CLUSTAL format seed alignment for MF_01453

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ADDB_LACLM        ---MEILYTEITQDLTEGLLEIALEELEKN---RKVYYIVPSSMSFEKEKEILERLAKGS
ADDB_LACLS        ---MEILYTEITQDLTEGLLEIALEELEKN---RKVYYIVPSSMSFEKEKEILERLAKGS
ADDB_LACLA        ---MEILYTEITQDLTEGLLEISLEELEKN---RKVYYIVPSSMSFEKEKEILERLAKGS
ADDB_STRPB        ---MKLIYTEMSYSMTEILVNEARKAADQG---YRVFYIAPNSLSFEKEREVLTLLPE--
ADDB_STRPC        ---MKLIYTEMSYSMTEILVNEARKAADQG---YRVFYIAPNSLSFEKEREVLTLLPE--
ADDB_STRPM        ---MKLIYTEMSYSMTEILVNEARKAADQG---YRVFYIAPNSLSFEKEREVLTLLPE--
ADDB_STRP8        ---MKLIYTEMSYSMTEILVNEARKAADQG---YRVFYIAPNSLSFEKEREVLTLLPE--
ADDB_STRP6        ---MKLIYTEMSYSMTEILVNEARKAADQG---YRVFYIAPNSLSFEKEREVLTLLPE--
ADDB_STRPG        ---MKLIYTEMSYSMTEILVNEARKAADQG---YRVFYIAPNSLSFEKEREVLTLLPE--
ADDB_STRPD        ---MKLIYTEMSYSMTEILVNEARKAADQG---YRVFYIAPNSLSFEKEREVLTLLPE--
ADDB_STRPF        ---MKLIYTEMSYSMTEILVNEARKAADQG---YRVFYIAPNSLSFEKEREVLTLLPE--
ADDB_STRPZ        ---MKLIYTEMSYSMTEILVNEARKAADQG---YRVFYIAPNSLSFEKEREVLTLLPE--
ADDB_STRP1        ---MKLIYTEMSYSMTEILVNEARKAADQG---YRVFYIAPNSLSFEKEREVLTLLPE--
ADDB_STRP3        ---MKLIYTEMSYSMTEILVNEARKAADQG---YRVFYIAPNSLSFEKEREVLTLLPE--
ADDB_STRS7        ---MKLLYTEISYSMTEILVKEARAYADKG---YRVFYIAPNSLSFEKERSVLALLPE--
ADDB_STREM        ---MKLLYTEISYSMTEILVKEARAYADKG---YRVFYIAPNSLSFEKERSVLALLPE--
ADDB_STRU0        ---MKLLYTDIENSLTEILVQEAEVFANSG---ARVFYIAPNSLSFEKERTVLEHLTK--
ADDB_STRA1        ---MKLLYTDINHDMTEILVNQAAHAAEAG---WRIFYIAPNSLSFEKERAVLENLPQ--
ADDB_STRA5        ---MKLLYTDINHDMTEILVNQAAHAAEAG---WRIFYIAPNSLSFEKERAVLENLPQ--
ADDB_STRA3        ---MKLLYTDINHDMTEILVNQAAHAAEAG---WRIFYIAPNSLSFEKERAVLENLPQ--
ADDB_STRMU        ---MKLLYTDIQYNMIDILAGEAQLAAKAG---KRVFYIAPNSLSFEKERAVLETLPE--
ADDB_STRT2        ---MKLLYTDMSQDLTEILTEQASSYAQKG---KRVFYIAPSALSFEKERKVLEYLPQ--
ADDB_STRTD        ---MKLLYTDMSQDLTEILTEQASSYAQKG---KRVFYIAPSALSFEKERKVLEYLPQ--
ADDB_STRGC        ---MKLLYTDIRHSLTKVLVAEAESLVATG---KRVFYIAPNSLSFEKERAVLECLKT--
ADDB_STRSV        ---MKLLYTDIRHSLTKVLVAEAESLVAAG---KRVFYIAPNSLSFEKERSVLECLKT--
ADDB_STRPN        ---MKLLYTDIRTSLTEILTREAEELVAAG---KRVFYIAPNSLSFEKERAVLEYLSQ--
ADDB_STRR6        ---MKLLYTDIRTSLTEILTREAEELVAAG---KRVFYIAPNSLSFEKERAVLEYLSQ--
ADDB_STRP2        ---MKLLYTDIRTSLTEILTREAEELVAAG---KRVFYIAPNSLSFEKERAVLEYLSQ--
ADDB_STRPS        ---MKLLYTDIRTSLTEILTREAEELVAAG---KRVFYIAPNSLSFEKERAVLECLSQ--
ADDB_STRPI        ---MKLLYTDIRTSLTEILTREAEELVAAG---KRVFYIAPNSLSFEKERAVLEYLSQ--
ADDB_STRPJ        ---MKLLYTDIRTSLTEILTREAEELVAAG---KRVFYIAPNSLSFEKERAVLECLSQ--
ADDB_STRP4        ---MKLLYTDIRTSLTEILTREAEELVAAG---KRVFYIAPNSLSFEKERAVLECLSQ--
ADDB_STRSY        ---MKLVYTDIRNPLTQYLTEQTATFAEQG---KRVFYIAPNSLSFEMERKVLEYLPE--
ADDB_STRS2        ---MKLVYTDIRNPLTQYLTEQTATFAEQG---KRVFYIAPNSLSFEMERKVLEYLPE--
ADDB_LEVBA        -MSLQFILGSAGQDHRTPMVTALAQQVTAHPTDQSYY-LVPNHIKFETEVDVLSALKEQI
ADDB_LACPL        -MSLQFVLGPAKMDHRRTMVAQLVATLMAKPQDQFFY-LVPNHIKFDTEVDVLNRLAQAF
ADDB_LACS1        -MSLGFVLGDATKNHRQVLLEQITNWQAEDPQAKIYY-IVPNHNKFSAEVKVLDYLKSQQ
ADDB_LACSS        -MSLKFILGTASYDHHQALVTNLKATFQEKPQERYFY-LVPNHIKFESEVSILEALKSDE
ADDB_PEDPA        -MPLQFMYGPASIDHLEGIADRVIELQQQNVGQPVYY-LVPNHIKFQSEIQLLQKLRQRR
ADDB_LACP3        -MGLQFILGDATTDHAGTMATMVQANLQADSQNQIFY-LVPNHIKFEAEVDLLKRLRAQA
ADDB_LACCB        -MGLQFILGDATTDHAGTMATMVQANLQADSQNQIFY-LVPNHIKFEAEVDLLKRLRAQA
ADDB_ENTFA        -MSVQFIRGTAVADLEAPLIQATKQWLEEDAQHEVFY-LVPNHIKFEQEIQVLQKLRQLQ
G4L7W9_TETHN      -MSLQFITGDGSCDHEKVVLDTACDWLAND-HNEVFF-LVPNYNKFEREQEILSQLKHRQ
ADDB_LACAC        --MIKILTGRQTDPVQEKILEEAVKNYQQHPENETFI-IVPNHIKFTTEVRAINKLATSK
ADDB_LACH4        --MIKIITGRQTDPLQEKILATAIENYQQHPENETFI-IVPNHIKFTTEVRAINKLASSK
ADDB_LACGA        --MINVITGRQVDNLQNEIIDQAVKSYYQDKTHDVFI-IVPNHIKFTTEVRALSKLSVLT
ADDB_LACJO        --MINVITGRQVDNLQNEIIDQAVKSYYQDKRHDVFI-IVPNHIKFTTEVRALSKLSVLT
ADDB_LACDA        --MIKIITGRQSDPLQTEIIGRAARNYLAQPGKDTFI-IVPNHIKFNTEVAAIGKVAQLQ
ADDB_LACDB        --MIKIITGRQSDPLQTEIIGRAARNYLAQPGKDTFI-IVPNHIKFNTEVSAIGKVAQLQ
ADDB_LIMRD        MGTLGFVLGTAAMDHQQVLIDQLVDQVKNTPADDTFYYLVPNHIKFETEINVLAGLRDRQ
ADDB_LACRJ        MGTLGFVLGTAAMDHQQVLIDQLVDQVKNTPADDTFYYLVPNHIKFETEINVLAGLRDRQ
ADDB_LEUCK        -MSLTVYMNHGQIDMRHALLSHAHEALNQDNNLTVYY-IVPNHVKFDSEVDVLRRFARLT
D5T5I7_LEUKI      -MGLKIFMNNARTDLRASLLEDVQKNLQQTPNLTVYY-IVPNHVKFDSEVDVLKQFAILN
ADDB_LEUMM        -MSLNVVMGNGQHDLRSEMLTMIQQQFCQNELLTVFY-IVPNHVKFDSEVNVLQRFSIMN
ADDB_LACF3        MATLQFVLGSASFDHQQVMLDRLAAQYQQAP-NDTYLYLVPNHVKFTTEVAVLKGLKKRL
ADDB_OENOB        -MTLEIVRGFADRDFRSELLERIYEKYRIDP-QARFFYIVPNHIKFSAEVDVLKKFGSLL
                     : .            :                   :.*.  .*  *   :  .    

