHRFSEQIMEGKVRHNPYRAKNRNACTYCSFQSVCGFDCKVSGFSYRNLKTLN
                              :  *     *        *  * :  .* .:               

ADDB_STAEQ      KPLDLIQQLRNEGGERHDSN----------------------------------------
ADDB_STAES      KPLDLIQQLRNEGGERHDSN----------------------------------------
ADDB_STAAB      NPIEAIQNINIDDEFGGEQ-----------------------------------------
ADDB_STAAR      NPIEAIQNININDEFGGEQ-----------------------------------------
ADDB_STAAW      NPIEAIQNININDEFGGEQ-----------------------------------------
ADDB_STAAS      NPIEAIQNININDEFGGEQ-----------------------------------------
ADDB_STAA1      NPIEAIQNININDEFGGE------------------------------------------
ADDB_STAA2      NPIEAIQNININDEFGGE------------------------------------------
ADDB_STAA9      NPIEAIQNININDEFGGE------------------------------------------
ADDB_STAAM      NPIEAIQNININDEFGGE------------------------------------------
ADDB_STAAN      NPIEAIQNININDEFGGE------------------------------------------
ADDB_STAA3      NPIEAIQNININDEFGGEQ-----------------------------------------
ADDB_STAA8      NPIEAIQNININDEFGGEQ-----------------------------------------
ADDB_STAAT      NPIEAIQNININDEFGGEQ-----------------------------------------
ADDB_STAAC      NPIEAIQNININDEFGGEQ-----------------------------------------
ADDB_STAAE      NPIEAIQNININDEFGGEQ-----------------------------------------
ADDB_STAHJ      DPIKAIQDVELESGDHNE------------------------------------------
ADDB_STAS1      NPLEAIQDVDLESEGE--------------------------------------------
ADDB_STACT      NPIDLLNQESDEDDEE--------------------------------------------
ADDB_EXIS2      KEVLERLKEETE------------------------------------------------
ADDB_LISMH      AETILTKMDMEGGTQ---------------------------------------------
ADDB_LISMO      AETILTKMDIEGGTQ---------------------------------------------
ADDB_LISMF      TETILAKMNIEGGEQ---------------------------------------------
ADDB_LISIN      TETILTKMDIEGGTQ---------------------------------------------
ADDB_LISW6      AENILTKMDIEGGTQ---------------------------------------------
ADDB_LYSSC      PNEIVDKIRKEIE-----------------------------------------------
ADDB_BACHK      DSEAMEKIREEVGGE---------------------------------------------
ADDB_BACCZ      DSEAMEKIREEVGGE---------------------------------------------
ADDB_BACAN      DSEAMEKIREEVGGE---------------------------------------------
ADDB_BACC0      DSEAMEKIREEVGGE---------------------------------------------
ADDB_BACC7      DSEAMEKIREEVGGE---------------------------------------------
ADDB_BACCQ      DSEAMEKIREEVGGE---------------------------------------------
ADDB_BACC1      DSEAMEKIREEVGGE---------------------------------------------
ADDB_BACAH      DSEAMEKIREEVGGE---------------------------------------------
ADDB_BACC4      DSEAMEKIREEVGGE---------------------------------------------
ADDB_BACCR      DSEAMEKIREEVGGE---------------------------------------------
ADDB_BACC2      DSEAMEKIREEVGGE---------------------------------------------
ADDB_BACMK      DSEAMEKIREEVGGE---------------------------------------------
ADDB_BACCN      DSEAMEKIREEVGE----------------------------------------------
ADDB_BACSU      DKTILEWIKKEADGNEHS------------------------------------------
ADDB_BACVZ      DGTILDWLKKEADDDANS------------------------------------------
ADDB_BACLD      DSVILERLKKEDEADGDF------------------------------------------
ADDB_BACP2      DDVVIERIKKEGDQYANTKTE---------------------------------------
ADDB_GEOKA      KEAVIEKLAEGKEG----------------------------------------------
ADDB_GEOTN      KDAVIETLGKREEES---------------------------------------------
ADDB_ANOFW      IDEWLKG-----------------------------------------------------
ADDB_OCEIH      ENDLLQLFEREGENNG--------------------------------------------
ADDB_DESHY      DEEFWQRVQSQDSEQYPEQHPPTSVPGETSRRALQKDGGNSPRGQELIWLGEDEAGAGKE
ADDB_DESHD      DEEFWQRVQSQDSEQYPEQHPPTSVPGETSRRALQKDGGNSPRGQELIWLGEDEAGAGKE
ADDB_SYMTH      APDVWQRVAAAGGEGDV-------------------------------------------
ADDB_MOOTA      G-DFWQLAAAFLGSQMKG------------------------------------------