ADDB_LACLM        D-------TAVFDLLVTRFKQLPYYFDKREKATMKTELGTVGLSMLFRRVLRSFKKD---
ADDB_LACLS        D-------TAVFYLLVTRFKQLPYYFDKREKATMKTELGTVGLSMLFRRILRSFKKD---
ADDB_LACLA        D-------SAVFDLLVTRFKQLPYYFDKREKATTKTELGTAGLSMLFRRVLRSFSKE---
ADDB_STRPB        --------RGTFSIIVTRFVQMSRYFTVE-SSPSKQHLDDTTLAMIFYRALMQLKPE---
ADDB_STRPC        --------RGTFSIIVTRFVQMSRYFTVE-SSPSKQHLDDTTLAMIFYRALMQLKPE---
ADDB_STRPM        --------RGTFSIIVTRFVQMSRYFTVE-SSPSKQHLDDTTLAMIFYRALMQLKPE---
ADDB_STRP8        --------RGTFSIIVTRFVQMSRYFTVE-SSPSKQHLDDTTLAMIFYRALMQLKPE---
ADDB_STRP6        --------RGTFSIIVTRFVQMSRYFTVE-SSPSKQHLDDTTLAMIFYRALMQLKPE---
ADDB_STRPG        --------RGTFSIIVTRFVQMSRYFTVE-SSPSKQHLDDTTLAMIFYRALMQLKPE---
ADDB_STRPD        --------RGTFSIIVTRFVQMSRYFTVE-SSPSKQHLDDTTLAMIFYRALMQLKPE---
ADDB_STRPF        --------RGTFSIIVTRFVQMSRYFTVE-SSPSKQHLDDTTLAMIFYRTLMQLKPE---
ADDB_STRPZ        --------RGTFSIIVTRFVQMSRYFTVE-SSPSKQHLDDTTLAMIFYRALMQLKPE---
ADDB_STRP1        --------RGTFSIIVTRFVQMSRYFTVE-SSPSKQHLDDTTLAMIFYRALMQLKPE---
ADDB_STRP3        --------RGTFSIIVTRFVQMSRYFTVE-SSPSKQHLDDTTLAMIFYRALMQLKPE---
ADDB_STRS7        --------QGSFAITVTRFEQMARYFTLA-KAANRQALDDNGLAMIFYRVLMQLQED---
ADDB_STREM        --------QGSFAITVTRFEQMARYFTLA-KAANRQALDDNGLAMIFYRVLMQLQED---
ADDB_STRU0        --------ESSFSITVTRFAQMARYFTLN-KQKAQKSLDDLSLTMLFHLVLHDLSQN---
ADDB_STRA1        --------EASFAITITRFAQLARYFTLN-QPNQKESLNDIGLAMIFYRALASFEDG---
ADDB_STRA5        --------EASFAITITRFAQLARYFTLN-QPNQKESLNDIGLAMIFYRALASFEDG---
ADDB_STRA3        --------EASFAITITRFAQLARYFTLN-QPNQKESLNDIGLAMIFYRALASFEDG---
ADDB_STRMU        --------RASFAITITRFEQMARYFVLN-DIHQGETIDDNGLVMVFYRVLSSFSDQ---
ADDB_STRT2        --------SASFDITVTRFTQMARYFILN-TSNPKTQLDDTGLAMIFYKVLLHMGDD---
ADDB_STRTD        --------SASFDITVTRFTQMARYFILN-TSNPKTQLDDTGLAMIFYKVLLHMGDD---
ADDB_STRGC        --------KASFAITVTRFAQMARYFVLN-DVRKGQSLDDIGLGMLIYRTLTELDDG---
ADDB_STRSV        --------QASFAITVTRFAQMARYFVLN-DVRQGQSLDDIGLGMLIYRTLTELDDG---
ADDB_STRPN        --------QASFSITVTRFAQMARYLVLN-DLPAKTTLDDIGLGLAFYKCLAELDPK---
ADDB_STRR6        --------QASFSITVTRFAQMARYLVLN-DLPAKTTLDDIGLGLAFYKCLAELDPK---
ADDB_STRP2        --------QASFSITVTRFAQMARYLVLN-DLPAKTTLDDIGLGLAFYKCLAELDPK---
ADDB_STRPS        --------QASFSITVTRFAQMARYLVLN-DLPAKTILDDIGLGLAFYKCLAELNPK---
ADDB_STRPI        --------QASFSITVTRFAQMARYLVLN-DLPAKTTLDDIGLGLAFYKCLAELDPK---
ADDB_STRPJ        --------QASFSITVTRFAQMARYLVLN-DLPAKTTLDDIGLGLAFYKCLAELDPK---
ADDB_STRP4        --------QASFSITVTRFAQMARYLVLN-DLPVKTTLDDIGLGLAFYKCLAELDPK---
ADDB_STRSY        --------QATFDIIVTRFGQLARYLMID-RKEAGQPLDDVGLAMIFFRVLSQFEDG---
ADDB_STRS2        --------QATFDIIVTRFGQLARYLMID-RKEAGQPLDDVGLAMIFFRVLSQFEDG---
ADDB_LEVBA        AP-EQA-LFAQTQVQVFSFTRLAWFFMKNEPIYQLPRISPAGLNMLIYQIIQTHADE---
ADDB_LACPL        G--QPD-LYAQTQVQVFSFTRLAWYLMKNEAAYQVPRLSAAGIDMLLYRILQRHADE---
ADDB_LACS1        D--NQD-LFATSNVQTFSFTRLAWYFMKDTATYQVNRITNAGLNMIVYRSLQEHSDE---
ADDB_LACSS        N----D-YVAASQIQVFSLTRLAWYFMKNTPYYQIPRISTAGLNMLVFRLLQEHQEQ---
ADDB_PEDPA        DV-KSH-IFAEKDVQILSISRLAWFFLRNSSIYQYPRVTSSSSNMLLYRVILEHQDE---
ADDB_LACP3        AS-VNG-VYAQNRVQVLSFSRLAWYFLKNTALYQQPRLDRASNTMLVAKILGESKEE---
ADDB_LACCB        AS-VNG-VYAQNRVQVLSFSRLAWYFLKNTALYQQPRLDRASNTMLVAKILGESKEE---
ADDB_ENTFA        TT-TSD-SITSTRLQVFSFYRLAWYYLQHTPFYSADVLSDAGAAMIFRKILVEAEEE---
G4L7W9_TETHN      EK-KD---FSTIRGQVYSFNRLAWYFLQDSENINGQTISDTGSAMIMRKVLLTLSDK---
ADDB_LACAC        N---KS-ETAVKNLHVLSFSRLAWFFLKDAEQGLPTQLDDAASAMLLTHIIEKEKDN---
ADDB_LACH4        K---QT-ETAVKNLHVLSFSRLAWFFLKDAEQGLPTQLDDAASAMLLTHIIEQKQDE---
ADDB_LACGA        N---KK-QVAVNKLHILSFSRLAWYFLKDEAIKLPQILDDAASVMLLEQIVKDHQDE---
ADDB_LACJO        N---KK-QVAVNKLHILSFSRLAWYFLRDEAIKLPQILDDAASVMLLEQIVKDHQDE---
ADDB_LACDA        G---RE-ETSVKNLHVLSFSRLAWFFFKKADLLMPESLDDAAATMILEQIIDKRRDE---
ADDB_LACDB        G---RE-ETSVKNLHVLSFSRLAWFFFKKADLLMPESLDDAAATMILEQIIDKRRDE---
ADDB_LIMRD        GLSGSD-RFASSRVQVLSFSRLAWYLLRDTPAFQKQHLSKIGMAMLTSQVVQEQASD---
ADDB_LACRJ        GLSGSD-RFASSRVQVLSFSRLAWYLLRDTPAFQKQHLSKIGMAMLTSQVVQEQASD---
ADDB_LEUCK        GQNPDTSLYAQSRLQVYSLSRLTWALLKDMATMQPNVIQGTGLFIMVSDILRDYAAQ---
D5T5I7_LEUKI      GKTSKNKFYAQSRLQVYSLTRLAWALLKDMPDAQPNIIQNTGLFIMVSDILREYAAQ---
ADDB_LEUMM        G-NDDSELYAQSRLQVYSLTRLAWALMKNTPDRQPDIVEPTGLFMIVSNILREQSDN---
ADDB_LACF3        KQ---TGNYAQANVAVLSFSRLGWFLCKDDPDYQKPRLSNVGMAMVVAKIIRELKAESPD
ADDB_OENOB        GKNDQE-AQAFSRLQVYSLSRLAWALTKE--RDQKTIISNQSVSILVGQVLRELPIE---
                                    : ::               :      :     :         

ADDB_LACLM        EIPLYFSLQDSAGFLEMLIQLRAELLTANLSVENLPDN----------------------
ADDB_LACLS        EIPLYFSLQDSAGFLEMLIQLRAELLTANLSVENLPDN----------------------
ADDB_LACLA        EIPLYFSLQDSAGFLEMLIQLRTELLTANLSVENLPDS----------------------
ADDB_STRPB        DLPSYGRLQNNSVFIEQLVELYKELKNAQLSVHDLTGLDH--------------------
ADDB_STRPC        DLPSYGRLQNNSVFIEQLVELYKELKNAQLSVHDLTGLDH--------------------
ADDB_STRPM        DLPSYGRLQNNSVFIEQLVELYKELKNAQLSVHDLTGLDH--------------------
ADDB_STRP8        DLPSYGRLQNNSVFIEQLVELYKELKNAQLSVHDLTGLDH--------------------
ADDB_STRP6        DLPSYGRLQNNSVFIEQLVELYKELKNAQLSVHDLTGLDH--------------------
ADDB_STRPG        DLPSYGRLQNNSVFIEQLVELYKELKNAQLSVHDLTGLDH--------------------
ADDB_STRPD        DLPSYGRLQNNSVFIEQLVELYKELKNAQLSVHDLTGLDH--------------------
ADDB_STRPF        DLPSYGRLQNNSVFIEQLVELYKELKNAQLSVHDLTGLDH--------------------
ADDB_STRPZ        DLPSYGRLQNNSVFIEQLVELYKELKNAQLSVHDLTGLDH--------------------
ADDB_STRP1        DLPSYGRLQNNSVFIEQLVELYKELKNAQLSVHDLTGLDH--------------------
ADDB_STRP3        DLPSYGRLQNNSVFIEQLVELYKELKNAQLSVHDLTGLDH--------------------
ADDB_STRS7        ELKVFHRLRTDQAFIAQLVELYKELQAANLTAFDLTTLDR--------------------
ADDB_STREM        ELKVFHRLRTDQAFIAQLVELYKELQAANLTAFDLTTLDR--------------------
ADDB_STRU0        ELTIYHALKSDQTFIKQLVDLFKEMQSANLTIADIEMENL--------------------
ADDB_STRA1        QLKVFGRLKQDASFISQLVDLYKELQTANLSILELKYLHS--------------------
ADDB_STRA5        QLKVFGRLKQDASFISQLVDLYKELQTANLSILELKYLHS--------------------
ADDB_STRA3        QLKVFGRLKQDASFISQLVDLYKELQTANLSILDLKYLHS--------------------
ADDB_STRMU        DLRVFGRLKQDAHFINQLVDLYKELKASNLTVLELNQLNS--------------------
ADDB_STRT2        ELKVYGRLRKDSNFINQLVDLYKELQQANMTVLDLQHLDQ--------------------
ADDB_STRTD        ELKVYGRLRKDSNFINQLVDLYKELQQANMTVLDLQHLNQ--------------------
ADDB_STRGC        ELKVYGRIKKDPQFIQQLMDLYHELQTAQMSFADLEFLEE--------------------
ADDB_STRSV        ELKVYSRIKKDPQFIQQLMDLYHELQTAQMSFADLEFLEE--------------------
ADDB_STRPN        DLRVYGAIKQDPQLIQQLIELYHEMTKSQMSFLDLENLTD--------------------
ADDB_STRR6        DLRVYGAIKQDPQLIQQLIELYHEMTKSQMSFLDLENLTD--------------------
ADDB_STRP2        DLRVYGAIKQDPQLIQQLIELYHEMTKSQMSFLDLENLTD--------------------
ADDB_STRPS        DLRVYGAIKQDPQLIQQLIELYHEMTKSQMNFLDLENLTD--------------------
ADDB_STRPI        DLRVYGAIKQDPQLIQQLIELYHEMTKSQMSFLDLENLTD--------------------
ADDB_STRPJ        DLRVYGAIKQDPQLIQQLIELYHEMTKSQMSFLDLENLTD--------------------
ADDB_STRP4        DLRVYGAIKQDPQLIQQLIELYHEMTKSQMSFLDLENLTD--------------------
ADDB_STRSY        DLKVYGRLQTDFGFINQLVALYKELQRANMSILDLEAMDS--------------------
ADDB_STRS2        DLKVYGRLQTDFGFINQLVALYKELQRANMSILDLEAMDS--------------------
ADDB_LEVBA        LTIFRG-EVDRPGFVSQLATQLAEFKVGQVTAADLMSAIEQL-----DTTNTD-------
ADDB_LACPL        LRLFGG-EISQTGFVTQLAREINELQTANLQPEDVVQLAA-------NAQAGD-------
ADDB_LACS1        LTIFKG-EQTQPGFIAQLVSQLIELQQSCITYDDIERMKENLSQQ-DTADSAE-------
ADDB_LACSS        LQLFRG-EVRHTGFVAQLTKQLLELKIGCITPADLTAMAENLG-----DQQVE-------
ADDB_PEDPA        LTLFHN-IDAQLGLVQKIATQLAEFKQGNVGPDELGRVAENIAE--NSDAGMD-------
ADDB_LACP3        LTIYAG-EAHNTGFVTQLADQLSELVTGRITAEDLNTTVAALTP------GDR-------
ADDB_LACCB        LTIYAG-EAHNTGFVTQLADQLSELVTGRITAEDLNTTVAALTP------GDR-------
ADDB_ENTFA        LQIFRG-EINKPGFIQQLFQLYQEMREGNIEIAELYPFLEKQTE---NPKGQD-------
G4L7W9_TETHN      LIIFRG-EINKEGFIAKLLELYKEFQLGNITI-DMLGFLPSSQE---TTKAKD-------
ADDB_LACAC        LTIFE---TINSGLVQQLYNTILQMYDGNIDLDNIDET----------NLDQE-------
ADDB_LACH4        LIIFE---QSNSGMVRQLYNTILQVYDGNLDLDNIDET----------NLDQE-------
ADDB_LACGA        LKLFQNKNQITSGALRQMYEAILSVRAGNIDLENIDNE----------KLNEE-------
ADDB_LACJO        LKLFQNQTQVTSGALRQMYEAILSVRAGNIELDNIDEK----------KLNEE-------
ADDB_LACDA        LLLFKN-SHANSGMIKQVYSTILQVHTGQLDLGNLLERAADPAV--ALDLDNE-------
ADDB_LACDB        LLLFKN-SHANSGMIKQVYSTILQVHTGQLDLGNLLERAADPAV--ALDLDNE-------
ADDB_LIMRD        LRLYAS-EVKQPGFIQKMTAQLEELKNANITADDLTDIIYRVKSANDPAANQA-------
ADDB_LACRJ        LRLYAS-EVKQPGFIQKMTAQLEELKNANITADDLTDIIYRVKSANDPAANQA-------
ADDB_LEUCK        LPIFAR-MQSKAGFVTTLVAQLVELRASRISPEDLLTILNQESDD-DTFLRQT-------
D5T5I7_LEUKI      LPVFAR-MQSKSGFISALVKQLVELRASHISPQDLLQILNDESHD-DTFLRQT-------
ADDB_LEUMM        LPVFSR-MQTKSGFVSALVAQLVELRASNVTPENLLEVL-EKSAD-NIFLRQT-------
ADDB_LACF3        LLKMFRGESERQGFATEVTKQLVELQNANIQPADLAPDQETGIIKRALASQAGGGRASQS
ADDB_OENOB        KLNIFARSARMPGFVANVAEQLLEIWRSGLTASEILPLHQ--------------------
                                   :     ..  . :   ::                         

ADDB_LACLM        ----PKNQELKKILAKFEAELSV-EYANYSEFGDFTNRLVDGEFDQQLKDVT--IIIDGY
ADDB_LACLS        ----PKNQELKKILTTFEAELSV-EYANYSEFGDFTNRLADGEFDQQLKDVT--IIIDGY
ADDB_LACLA        ----PKNQELKKILSRFEEKLAN-DYANYSEFGDFTSRLADGEFDFQLKDVT--IVIDGY
ADDB_STRPB        ---PQKQEDLIKIIELAETIMIQQDYNQDSPLQSFARAIKLGLLNNQLSKTV--IVIDGF
ADDB_STRPC        ---PQKQEDLIKIIELAETIMIQQDYNQDSPLQSFARAIKLGLLNNQLSKTV--IVIDGF
ADDB_STRPM        ---PQKQEDLIKIIELAETIMIQQDYNQDSPLQSFARAIKLGLLNNQLSKTV--IVIDGF
ADDB_STRP8        ---PQKQEDLIKIIELAETIMIQQDYNQDSPLQSFARAIKLGLLNNQLSKTV--VVIDGF
ADDB_STRP6        ---PQKQEDLIKIIELAETIMIQQDYNQDSPLQSFARAIKLGLLNNQLSKTV--VVIDGF
ADDB_STRPG        ---PQKQEDLIKIIELAETIMIQQDYNQDSPLQSFARAIKLGLLNNQLSKTV--VVIDGF
ADDB_STRPD        ---PQKQEDLIKIIELAETIMIQQDYNQDSPLQSFARAIKLGLLNNQLSKTV--IVIDGF
ADDB_STRPF        ---PQKQEDLIKIIELAETIMIQQDYNQDSPLQSFARAIKLGLLNNQLSKTV--VVIDGF
ADDB_STRPZ        ---PQKQEDLIKIIELAETIMIQQDYNQDSPLQSFARAIKLGLLNNQLSKTV--VVIDGF
ADDB_STRP1        ---PQKQEDLIKIIELAETIMIQQDYNQDSPLQSFARAIKLGLLNNQLSKTV--VVIDGF
ADDB_STRP3        ---PQKQEDLIKIIELAETIMIQQDYNQDSPLQSFARAIKLGLLNNQLSKTV--VVIDGF
ADDB_STRS7        ---PEKQEDLITIMTKAEQLIAQGDYDQSSRLAQLAEAIKSKSLDDELRQTV--LVIDGF
ADDB_STREM        ---PEKQEDLITIMTKAEQLIAQGDYDQSSRLAQLAEAIKSKSLDDELRQTV--LVIDGF
ADDB_STRU0        ---ARK-EDLITIFSALSRELLRYDFQQMSSLAVFQEAIRSGLLDQELAKTV--VIIDGF
ADDB_STRA1        ---PEKFEDLLAIFLVVSDLLREGEYDNQSKIAFFTEQVRSGQLDVDLKNTI--LIVDGF
ADDB_STRA5        ---PEKFEDLLAIFLVVSDLLREGEYDNQSKIAFFTEQVRSGQLDVDLKNTI--LIVDGF
ADDB_STRA3        ---PEKFEDLLAIFLVVSDLLREGEYDNQSKIAFFTEQVRSGQLDVDLKNTI--LIVDGF
ADDB_STRMU        ---AEKQEDLIKIFTEVETILSAGHFDNQSKIAFFAQQIKFGHLDTALQDLT--IVIDGF
ADDB_STRT2        ---VEKQEDLVRIFSAAQDLLLAGDFDNQSKLSAFFKEITSGHLDEALSNTV--LVIDGF
ADDB_STRTD        ---VEKQEDLVRIFSAAQDLLLAGDFDNQSKLSAFFKEITSGHLDEALSNTV--LVIDGF
ADDB_STRGC        ---PEKREDLVKIFTAVATALNKGDFDSSSQIATFAQHILSGDTDEELADLA--LVIDGF
ADDB_STRSV        ---PEKREDLVKIFTAVTAALNKGDFDSSSQIAAFAQHILAGDTDEELADLA--LVIDGF
ADDB_STRPN        ---EDKRADLLLIFEKVTAYLNQGQLAQESQLSHLIEAIENDKVSSDFNQIA--LVIDGF
ADDB_STRR6        ---EDKRADLLLIFEKVTAYLNQGQLAQESQLSHLIEAIENDKVSSDFNQIA--LVIDGF
ADDB_STRP2        ---EDKRADLLLIFEKVTAYLNQGQLAQESQLSHLIEAIENDKVSSDFNQIA--LVIDGF
ADDB_STRPS        ---EDKRADLLLIFEKVTAYLNQGQLAQGSQLSHLIEAIENDKVSSDFNQIA--LVIDGF
ADDB_STRPI        ---EDKRADLLLIFEKVTAYLNQGQLAQGSQLSHLIEAIENDKVSSDFNQIA--LVIDGF
ADDB_STRPJ        ---EDKRADLLLIFEKVTAYLNQGQLAQGSQLSHLIEAIENDKVSSDFNQIT--LVIDGF
ADDB_STRP4        ---EDKRTDLLLIFEKVTAYLNQGQLAQGSQLSHLIEAIENDKVSSDFNQIT--LVIDGF
ADDB_STRSY        ---PDKQADLVKIFLAVTDILSKEGFEHQSKLAQLTGLVETGQLDEQLKNIV--LVVDGF
ADDB_STRS2        ---PDKQADLVKIFLAVTDILSKEGFEHQSKLAQLTGLVETGQLDEQLKNIV--LVVDGF
ADDB_LEVBA        --LQAKLHDLMIIYEAFETQMMGKFVENTDLLNQLATYLEQQ-VDLQHAH----FYLEGF
ADDB_LACPL        --LQAKLHDLAIVYKDFVAATADKYLKPADILVQLNAYLRRQDLHGTHVY----VELAGF
ADDB_LACS1        --LEAKLHDIAIIYRDFMQMTDSKYLKPADILPSLTQYLQNE--DLSNSY----FIIEGF
ADDB_LACSS        --LAKKLHDLTIIATAFEAAMQKRFIENTALIDALTLFLQQQ--TLTDCH----FYVEGF
ADDB_PEDPA        --IKAKLHDLGIIYSAYEEEIQSRFIDASDITHTLTDELSKM--DLSGQS----FIISGF
ADDB_LACP3        --HRAKLRDLGIILDHYEAEI-GPYATNASLLSGLQQVMRNQ--DLSHTF----IYLNDF
ADDB_LACCB        --HRAKLRDLGIILDHYEAEI-GPYATNASLLSGLQQVMRNQ--DLSHTF----IYLNDF
ADDB_ENTFA        --LQLKFQDLTLIFTRFQLQMSQYGYESAEIIQHLSEYLQTVDLSNVQ------FVISGY
G4L7W9_TETHN      --FELKMYEIRLIFTAYEKELAKRNLQIEQPISMLTNFLAASDLQDTAQLNQKLFIVNGF
ADDB_LACAC        --TKSKIHDLRIIYDAYIKEIAGK-FSTKNEVQVELNKVLANN-KSLSNAS---FYFCDF
ADDB_LACH4        --TKSKIHDLRIIYDAFIEEIAGK-FSTKNEVQVQLNDILAKN-SELKNAS---FYFCDF
ADDB_LACGA        --TSYKVHDLQIIYDDFIDRLSEK-FATKDEMQLLLNEFLAKS-DSLSTMV---FYFSDF
ADDB_LACJO        --TSYKIHDLRIIYDEFIERLSEK-FATKDEMQLLLNQFLAKS-NNLSTME---FYFSDF
ADDB_LACDA        --TRDKLHDLDLIYQDFLEIVSEKHFATKDELNIQLNQLLASRPDLVSQAS---FYVTDF