ADDB_DESAP      AGELWRLLGLPEEDEPGDE-----------------------------------------
ADDB_DESRM      EQVLWSLIKESLGDKHE-------------------------------------------
ADDB_PELTS      EGAIWSKLGRMCRKGWGQ------------------------------------------
ADDB_HELMI      PEKIWEKIAAGPKAIFEGVIR---------------------------------------
ADDB_NATTJ      DYLSLILEEMEEVKE---------------------------------------------
ADDB_ALKMQ      SDEVLERIKKESQKKLE-------------------------------------------
ADDB_ALKOO      NEEVLEKIRKENENI---------------------------------------------
ADDB_CLOPE      DEDIWKSINEKVGGE---VNGD--------------------------------------
ADDB_CLOP1      DEDIWKSINEKVGGE---VNGD--------------------------------------
ADDB_CLOPS      DEDIWKSINEKVGGE---VNGD--------------------------------------
ADDB_CLOBB      KDEIWNNIRDELNDD----KKEN-------------------------------------
ADDB_CLOBA      KDEIWNNIRDELNDD----KKEN-------------------------------------
ADDB_CLOB8      TNDIWNNIKKEIDNSNKLIKVENEEV----------------------------------
ADDB_THEP3      EEEIWNMLQKEVNKDGDKVD----------------------------------------
ADDB_THEPX      EEEIWNMLQKEVNKDGDKVD----------------------------------------
ADDB_CALS4      EEKLWSIFEEEVKEDGSQVDGRTEGSDNNEG-----------------------------
ADDB_CLOD6      NEEIIKMMKGDVN-----------------------------------------------
ADDB_HUNT2      DDEIWSLMAQEEEE----------------------------------------------
ADDB_RUMCH      DNDIWKLMNEIDVKDN--------------------------------------------
ADDB_CLOBK      DEEVWDAIKKKLEYKNI-------------------------------------------
ADDB_CLOBL      DEEVWDAIKKKLEYKNI-------------------------------------------
ADDB_CLOBH      DEEVWDAIKKKLEYKNI-------------------------------------------
ADDB_CLOB1      DEEVWDDIKKKLEC----------------------------------------------
ADDB_CLOBM      DEEVWEAIKKKLEC----------------------------------------------
ADDB_CLOK1      DEEIWKHIENKVQE----------------------------------------------
ADDB_CLOTE      DDEVLQCIREEMKED---------------------------------------------
ADDB_CLONN      DEEVWELLRKEGEESWEK------------------------------------------
ADDB_CLOAB      DEEVWKLIEREMSEEGDERGED--------------------------------------
ADDB_LACP7      KEEVWNLIKKEDEFFGKDELDTGATEGN--------------------------------
                                                                            

ADDB_STAEQ      -----
ADDB_STAES      -----
ADDB_STAAB      -----
ADDB_STAAR      -----
ADDB_STAAW      -----
ADDB_STAAS      -----
ADDB_STAA1      -----
ADDB_STAA2      -----
ADDB_STAA9      -----
ADDB_STAAM      -----
ADDB_STAAN      -----
ADDB_STAA3      -----
ADDB_STAA8      -----
ADDB_STAAT      -----
ADDB_STAAC      -----
ADDB_STAAE      -----
ADDB_STAHJ      -----
ADDB_STAS1      -----
ADDB_STACT      -----
ADDB_EXIS2      -----
ADDB_LISMH      -----
ADDB_LISMO      -----
ADDB_LISMF      -----
ADDB_LISIN      -----
ADDB_LISW6      -----
ADDB_LYSSC      -----
ADDB_BACHK      -----
ADDB_BACCZ      -----
ADDB_BACAN      -----
ADDB_BACC0      -----
ADDB_BACC7      -----
ADDB_BACCQ      -----
ADDB_BACC1      -----
ADDB_BACAH      -----
ADDB_BACC4      -----
ADDB_BACCR      -----
ADDB_BACC2      -----
ADDB_BACMK      -----
ADDB_BACCN      -----
ADDB_BACSU      -----
ADDB_BACVZ      -----
ADDB_BACLD      -----
ADDB_BACP2      -----
ADDB_GEOKA      -----
ADDB_GEOTN      -----
ADDB_ANOFW      -----
ADDB_OCEIH      -----
ADDB_DESHY      DDGHE
ADDB_DESHD      DDGHE
ADDB_SYMTH      -----
ADDB_MOOTA      -----
ADDB_DESAP      -----
ADDB_DESRM      -----
ADDB_PELTS      -----
ADDB_HELMI      -----
ADDB_NATTJ      -----
ADDB_ALKMQ      -----
ADDB_ALKOO      -----
ADDB_CLOPE      -----
ADDB_CLOP1      -----
ADDB_CLOPS      -----
ADDB_CLOBB      -----
ADDB_CLOBA      -----
ADDB_CLOB8      -----
ADDB_THEP3      -----
ADDB_THEPX      -----
ADDB_CALS4      -----
ADDB_CLOD6      -----
ADDB_HUNT2      -----
ADDB_RUMCH      -----
ADDB_CLOBK      -----
ADDB_CLOBL      -----
ADDB_CLOBH      -----
ADDB_CLOB1      -----
ADDB_CLOBM      -----
ADDB_CLOK1      -----
ADDB_CLOTE      -----
ADDB_CLONN      -----
ADDB_CLOAB      -----
ADDB_LACP7      -----