ADDB_LACDB        --TRDKLHDLDLIYQDFLEIVSEKHFATKDELNIQLNQLLASRPDLVSQAS---FYVTDF
ADDB_LIMRD        --WLAKMYDVETIYHAYEARLRDRYIGNSELYRQLVSYLQKSP-EVAKMH----FFIDRF
ADDB_LACRJ        --WLAKMYDVETIYHAYEARLRDRYIGNSELYRQLVSYLQKSP-EVAKMH----FFIDRF
ADDB_LEUCK        --LSGKLRDLAIVADALDKKMGHTYITQQEVLSFFATQLATTQLKNVA------FYFDGF
D5T5I7_LEUKI      --LASKLRDLAIVSDALTRKIGTERITQQEVLPFFATQLAATQLENVA------FYFDNF
ADDB_LEUMM        --LNAKLHDLAIVADDFNARMGENQITGQETLIAFAKQLADLKLSNVA------FYFDGF
ADDB_LACF3        TVFTDKMTVLYEIYRRFEAAVTTHVTAPDR-SAMLLNHLEAADLSTTHVYLD-----RFA
ADDB_OENOB        --FDDRLSEKIKVLALIETKILPSLKDYSLPDDALRNFATQISKIDLKNCNF---YFEGF
                       :      :                                               

ADDB_LACLM        TRFSAEEELFIESIQEKVARFVVGTYSDENSLTA--------GSE--TIYVGTSQMITRF
ADDB_LACLS        TRFSAEEELFIESIQEKVARFVVGTYSDENSLTA--------GSE--TIYVGTSQMITRF
ADDB_LACLA        TRFSAEEELFIESIQDRVARFVIGTYSDENSLTA--------GSE--TIYISTSQMIGRF
ADDB_STRPB        SRFSAEEDYLLSLLNNNCQEVIIGSYVSQKAYQK--------SFIKGNIYEASLHFLQDL
ADDB_STRPC        SRFSAEEDYLLSLLNNNCQEVIIGSYVSQKAYQK--------SFIKGNIYEASLHFLQDL
ADDB_STRPM        SRFSAEEDYLLSLLNNNCQEVIIGSYVSQKAYQK--------SFIKGNIYEASLHFLQDL
ADDB_STRP8        SRFSAEEDYLLSLLNNNCQEVIIGSYVSQKAYQK--------SFIKGNIYEASLHFLQDL
ADDB_STRP6        SRFSAEEDYLLSLLNNNCQEVITGSYVSQKAYQK--------SFIKGNIYEASLHFLQDL
ADDB_STRPG        SRFSAEEDYLLSLLNNNCQEVIIGSYVSQKAYQK--------SFIKGNIYEASLHFLQDL
ADDB_STRPD        SRFSAEEDYLLSLLNNNCQEVIIGSYVSQKAYQK--------SFIKGNIYEASLHFLQDL
ADDB_STRPF        SRFSAEEDYLLSLLNNNCQEVIIGSYVSQKAYQK--------SFIKGNIYEASLHFLQDL
ADDB_STRPZ        SRFSAEEDYLLSLLNNNCQEVIIGSYVSQKAYQK--------SFIKGNIYEASLHFLQDL
ADDB_STRP1        SRFSAEEDYLLSLLNNNCQEVIIGSYVSQKAYQK--------SFIKGNIYEASLHFLQDL
ADDB_STRP3        SRFSAEEDYLLSLLNNNCQEVIIGSYVSQKAYQK--------SFIKGNIYEASLHFLQDL
ADDB_STRS7        TRFSAEEEQLLALLNEACEEIVIGAYISQKAYRL--------AFTKGNLYEASLAFIQQL
ADDB_STREM        TRFSAEEEQLLALLNEACEEIVIGAYISQKAYRL--------AFTKGNLYEASLAFIQQL
ADDB_STRU0        TRFSAEEESLIHQLHQKCQEIVIGTYISSKAMKQ--------NFTKGNLYEASIDFLRQL
ADDB_STRA1        TRFSAEEEALIKSLSSRCQEIIIGAYASQKAYKA--------NFTNGNIYSAGVDFLRYL
ADDB_STRA5        TRFSAEEEALIKSLSSRCQEIIIGAYASQKAYKA--------NFTNGNIYSAGVDFLRYL
ADDB_STRA3        TRFSAEEEALIKSLSSRCQEIIIGAYASQKAYKA--------NFTNGNIYSAGVDFLRYL
ADDB_STRMU        TRFSAEEENLIGLLHEKGVDIIIGTYISQKAYRS--------TFSNGNVYQASLDFIRGL
ADDB_STRT2        TRFSAEEEALVALLNDKCHQIVVGTYTSQKAYKA--------NFVYGNVYQASVDFLRTL
ADDB_STRTD        TRFSAEEEALVALLNDKCHQIVVGTYTSQKAYKA--------NFVYGNVYQASVDFLRTL
ADDB_STRGC        TRFSAEEEYLVGLLHRKGVEIVIGTYASQKAYRA--------AFRDGNLYQASVDFLRKL
ADDB_STRSV        TRFSAEEEYLVGLLHRKGVEIVIGTYASQKAYRA--------AFREGNLYQASVDFLRKL
ADDB_STRPN        TRFSAEEERVVDLLHGKGVEIVIGAYASKKAYTS--------PFSEGNLYQASVKFLHHL
ADDB_STRR6        TRFSAEEERVVDLLHGKGVEIVIGAYASKKAYTS--------PFSEGNLYQASVKFLHHL
ADDB_STRP2        TRFSAEEERVVDLLHGKGVEIVIGAYASKKAYTS--------PFSEGNLYQASVKFLHHL
ADDB_STRPS        TRFSAEEERVVDLLHGKGVEIVIGAYASKKAYTS--------PFSEGNLYQASVKFLHHL
ADDB_STRPI        TRFSAEEERVVDLLHGKGVEIVIGAYASKKAYTS--------PFSEGNLYQASVKFLHHL
ADDB_STRPJ        TRFSAEEERVVDLLHGKGVEIVIGAYASKKAYTS--------PFSEGNLYQASVKFLHHL
ADDB_STRP4        TRFSAEEERVVDLLHGKGVEIVIGAYASKKAYTS--------PFSEGNLYQASVKFLHHL
ADDB_STRSY        SRFSAEEEALVSALNERVSEILIGVYASKKAVQA--------TYAEGNVYQANVDFLRQL
ADDB_STRS2        SRFSAEEEALVSALNERVSEILIGVYASKKAVQA--------TYAEGNVYQANVDFLRQL
ADDB_LEVBA        SQLSAQERQLVAILIQRSASVTVALNLDHGYPQ-------KLPDKTTLFFQSAKLYQQLY
ADDB_LACPL        AQLPAQEQGIVTTMLEQGADVTISLMLDHKVVD-------RAPENGTLFYQSGRLYYRLY
ADDB_LACS1        SQFTAQEQAIISVLLQRAKEVRIDLILNRGVTDI-----EDLSDKQSLFYRSERTYYLLY
ADDB_LACSS        AQFTAQEQALLTTLMQQS-EVQIGFILDRAYPN-------QQPDGLNFFFQAGRTYYNLY
ADDB_PEDPA        SNFTAEEMSLIQALMKANGNVVIDLIMDKFPLY-------EKVSENSLFFENEKIIFKFN
ADDB_LACP3        NVFSASETGLVETMIETAAEVTVSLVLDKPYPA-------APPVAPNLFLPAGRLYHRLY
ADDB_LACCB        NVFSASETGLVETMIETAAEVTVSLVLNKPYPA-------APPVAPNLFLPAGRLYHRLY
ADDB_ENTFA        QQFTARELKLIEVLMAQAGSVKVALLLDKQYPH-------DLPDPRSLFYEAGQTYHQLY
G4L7W9_TETHN      SNFSMQEQELLKVLFDKS---HVCIDLYVDSVH-------TDSDALDLFFDPKQTYHILK
ADDB_LACAC        SHFSLQETLTIKLLIRKAQNVILGFKTKLGDINP-----QAEAGDYDYVIQQTIKRFTSF
ADDB_LACH4        SHFSLQEMLTIQILMRKAKNVTLAFKTRLGNINP-----KAEAGDYDYVIQQTIRRLVSF
ADDB_LACGA        SHFSLQELTSVRLISKKAKNTTLAFKTKIGKIDS-----KAEQGDYDYVVQRTIRQLEHF
ADDB_LACJO        SHFSLQELTSVRLISKKAKNTTLAFKTKIGKIDN-----NAEPGDYDYVVQRTIGQLEHF
ADDB_LACDA        SHFSIQEKMTMQLLAAFASEMTFAFKTADGSVIE-----PA-AGEYDYVVQKTIKDLTGY
ADDB_LACDB        SHFSIQEKMTMQLLAAFASEMTFAFKTADGSVIE-----PA-AGEYDYVVQKTIKDLTGY
ADDB_LIMRD        AQFTANEQQVVDALITNAASTTISLTLDRGYPDQNHPNPQELPPKNNLFYSSAMQFHRLW
ADDB_LACRJ        AQFTANEQQVVDALITNAASTTISLTLDRGYPDQNHPNPQELPPKNNLFYSSAMQFHRLW
ADDB_LEUCK        NGFTSPETQVMIELMARYPVTVALLGDVEKLGSQ---------QPGDLFYKPMTTAQRLA
D5T5I7_LEUKI      NGFTSAEMQVVSQILTHYPTTIALLGDVKKLGYQ---------QAGDVFNKPMQTAQQLV
ADDB_LEUMM        NGFTSAEMMVVNQLITTYPVTMGILGDPEKMGQQ---------REGDVFFKPMTTVEQLS
ADDB_LACF3        GEFSAQEQLIVDALIQRAADTTVSLILDRDYRGR------ELPSQNNLYYRSAKQYQDLL
ADDB_OENOB        SGFTASELSLVKALISADRKTQLGKKSEIVFSLTG--------EQQSDQYGEGNLFYRAN
                    :.  *   :  :                                              

ADDB_LACLM        RNK-FPVELRKIASS-AVNEVYSKLTRILDLDSRFVITDEKIELKAE------DEKYFRI
ADDB_LACLS        RNK-YPVELRKIASS-SVNEVYSKLTRMLDLDSRFVITDEKIELKAE------DEKYFRI
ADDB_LACLA        RSK-FPVELRKMAFS-SVNEVYNKLTKLLDLDSRFAISDQNIEINSA------DAKYFRI
ADDB_STRPB        AQK-YHIKPVFATSNQVFKPAFSRLTQLFEATHDFSQVD--WQLQKN------DLDHFSL
ADDB_STRPC        AQK-YHIKPVFATSNQVFKPAFSRLTQLFEATHDFSQVD--WQLQKN------DLDHFSL
ADDB_STRPM        AQK-YHIKPVFATSNQVFKPAFSRLTQLFEATHDFSQVD--WQLQKN------DLDHFSL
ADDB_STRP8        AQK-YHIKPVFATSNQVFKPAFSRLTQLFEATHDFSQVD--WQLQKN------DLDHFSL
ADDB_STRP6        AQK-YHIKPVFATSNQVFKPAFSRLTQLFEATHDFSQVD--WQLQKN------DLDHFSL
ADDB_STRPG        AQK-YHIKPVFATSNQVFKPAFSRLTQLFEATHDFSQVD--WQLQKN------DLDHFSL
ADDB_STRPD        AQK-YHIKPVFAISNQVFKPAFSRLTQLFEATHDFSQVD--WQLQKN------DLDHFSL
ADDB_STRPF        AQK-YHIKPVFATSNQVFKPAFSRLTQLFEATHDFSQVD--WQLQKN------DLDHFSL
ADDB_STRPZ        AQK-YHIKPVFATSNQVFKPAFSRLTQLFEATHDFSQVD--WQLQKN------DLDHFSL
ADDB_STRP1        AQK-YHIKPVFATSNQVFKPAFSRLTQLFEATHDFSQVD--WQLQKS------DLDHFSL
ADDB_STRP3        AQK-YHIKPVFATSNQVFKPAFSRLTQLFEATHDFSQVD--WQLQKN------DLDHFSL
ADDB_STRS7        AQQ-FQTKPIYTTSEKVFDVSFSRLTQLLEANHDYSKLD--WQLSAK------DKSKVVI
ADDB_STREM        AQQ-FQTKPIYTTSEKVFDVSFSRLTQLLEANHDYSQLD--WQLSAK------DKSKVVI
ADDB_STRU0        SVT-YQVKSLYLSGEKTFKNSFTTMSRLLESQYDYSLTE--LTISED------IKNDVQI
ADDB_STRA1        ATT-FQTKPEFILSKWESKSGFEMISKNIEGKHDFTNSS--HILDDT------AKDCITI
ADDB_STRA5        ATT-FQTKPEFILSKWESKSGFEMISKNIEGKHDFTNSS--HILDDT------AKDCITI
ADDB_STRA3        ATT-FQTKPEFILSKWESKSGFEMISKNIEGKHDFTNSS--HILDDT------AKDCITI
ADDB_STRMU        AGK-FQTKPEYVVSKQEALPAFTKLSQLFESCHDFSDSQ--LVLTDK------DKEHVTI
ADDB_STRT2        AQT-YKVIPDYVTTDKEGNLSFARISRLLESRHDFSTVD--ETVTEQ------DKHALKV
ADDB_STRTD        AQT-YKVIPDYVTTDKEGNRSFARISRLLESRHDFSTVD--ETVTEQ------DKHALKV
ADDB_STRGC        AED-YQVKP-DYIPYAEAEDAFGRISKVLESRYDFSEPA--VEVSET------DRSQLQI
ADDB_STRSV        AED-YQVKP-DYIPHAEAEDAFGRISKILESRYDFSEST--VSLSES------DRSQLQI
ADDB_STRPN        ASK-YQTPAQDCSQTHEKMDSFDKASRLLESSYDFSELA--LDVDEK------DRENLQI
ADDB_STRR6        ASK-YQTPAQDCSQTHEKMDSFDKASRLLESSYDFSELA--LDVDEK------DRENLQI
ADDB_STRP2        ASK-YQTPAQDCSQTHEKMDSFDKASRLLESSYDFSELA--LDVDEK------DRENLQI
ADDB_STRPS        ASK-YQTPAQDCSQTHEKMDSFDKASRLLESSYDFSELA--LDVDEK------DRENLQI
ADDB_STRPI        ASK-YQTPAQDCSQTHEKMDSFDKASRLLESSYDFSELA--LDVDEK------DRENLQI
ADDB_STRPJ        ASK-YQTPAQDCSQTHEKMDSFDKASRLLESSYDFSELA--LDVDEK------DRENLQI
ADDB_STRP4        ASK-YQTPAQDCSQTHEKMDSFDKASRLLESSYDFSELA--LDVDEK------DRENLQI
ADDB_STRSY        SAQ-FQTKA-TYIGQEPVLDSIGKFSKNMEAYYDYSGTM--IDLTPA------DQEKIQL
ADDB_STRS2        SAQ-FQTKA-TYIGQEPVLDSIGKFSKNMEAYYDYSGTM--IDLTPA------DQEKIQL
ADDB_LEVBA        MVA-QANRVPVLID--QQAKTARV-SADLQALDTYWQASQTLSPQP---SAVEKPTHIQI
ADDB_LACPL        QYA-RIRQIPVSQD--IYAETPRV-APGLVALDDFWRGQPQAAT-----GYEEPNTNVHL
ADDB_LACS1        QQA-RKAQVKILND--VYPQELRVETPELQSLAKYWKESTDLKPINV--EKIGDNHNLQV
ADDB_LACSS        QQA-RLNHVPVMMD--QMADSQRL-TPALAALDQFWVSSESPGNRKL--SPVPVADHLHV
ADDB_PEDPA        AWA-HENKVKSLEP--VRLHRVRV-NSDLLKLEKYWIES-SEGQVGG--SKQENNACVTI
ADDB_LACP3        QKA-KTMKVPIRLD--RFAK-PRPLSEGMKHLADWWQTSTNLQPQAP--AQTAQNKEVEL
ADDB_LACCB        QKA-KTMKVPIRLD--RFAK-PRPLSEGMNHLADWWQTSTNLQPQAP--AQTAQNKEVEL
ADDB_ENTFA        QLA-RQKQIPILSDY-VEKKEVLITNPDLQGLNDYWIQSQEHLPPLS--TADWRGDGLFL
G4L7W9_TETHN      NFA-QNQQSHVLFD----KKAPLLSNVSASYLELERCFRQTNHGRYE--QAGALSDHVEI
ADDB_LACAC        LQE-RNINYTVNNF------PLSSKPTNRENLNSLWTESINKVDN--------IKKHVQL
ADDB_LACH4        LQE-RDMDYVASEF------PIPSEPTPREILNSLWTETVSKVDE--------LKQ-VQL
ADDB_LACGA        WQN-QQLNYQTTEF------PL-TKTNPSSLLNGVWTKTNGFDES--------LSKFLQP
ADDB_LACJO        WQN-QQLDYQTQEY------PL-TQTSPSSLLNGVWTKTSGFDER--------LSKFLQP
ADDB_LACDA        FSA-HDFAWERE--------KIASPASPARDLNQAWQ---GQGQP--------DLNNLQL
ADDB_LACDB        FSA-HDFAWERE--------KIASPASPARDLNQAWQ---GQGQP--------DLNNLQL
ADDB_LIMRD        KFG-QMHQKEVKVLQNVAFATTPRVDAELQQVDSYFKRYASEPIGPGEREELLDPQNIQF
ADDB_LACRJ        KFG-QMHQKEVKVLQNVAFATTPRVDAELQQVDSYFKRYASEPIGPGEREELLDPQNIQF
ADDB_LEUCK        QFT-KIANQQVVWQ---VPTQARCLDESIISVMSAWEKLGEYRQFNS----ENKKTNLAA
D5T5I7_LEUKI      YLT-KQANQSVELI---AATKPRQLSHTVNQVLSAWENLGEYRAFSG----EVDKVELQA
ADDB_LEUMM        ITA-RTAQQEVAIT---AATKMRPLSRTAQQVLGAWACLGEYRNFTG----SRDEVHLNV
ADDB_LACF3        NLATQQVGVDVLDPIVLNQPNQRRVSDALVGVEEWMEADARFALPDR---LPAPTDQVGF
ADDB_OENOB        QLF----KNEFSSARVWIVSNIRPLSESQLNFEQSWRELETQGFTSQ----KRSFPQTKI
                                                                              

ADDB_LACLM        WEAENQKVEIERVAKEIRQKIIQG-------AFFKDFTVLVGDPAAYEITLKEVFDLYEI
ADDB_LACLS        WEAENQKVEIERVAKEIRQKISQG-------AFFKDFTVLVGDPAAYEITLKEIFDLYEI
ADDB_LACLA        WEAENQKVEIEGVAKEIRQKISQG-------AFFKDFTVLVGDPAAYEITLKEIFELYEI
ADDB_STRPB        WQCHHQKEEIEHVAKSIRQKLYEG-------YRYKDILVLLGDMDAYQLQIGPIFDKFEI
ADDB_STRPC        WQCHHQKEEIEHVAKSIRQKLYEG-------YRYKDILVLLGDMDAYQLQIGPIFDKFEI
ADDB_STRPM        WQCHHQKEEIEHVAKSIRQKLYEG-------YRYKDILVLLGDMDAYQLQIGPIFDKFEI
ADDB_STRP8        WQCHHQKEEIEHVAKSIRQKLYEG-------YRYKDILVLLGDMDAYQLQIGPIFDKFEI
ADDB_STRP6        WQCHHQKEEIEHVAKSIRQKLYEG-------YRYKDILVLLGDMDAYQLQIGPIFDKFEI
ADDB_STRPG        WQCHHQKEEIEHVAKSIRQKLYEG-------YRYKDILVLLGDMDAYQLQIGPIFDKFEI
ADDB_STRPD        WQCHHQKEEIEHVAKSIRQKLYEG-------YRYKDILVLLGDMDAYQLQIGPIFDKFEI
ADDB_STRPF        WQCHHQKEEIEHVAKSIRQKLYEG-------YRYKDILVLLGDMDAYQLQIGPIFDKFEI
ADDB_STRPZ        WQCHHQKEEIEHVAKSIRQKLYEG-------YRYKDILVLLGDMDAYQLQIGPIFDKFEI
ADDB_STRP1        WQCHHQKEEIEHVAKSIRQKLYEG-------YRYKDILVLLGDMDAYQLQIGPIFDKFEI
ADDB_STRP3        WQCHHQKEEIEHVAKSIRQKLYEG-------YRYKDILVLLGDMDAYQLQIGPIFDKFEI
ADDB_STRS7        WQALNQKEELEYVAKAIREKLYQG-------YRYKDMLVLLGDVASYQLQIGPIFEKFEI
ADDB_STREM        WQALNQKEELEHVTKAIREKLYQG-------YRYKDMLVLLGDVASYQLQIGPIFEKFEI
ADDB_STRU0        WQQLNQKEEIENIARDIRQKLNEG-------YRYKDILVLLGDVEAYQLQVGPIFDKYDI
ADDB_STRA1        WECINQKDEVEHVARAIRQKLYQG-------YRYKDILVLLGDVDSYKLQLSKIFEQYDI
ADDB_STRA5        WECINQKDEVEHVARAIRQKLYQG-------YRYKDILVLLGDVDSYKLQLSKIFEQYDI
ADDB_STRA3        WECINQKDEVEHVARAIRQKLYQG-------YRYKDILVLLGDVDSYKLQLSKIFEQYDI
ADDB_STRMU        WDVINQKEEVEHVAKSIRRKLYEG-------HRYKDILVLLGDADAYKLQIGKIFDKYEI
ADDB_STRT2        WEVVNQKEEVAQVAKSIRQLLADG-------KRYKDILVLLGDEESYKLHVGQIFRKFDI
ADDB_STRTD        WEVVNQKEEVAQVAKSIRQLLADG-------KRYKDILVLLGDEESYKLHVGQIFRKFDI
ADDB_STRGC        WATMNQKEELEYVAKSIRQRVHDG-------VRYKDIRLLFGDVEAYQLQLKTIFDQYQI
ADDB_STRSV        WATMNQKEELEYVAKSIRQRVHEG-------VRYKDIRLLLGDVEAYQLQLKTIFDQYQI
ADDB_STRPN        WSCLTQKEELELVARSIRQKLHENS-----DLSYKHFRILLGDVASYQLSLKTIFDQYQI
ADDB_STRR6        WSCLTQKEELELVARSIRQKLHENS-----DLSYKHFRILLGDVASYQLSLKTIFDQYQI
ADDB_STRP2        WSCLTQKEELELVARSIRQKLHENS-----DLSYKHFRILLGDVASYQLSLKTIFDQYQI
ADDB_STRPS        WSCLTQKEELELVARSIRQKLHENS-----DLSYKHFRILLGDVASYQLSLKTIFDQYQI
ADDB_STRPI        WSCLTQKEELELVARSIRQKLHENS-----DLSYKHFRILLGDVASYQLSLKTIFDQYQI
ADDB_STRPJ        WSCLTQKEELELVARSIRQKLHENS-----DLSYKHFRILLGDVASYQLSLKTIFDQYQI
ADDB_STRP4        WSCLTQKEELELVARSIRQKLHENS-----DLSYKHFRILLGDVASYQLSLKTIFDQYQI
ADDB_STRSY        WEVVNQKEEVEQVATAIRQHVHQG-------ARYKDILLLLGDVDSYKLQIGKIFDKYDI
ADDB_STRS2        WEVVNQKEEVEQVATAIRQHVHQG-------ARYKDILLLLGDVDSYKLQIGKIFDKYDI
ADDB_LEVBA        VQAANRYVEVSRVATQIRQLVA------TGNYRYRDFLVLTRHLDAYQTVIDPIFQAQAV
ADDB_LACPL        FRTDSRQTELAQVGRMIRAMVAKKHADPADDYHYRDFLIMTRHLDAYQTMLAPTFHELEI
ADDB_LACS1        IKADTRMTEIKEIATRIKQMVA------LKDYRYADFLLLTPDLNKYRNIIEPIFNDYKV
ADDB_LACSS        VAAENRYAELRYVAREIRRLVQ------TGHYRYRDFLILTRHLAPYQTMIAPILTEYEI
ADDB_PEDPA        FQANSRYAEVEHVATLIRQKMAK-----DPSLKFSDFSVLTRHLSDYSTIIKPIFDQMEL
ADDB_LACP3        AVATDPYHELRTVARQIYQAVR-------QGARYRDFLILARRLDPYAAVIPAIFEEFNI
ADDB_LACCB        AVATDPYHELRTVARQIYQAVR-------QGARYRDFLILARRLDPYAAVIPAIFEEFNI
ADDB_ENTFA        WRAENVKEELTHVATEIRRLVVEEGYR------YKEIQVLTRDLDCYENLLEPIFAEHEI
G4L7W9_TETHN      WKAENPEEELRQVATEIRRLVSLSFTKGNKPLYYRDIQLLTLNPELYYSFIPSIFEELDI
ADDB_LACAC        VKADSRYAEAYFVARSIYQQVAL------GNYRYHDFLILAPDLKEYETYLTPILRQNKI
ADDB_LACH4        VKADSRYAEAYFVARTIYQQVAL------NNYRYRDFLILAPDLKEYETYLTPILRQNNI
ADDB_LACGA        VKADSRYAEAYFVARTIYQQVAL------NNYRYQDFLVLAPNLNEYETYLTPILRQNNI
ADDB_LACJO        VKADSRYAEAYFVARTIYQQVAL------NNYRYQDFLVLAPNLSEYETYLTPILRQNQI
ADDB_LACDA        VKADSRYAEAYFVARTIYDEVAL------KGCQYRDFLVLAPNLQEYETYLAPILRQNQI
ADDB_LACDB        VKADSRYAEAYFVARTIYDEVAL------KGCQYRDFLVLAPNLQEYETYLAPILRQNQI
ADDB_LIMRD        MTTTNRMTELNNVATQIRQLVAS------GKYRYRDFLILSRHLDGYQTMIEPVFAAHNI
ADDB_LACRJ        MTTTNRMTELNNVATQIRQLVAS------GKYRYRDFLILSRHLDGYQTMIEPVFAAHNI
ADDB_LEUCK        FVAENTMVEIQEVARRIRQLLVA-----QPDLRLRDILILARDLTPYTGHIPEVMQQFDL
D5T5I7_LEUKI      FAAENTVVEMQEIARRVRRLLVE-----QPTLRLRDILILARDLTPYTAHIPEVMSQFDL
ADDB_LEUMM        FAAENPITEIKEVARRIRRSLVD-----DPTLHLRDIIILSRDLTPYQAHIEAVMSQFEL
ADDB_LACF3        FTAPTRVAELNRVATKIRQLVATG------QYRYRDFLVVTRHLDGYQTMLEPIFSRHQI
ADDB_OENOB        VVSSDQEHEIDFVARSIRQRLVDNP-----KLRAKDILVLAQRLDGYKNIIPKIFDRYDL
                          *   :   :   :              .: ::      *   :   :    :

ADDB_LACLM        PFFYAQEESMSQHPLVIFFESLFAIKKN---NYRTDDVVNLLKSKVYTDANLDEE-----
ADDB_LACLS        PFFYAQEESMSQHPLVIFFESLFAIKKN---NYRTDDVVNLLKSKVYTDVNLDEE-----
ADDB_LACLA        PFFYAQEESMSQHPLVIFFESLLSIKKN---NYGTDDVVNLLKSKVYTDVNLDEE-----
ADDB_STRPB        PYYLGKAEPMAAHPLVQFIESLERSQRY---NWRREDILNMLKSGLFGCFDDSD------
ADDB_STRPC        PYYLGKAEPMAAHPLVQFIESLERSQRY---NWRREDILNMLKSGLFGCFDDSD------
ADDB_STRPM        PYYLGKAEPMAAHPLVQFIESLERSQRY---NWRREDILNMLKSGLFGCFDDSD------
ADDB_STRP8        PYYLGKAEPMAAHPLVQFIESLERSQRY---NWRREDILNMLKSGLFGCFDDSD------
ADDB_STRP6        PYYLGKAEPMAAHPLVQFIESLERSQRY---NWRREDILNMLKSGLFGCFDDSD------
ADDB_STRPG        PYYLGKAEPMAAHPLVQFIESLERSQRY---NWRREDILNMLKSGLFGCFDDSD------
ADDB_STRPD        PYYLGKAEPMAAHPLVQFIESLERSQRY---NWRREDILNMLKSGLFGCFDDSD------
ADDB_STRPF        PYYLGKAEPMAAHPLVQFIESLERSQRY---NWRREDILNMLKSGLFGCFDDSD------
ADDB_STRPZ        PYYLGKAEPMAAHPLVQFIESLERSQRY---NWRREDILNMLKSGLFGCFDDSD------
ADDB_STRP1        PYYLGKAEPMAAHPLVQFIESLERSQRY---NWRREDILNMLKSGLFGCFDDSD------
ADDB_STRP3        PYYLGKAEPMAAHPLVQFIESLERSQRY---NWRREDILNMLKSGLFGCFDDSD------
ADDB_STRS7        PYYIGKQEPMSAHPLVQFVESLERGRRY---NWRREDIVNLLKSGLFGRFQEGE------
ADDB_STREM        PYYIGKQEPMSAHPLVQFVESLERGRRY---NWRREDIVNLLKSGLFGRFQEGE------
ADDB_STRU0        PYYLGKAESMSHHPLVQFMDSLENCRRY---NWRKEDIINLLKSRMLGDFTIRE------
ADDB_STRA1        PYYFGKAETMAAHPLVHFMDSLSRIKRY---RFRAEDVLNLFKTGIYGEISQDD------
ADDB_STRA5        PYYFGKAETMAAHPLVHFMDSLSRIKRY---RFRAEDVLNLFKTGIYGEISQDD------
ADDB_STRA3        PYYFGKAETMAAHPLVHFMDSLSRIKRY---RFRAEDVLNLFKTGIYGEISQDD------
ADDB_STRMU        PYYFGKAESMSSHPLVHFVDSLERVKRY---NFRAEDVMNLLKSGLYGKIRQNQ------
ADDB_STRT2        PYYFGKEESMSSHPLVEFVDSLERIKRY---NYRAEDLLNLVKSGLYGGFAQED------
ADDB_STRTD        PYYFGKEESMSSHPLVEFVDSLERIKRY---NYRAEDLLNLVKSGLYGGFAQED------
ADDB_STRGC        PYYLGRSESMAQHPLVQFVESLERLKRY---NFQLEDLLNLLKTGIYGDLTQEE------
ADDB_STRSV        PYYLGRSESMAQHPLVQFVESLERLKRY---NFQLEDLLNLLKTGLYGDLTQEE------
ADDB_STRPN        PFYLGRSEAMAHHPLTQFVESILALKRY---RFRQEDLINLLRTDLYTDLSQSD------
ADDB_STRR6        PFYLGRSEAMAHHPLTQFVESILALKRY---RFRQEDLINLLRTDLYTDLSQSD------
ADDB_STRP2        PFYLGRSEAMAHHPLTQFVESILALKRY---RFRQEDLINLLRTDLYTDLSQSD------
ADDB_STRPS        PFYLGRSEAMAHHPLTQFVESILALKRY---RFRQEDLINLLRTDLYTDLSQSD------
ADDB_STRPI        PFYLGRSEAMAHHPLTQFVESILALKRY---RFRQEDLINLLRTDLYTDLSQSD------
ADDB_STRPJ        PFYLGRSEAMAHHPLTQFVESILALKRY---RFRQEDLINLLRTDLYTDLSQSD------
ADDB_STRP4        PFYLGRSEAMAHHPLTQFVESILALKRY---RFRQEDLINLLRTDLYTDLSQSD------
ADDB_STRSY        PYYFGKAEEMSHHPLVHFVESLERLRRY---RFRAEDLLNLLKSGLYASISQKE------
ADDB_STRS2        PYYFGKAEEMSHHPLVHFVESLERLRRY---RFRAEDLLNLLKSGLYASISQKE------
ADDB_LEVBA        PYFDDADIRMADHPFVELLNALFDVQRR---NYRYADVFRVLKSELLLPRDAD-------
ADDB_LACPL        PYFVDLQRSMADHPLVELINALFDIDAQ---QYQYRDVMRVLKTELLMP-NIN-------
ADDB_LACS1        PIFVDLAKKMIDHPLVELLTALFNVKAR---HYRYVDMMRLLKTELLIPKTEY-------
ADDB_LACSS        PYFCDLPQTMAAHPLVSLLEKLLDVNLH---FYRYEDVMALLKTELLIP-----------
ADDB_PEDPA        PIFYDLQIAMKDHPLLELINALFDIRAH---HFRYEDVMRLLKTGLLFPETED-------
ADDB_LACP3        PQFTDLERPMKDHPLVVLIESLFAIQDH---DYQYQDVMRLLHTELLLP-----------
ADDB_LACCB        PQFTDLERPMKDHPLVVLIESLFAIQDH---DYQYQDVMRLLHTELLLP-----------
ADDB_ENTFA        PVYVDRDMAMDRHPLVEWIESLFAIHSY---NYRYRDVLRFLRTELFMPMNQLATSEESL
G4L7W9_TETHN      PFYLDEDRQMKQHPLVEFIQALFALDNY---YYRTSDVFRFLRTELYIPKQLQEDTQ---
ADDB_LACAC        PFFNDLQQEMKYHPLVVLIESLFNMYDEKTISLNTQSIIAILKTHLMIPSWYKE------
ADDB_LACH4        PFFNDLQQEMKYHPLVVLIENLFNLRDLKENPFQTQSMLAILKTHLLIPSWYKE------
ADDB_LACGA        PFFNDLQKEMKYHPLVVAVENLQQIFKR---GFQTDNVIALMKTQLFIPEWYKS------
ADDB_LACJO        PFFNDLQREMKYHPLVVAVENLQQIFKR---GFQTDNVIALMKTQLFIPDWYKN------
ADDB_LACDA        PFFDDLQQQMKYHPLVLLLENLGKLLQQ---AGDTPALLSIMKTRLLIPDWYLEGDA---
ADDB_LACDB        PFFDDLQQQMKYHPLVLLLENLGKLLQQ---AGDTPALLSIMKTRLLIPDWYLEGDA---
ADDB_LIMRD        PVFNDHERLMDNHPLVTLLTTLLELPQR---GYRTADIIQLLKTWLLVPRTGTG------
ADDB_LACRJ        PVFNDHERLMDNHPLVTLLTTLLELPQR---GYRTADIIQLLKTWLLVPRTGTG------
ADDB_LEUCK        PYFLDTDQKMTNHPLVELLLNLLRPAKE---RFQYQQVMAILKTGLLRPYTDGSLVP---
D5T5I7_LEUKI      PYFLDTDQKMVNHPLVELILNLLVPAKD---RFQYQNVMTVLKTSLLRPYNQTSLVP---
ADDB_LEUMM        PYFLDMDVNMMNHPLVELILNLLAPNK-----FQYQTMLAILKTGLLRPTFENKIVS---
ADDB_LACF3        PVFNDNQRPMATSPLATFTAALFKVLKD---YYQEADVMELLKTGLLVPETPEELQQE--
ADDB_OENOB        PYFLDKDTRMSDHPLASLAENLLGSSNE----FAYERIMKIFRTGLLSWQLEDN------
                  * :      *   *:      :               :. ..:: :              

ADDB_LACLM        ------------VIDYFEYYVQKYKISGRKKFTEEFI-------ESEFSQ----------
ADDB_LACLS        ------------VIDYFEYYVQKYKISGRKKFTEEFI-------ESEFSQ----------
ADDB_LACLA        ------------VIDYFEYYVQKYKISGRKKFTEAFN-------ESEFSK----------
ADDB_STRPB        -------------IDRFEEYTQFADIKGFTKFSKPFT-------INSSRQ----------
ADDB_STRPC        -------------IDRFEEYTQFADIKGFTKFSKPFT-------INSSRQ----------
ADDB_STRPM        -------------IDRFEEYTQFADIKGFTKFSKPFT-------INSSRQ----------
ADDB_STRP8        -------------IDRFEEYTQFADIKGFTKFSKPFT-------INSSRQ----------
ADDB_STRP6        -------------IDRFEEYTQFADIKGFTKFSKPFT-------INSSRQ----------
ADDB_STRPG        -------------IDRFEEYTQFADIKGFTKFSKPFT-------INSSRQ----------
ADDB_STRPD        -------------IDRFEEYTQFADIKGFTKFSKPFT-------INSSRQ----------
ADDB_STRPF        -------------IDRFEEYTQFADIKGFTKFSKPFT-------INSSRQ----------
ADDB_STRPZ        -------------IDRFEEYTQFADIKGFTKFSKPFT-------INSSRQ----------
ADDB_STRP1        -------------IDRFEEYTQFADIKGFTKFSKPFT-------INSSRQ----------
ADDB_STRP3        -------------IDRFEEYTQFADIKGFTKFSKPFT-------INSSRQ----------
ADDB_STRS7        -------------LDQLEQYLVFADIQGFTKFSRPFT-------LNSSRQ----------
ADDB_STREM        -------------LDQLEQYLVFADIQGFTKFSRPFT-------LNSSRQ----------
ADDB_STRU0        -------------CDQFESYLNYADINGFTAFSKDFT-------ANTFNQKNEKG-----
ADDB_STRA1        -------------LDYFEAYISYADIKGPKKFFTDFV-------VGAK-K----------
ADDB_STRA5        -------------LDYFEAYISYADIKGPKKFFTDFV-------VGAK-K----------
ADDB_STRA3        -------------LDYFEAYISYADIKGPKKFFTDFV-------VGAK-K----------
ADDB_STRMU        -------------LDKLEQYVIYADIKGKTKFFKDFT-------LDNHGQ----------
ADDB_STRT2        -------------LDLFEYYVNFADIKGRHKFLSDFT-------ANSRDK----------
ADDB_STRTD        -------------LDLFEYYVNFADIKGRHKFLSDFT-------ANSRDK----------
ADDB_STRGC        -------------LDHFEQYLRFADIKGAVKLAKDFT-------ANSQGK----------
ADDB_STRSV        -------------LDHFEQYLRFADIKGAGKLAKDFT-------ANSQGK----------
ADDB_STRPN        -------------IDAFEQYIRYLGINGLPAFQQTFT-------KSHHGK----------
ADDB_STRR6        -------------IDAFEQYIRYLGINGLPAFQQTFT-------KSHHGK----------
ADDB_STRP2        -------------IDAFEQYIRYLGINGLPAFQQTFT-------KSHHGK----------
ADDB_STRPS        -------------IDAFEQYIRYLGINGLPAFQQTFT-------KSHHGK----------
ADDB_STRPI        -------------IDAFEQYIRYLGINGLPAFQQTFT-------KSHHGK----------
ADDB_STRPJ        -------------IDAFEQYIRYLGINGLPAFQQIFT-------KSHHGK----------
ADDB_STRP4        -------------IDAFEQYIRYLGINGLPAFQQIFT-------KSHHGK----------
ADDB_STRSY        -------------LDLFESYILFADMKGQAAFSRAFS-------VNGRADYDAEVIKEKR
ADDB_STRS2        -------------LDLFESYILFADMKGQAAFSRAFS-------VNGRADYDAEVIKEKR
ADDB_LEVBA        -GELMAVPAYRQALALTENFVLKNGLEGQHWWTQDK------DWVYNRFAVGDGGVQTTR
ADDB_LACPL        -GQPMDRQAYRQAVDLTENFILKSGYHGQRWVQRE-------DWQYFQLTEGDAGVETDQ
ADDB_LACS1        -G-YLGIKQFRQDLDLTENLILKFGFEGSQWLRKD-------DWVYYRFGSSDFGTQTDV
ADDB_LACSS        --KGMSIAEFRADLDLCENLILKNGYEGKDWLNDF-------DWQFYRFGSYQEGTRTTQ
ADDB_PEDPA        ---DPHGMDFFKSVHITENYVLKQGIYGDRWLQKK-------DWKYSRFNDIDEEKQTDE
ADDB_LACP3        --ENMDIAAFRDALDTTDNHLVRTGITGKKRWTQTD------PWRYFQRNPNADDSQLDP
ADDB_LACCB        --ENMDIAAFRDALDTTDNHLVRTGITGKKRWTQTD------PWRYFQRNPNADDSQLDP
ADDB_ENTFA        TDWLNQRNAWRRKVDITENVVLAYGYEGYYWSQEK-------DWEFIRYDFEAE--EQED
G4L7W9_TETHN      -DWQKARDKYRWIVDITENQALAHNFHGADWTREQ-------DWRLFNFDFEKE--ELID
ADDB_LACAC        ------EAEFIHDVDELENFVLAHGIEHNLWQRPFS------HFVNAEV----IRLDKM-
ADDB_LACH4        ------EAEYIHDVDELENFVLAHGINHNLWKKHFA------DFVSAEV----IRLDKI-
ADDB_LACGA        ------VARYQNDVDLLENFVLAHGIKGELWKKPLK------SFVDAEV----IALDKS-
ADDB_LACJO        ------SARYQNDVDLLENFVLAHGIKGKLWTKSLK------SFVDADV----IALDKS-
ADDB_LACDA        ---EAGEAAYLRDIDQLENFALAHGIKYSLWQKPLK------DFTKAQV----IALDQEQ
ADDB_LACDB        ---EAGEAAYLRDIDQLENFALAHGIKYSLWQKPLK------DFTKAQV----IALDQEQ
ADDB_LIMRD        --DLMGLSDFQAAVFTTENWCLKQAIEGKNAWTTNDPEKIKQLWQAPGTNLTDPKYEQSR
ADDB_LACRJ        --DLMGLSDFQAAVFTTENWCLKQAIEGKNAWTTNDPEKIKQLWQAPGTNLTDPKYEQSR
ADDB_LEUCK        ------EGDFFDIVSYLDNYLYANQPFERTWRDLDHP---FTLFTVSEDEDDEDARVVLD
D5T5I7_LEUKI      ------EDEFFDVVSYFDNYLYANRPYEKTWRNLEKP---FELFTVVGQIDDDDATIVSD
ADDB_LEUMM        ------HDEFFDIVSHMDNYLYAYRPYESRWRDFSRP---FKLFQVTR---DDDDTEISE
ADDB_LACF3        GRAKRNPNTFMTAVYRTENYCLKFGKGGRSWFDERPWRLEGEQPESDALK----------
ADDB_OENOB        ---------FQTALDYLENYLLANNPKEKNWRQEEFQ-------LIQISDEQDLNDDHKI
                                   :                                          

ADDB_LACLM        ----IELVNEMREKLLGSESPLQVFLGNNRKKTGKKWVSDLQGLLENGNVMTNMNAYFSA
ADDB_LACLS        ----IELVNEMREKLLGSESPLQVFLGNNRQKTGKKWVSDLQALLENGNVMANMNAYFSA
ADDB_LACLA        ----IELVNQLRENLLGNDSPLQVFLGTNRQKTGKKWVSDLQVLLENGNVMANMNTYFSE
ADDB_STRPB        --YPLDFLNEMRQDIV---LPLQELFK-SQKQLGASLIDKLILFLEKIRLAENMQGLAQS
ADDB_STRPC        --YPLDFLNEMRQDIV---LPLQELFK-SQKQLGASLIDKLILFLEKIRLAENMQGLAQS
ADDB_STRPM        --YPLDFLNEMRQDIV---LPLQELFK-SQKQLGASLVDKLILFFKKIRLAENMQGLAQS
ADDB_STRP8        --YPLDFLNEMRQDIV---LPLQELFK-SQKQLGASLVDKLILFLKKIRLAENMQGLAQS
ADDB_STRP6        --YPLDFLNEMRQDIV---LPLQELFK-SQKQLGASLVDKLILFLKKIRLAENMQGLAQS
ADDB_STRPG        --YPLDFLNEMRQDIV---LPLQELFK-SQKQLGASLVDKLILFLKKIRLAENMQGLAQS
ADDB_STRPD        --YPLDFLNEMRQDIV---LPLQELFK-SQKQLGASLVDKLILFLKKIRLAENMQGLAQS
ADDB_STRPF        --YPLDFLNEMRQDIV---LPLQELFK-SQKQLGASLVDKLILFLKKIRLAENMQGLAQS
ADDB_STRPZ        --YPLDFLNEMRQDIV---LPLQELFK-SQKQLGASLVDKLILFLKKIRLAENMQGLAQS
ADDB_STRP1        --YPLDFLNEMRQDIV---LPLQELFK-SQKQLGASLVDKLILFLKKIRLAENMQGLAQS
ADDB_STRP3        --YPLDFLNEMRQDIV---LPLQELFK-SQKQLGASLVDKLILFLKKIRLAENMQGLAQS
ADDB_STRS7        --YPLPLLNQLRLAVV---TPLQQLFK-SQKQLGASLLDKLMTFFKTIQLADNFEALAGS
ADDB_STREM        --YPLPLLNQLRLAVV---TPLQQLFK-SQKQLGASLLDKLMTFFKTIQLADNFEALAGS
ADDB_STRU0        --YDLDKINLIRKYLF---SHLNQFFK-SRAQKGSNILNHFLQFLSDIDFVSSFQRLSQK
ADDB_STRA1        --FDLGRLNTIRQSLL---TPLESFVK-TKKQDGIKTLNQFMFFLTQVGLSDNLSRLVGQ
ADDB_STRA5        --FDLGRLNTIRQSLL---TPLESFVK-TKKQDGIKTLNQFMFFLTQVGLSDNLSRLVGQ
ADDB_STRA3        --FDLGRLNTIRQSLL---APLESFVK-TKKQDGIKTLNQFMFFLTQVGLSDNLSRLVGQ
ADDB_STRMU        --FDLKALNKLRAEVM---SPLQELIK-IQAQKGDSILQKLTNFLEAISLTNNFSKLIQG
ADDB_STRT2        --YNLDQINALRSQLI---EPLDKFLN-SRKQKGSSLLKKLVVFLEAVQLPSQMFELSTK
ADDB_STRTD        --YNLDQINALRSQLI---EPLDKFLN-SRKQKGSSLLKKLVVFLEAVQLPSQMFELSTK
ADDB_STRGC        --FDLDRLNHIRRRVM---APLQDFFK-SRSQTASGLLAKFTEFVQAARLSDNLTALLQE
ADDB_STRSV        --FDLDCLNHIRRRVM---TPLQDFFK-SRSQTASGLLAKFTEFVQAARLSDNLTALLQG
ADDB_STRPN        --FNLERLNVLRLRIL---APLETLFA-SRKQKAEKLLQKWSVFLKEGAVTKQLQDLTTT
ADDB_STRR6        --FNLERLNVLRLRIL---APLETLFA-SRKQKAEKLLQKWSVFLKEGAVTKQLQDLTTT
ADDB_STRP2        --FNLERLNVLRLRIL---APLETLFA-SRKQKAEKLLQKWSVFLKEGAVTKQLQDLTTT
ADDB_STRPS        --FNLERLNVLRLRIL---APLETLFA-SRKQKAENLLQKWSVFLKEGAVTKQLQDLTTT
ADDB_STRPI        --FNLERLNVLRLRIL---APLETLFA-SRKQKAENLLQKWSVFLKEGAVTKQLQDLTTT
ADDB_STRPJ        --FNLERLNVLRLRIL---APLETLFA-SRKQKAENLLQKWSVFLKEGAVTKQLQDLTTT
ADDB_STRP4        --FNLERLNVLRLRIL---APLETLFA-SRKQKAENLLQKWSVFLKEGAVTKQLQDLTTT
ADDB_STRSY        LVYDLTVLEPLRAKIM---EPLNQLFK-AGPQSGTALLEKFMAFLEAIDLPKNMEKMSRN
ADDB_STRS2        LVYDLTVLEPLRAKIM---EPLNQLFK-AGPQSGTALLEKFMAFLEAIDLPKNMEKMSRN
ADDB_LEVBA        DDQISAQINRIRRFVKQTLPPFFARLK--VAATYTDAAAVLYQFVANAGVSERLMTWRDQ
ADDB_LACPL        NAEISRQINLIHHFVAETLPPFFKKMR--QAPDGKAAVTLLVNFLTSQGVTDQLLAWRDQ
ADDB_LACS1        QEKITKQVNVIRRYIKEILPPFFKQLD--EAENGKEAAQILMNFLIINGVPEQLINWRNK
ADDB_LACSS        DEALTERINGIRRYVQATLPPFYRALK--AAKTGRQVVQVLYQFLIDHGVDRQLLHWRDQ
ADDB_PEDPA        EIEINQRINTVKNYVAETVVPFFNQLS--TATTGVEAAKALYDFLIKNGIDQCLLAWRDQ
ADDB_LACP3        EADKTAQINAIKTLVADTVPQLLRQWQ--TAKTGREAAASLYQWLQTTGVIDQLNVWRQT
ADDB_LACCB        EADKTAQINAIKTLVADTVPQLLRQWQ--TAKTGREAAASLYQWLQTTGVIDQLNVWRQT
ADDB_ENTFA        VATMEEESNAIRQSLQRLLPSYFQAMI--SAKTGLEAATVFYHFLLQSGVATQLKMWRLQ
G4L7W9_TETHN      TENTEVLTNQLRNNFRNDIVSFFISLK--AADTTKEAIIIFYQFLQKIGVEQQLIYWREQ
ADDB_LACAC        -DEEIAKLNRLREFLINKITELLEKLK--KEESSQKALTMFFDFLTNNGIASRLEQWRND
ADDB_LACH4        -DEEVAKIDRLRGYLVDKVTNLFTKLE--QEKDSQKALTIFFDFLTKNGIAERLEQWRDA
ADDB_LACGA        -EQEVEELDRLRKYFISILSEFFEDIE--TEKDPQAGVTIFWNFLIKNRVAKRLEAWRKE
ADDB_LACJO        -EKEVEDLDRLRDYFIDALTKFFEQLD--KEEDPQAGVTVFWNFLIKNRVAKRLESWRKE
ADDB_LACDA        YQKWLDRLDKLRDFFVSKISRLARQLK--SEKDSMTAVKLFFDFLVKNGVSARLEAWRLK
ADDB_LACDB        YQKWLDRLDKLRDFFVSKISRLARQLK--SEKDSMTAVKLFFDFLVKNGVSARLEAWRLK
ADDB_LIMRD        LEKLNDQLALVKDFVANHLLPVFDQFK--QAQTGQELATALYQFLAAMGVTDRLYAWQ-Q
ADDB_LACRJ        LEKLNDQLALVKDFVANHLLPVFDQFK--QAQTGQELATALYQFLAAMGVTDRLYAWQ-Q
ADDB_LEUCK        DKTVNRRIETLRRFVIDAFDSLQQQLN--QAQTMRQAATLIILWLEKYHVTEAILSQRDT
D5T5I7_LEUKI      DAITNRRIETLRRFVLTAFDALQVALD--QAKTTQLAATNLVTWLQNFHVVDAITEQRDA
ADDB_LEUMM        DEKVNNRLEYLRHFIVEAFDELDDGFA--MAKNLRQSVTHLVLWLQKYHVTDALLEQRDD
ADDB_LACF3        --RQNAQINWVKNYIKDELAPALADLQ--TATTGRELATKFYQFLLDQGVRHQLYSWAHQ
ADDB_OENOB        DRQINALINRMRLFIIKILDDFQEKFA--KVENYHQAVKTLYNWLTDQQVDQVLLNQAND
                            ::  .                             .    .   :      

ADDB_LACLM        AELQNEHQMADKHEQVWQMLISTLNEFLAVFSDEKLK-------SVEFLDILLAGLKNAK
ADDB_LACLS        AELQNEHQMADKHEQVWQMLISTLNEFFAVFSDEKLK-------SVEFLDILLAGLKNAK
ADDB_LACLA        AESENKHQMADKHEQVWQMLISILNEFLAVFSDEKLK-------SVEFLDILLAGLKNAK
ADDB_STRPB        QL----EVE--KNEEVWKRFTDILTSFHHIFGQEKLR-------LSDCLALIKTGMKSAQ
ADDB_STRPC        QL----EVE--KNEEVWKRFTDILTSFHHIFGQEKLR-------LSDCLALIKTGMKSAQ
ADDB_STRPM        QL----EVE--KNEEVWKRFTDILTSFHHIFGQEKLR-------LSDCLALIKTGMKSAQ
ADDB_STRP8        QL----EVE--KNEEVWKRFTDILTSFHHIFGQEKLR-------LSDCLALIKTGMKSAQ
ADDB_STRP6        QL----EVE--KNEEVWKRFTDILTSFHHIFGQEKLR-------LSDCLALIKTGMKSAQ
ADDB_STRPG        QL----EVE--KNEEVWKRFTDILTSFHHIFGQEKLR-------LSDCLALIKTGMKSAQ
ADDB_STRPD        QL----EVE--KNEEVWKRFTDILTSFHHIFGQEKLR-------LSDCLALIKTGMKSAQ
ADDB_STRPF        QL----EVE--KNEEVWKRFTDILTSFHHIFGQEKLR-------LSDCLALIKTGMKSAQ
ADDB_STRPZ        QL----EVE--KNEEVWKRFTDILTSFHHIFGQEKLR-------LSDCLALIKTGMKSAQ
ADDB_STRP1        QL----EVE--KNEEVWKRFTDILTSFHHIFGQEKLR-------LSDCLALIKTGMKSAQ
ADDB_STRP3        QL----EVE--KNEEVWKRFTDILTSFHHIFGQEKLR-------LSDCLALIKTGMKSAQ
ADDB_STRS7        RR----EADREKDEEVWKAFTGILETFYQVFGQEKMT-------LADCLALIKMGMQTAH
ADDB_STREM        RR----EADREKDEEVWKTFTGILETFYQVFGQEKMT-------LADCLALIKMGMQTAH
ADDB_STRU0        QS----ALQQEKDEEVWKSFTSILESFYNIFKDETLT-------QELTLMLIKSAMQAAD
ADDB_STRA1        MS----ENEQEKHQEVWKTFTDILEQFQTIFGQEKLN-------LDEFLSLLNSGMMQAE
ADDB_STRA5        MS----ENEQEKHQEVWKTFTDILEQFQTIFGQEKLN-------LDEFLSLLNSGMMQAE
ADDB_STRA3        MS----ENEQEKHQEVWKTFTDILEQFQTIFGQEKLN-------LDEFLSLLNSGMMQAE
ADDB_STRMU        VS----DTEQEKNEQVWKTFTVILEQFHTIFGQEKMK-------LADFLALLRSGMLAAD
ADDB_STRT2        AS----EAEKEQNEQVWKAFTHILEQVETIFGDESLS-------VDDFLSILRSGMLACD
ADDB_STRTD        AS----EAEKEQNEQVWKAFTHILEQVETIFGDESLS-------VDDFLSILRSGMLACD
ADDB_STRGC        ES----HQEQERHEEVWKAFSHVLEQFAQVFADSKVK-------LDDFLALVLSGMLLSN
ADDB_STRSV        ES----QQEQERHEEVWKAFSHVLEQFAQVFADSKVK-------LDDFLALVLSGMLLSN
ADDB_STRPN        LE----AVEQERQAEVWKAFCHVLEQFATVFAGSQVS-------LEDFLALLHSGMSLSQ
ADDB_STRR6        LE----AVEQERQAEVWKAFCHVLEQFATVFAGSQVS-------LEDFLALLHSGMSLSQ
ADDB_STRP2        LE----AVEQERQAEVWKAFCHVLEQFATVFAGSQVS-------LEDFLALLHSGMSLSQ
ADDB_STRPS        LE----AVEQERQAEVWKAFCHVLEQFATVFAGSQVS-------LEDFLALLHSGMSLSQ
ADDB_STRPI        LE----AVEQERQTEVWKAFCHVLEQFATVFAGSQVS-------LEDFLALLHSGMSLSQ
ADDB_STRPJ        LE----AVEQERQAEVWKAFCHVLEQFATVFAGSQVS-------LEDFLALLHSGMSLSQ
ADDB_STRP4        LE----AVEQERQAEVWKAFCHVLEQFATVFAGSQVS-------LEDFLALLHSGMSLSQ
ADDB_STRSY        LS----EVEQEKEEQVWKSFTHLLENFHQIFGKEKLK-------MDDFLAILQAGMQASH
ADDB_STRS2        LS----EVEQEKEEQVWKSFTHLLENFHQIFGKEKLK-------MDDFLAILQAGMQASH
ADDB_LEVBA        AIAAGDLTKAGQPEQTWAAFCDILDEFHTILGDLPTV-------LPDFQALLQAGFAGAK
ADDB_LACPL        ALDRQDVRAAAEPEQTWQTFCGMLDEYVTILGAEPFE-------ITDFLALLQAGFEGAS
ADDB_LACS1        ALEQGDMVMADRPEQVWNLFCALMDEYVDTLGDLSFK-------EEDFLNLLQTGFEGAT
ADDB_LACSS        ALAANQVAQAGQPEQTWSTFMQMLDEYVTLLGDVSFEEDN-TEQLNEFKQLLSAGFAAAQ
ADDB_PEDPA        WIEEGRLAKAAEPEQTWETFIQMLDEFVDILGDQPFD-------PDNFMGLLNAGFEGAT
ADDB_LACP3        ANADGDLSRSQANEQAWDTFTQLLNDYATILGEADFN-------RDQFRELLAAGFASAT
ADDB_LACCB        ANADGDLSRSQANEQAWDTFTQLLNDYATILGEADFN-------RDQFRELLAAGFASAT
ADDB_ENTFA        AIEAGQLETARNHEQTWDALMSLLDEYVTVYGESSFD-------FTTFQEIFVSGLEGLH
G4L7W9_TETHN      EIVWGNLEQARDHEQTWASLMDLLDELVEIYGEDPFD-------FDLFKEILSSGLENLT
ADDB_LACAC        ANDAGDLQQAQQPEQLWDLLIQLLKDYLMINPEKFDV--------DEFFNMLINAFREAN
ADDB_LACH4        ANNAGDLQQAQQPEQLWDLLIQLLKDYLAINPEKFDL--------DEFFNMLISAFKEAT
ADDB_LACGA        ANDAGDLQLAQQPEQVWSTLNDLLKDYLLV-AKEFSL--------EQFFDLLISGFSEAN
ADDB_LACJO        ANDTGDLQLAQQPEQVWSTLTDLLKDYLLV-ANKFSV--------DQFFDLLISGFSEAN
ADDB_LACDA        ASESGDLQQAQQPEQCWNLLLSLLKDYLLVNPENFAW--------ADFFKMLTAAFSQAN
ADDB_LACDB        ASESGDLQQAQQPEQCWNLLLSLLKDYLLVNPENFAW--------ADFFKMLTAAFSQAN
ADDB_LIMRD        YQSTRDLDLARQPQQVWTTFCQILQEYVEILGQQELRDGT-NEVLADFSELLQAGFAAAQ
ADDB_LACRJ        YQSTRDLDLARQPQQVWTTFCQILQEYVEILGQQELRDGT-NEVLADFSELLQAGFAAAQ
ADDB_LEUCK        LLAAGELSRSREGEEVWEMMTQTLDDIVAIDGDERFE-------LEKFKAILVAGFEGAT
D5T5I7_LEUKI      LILAGELTRSRQGEEVWQLLTQTLDEIVEISGNEPFD-------LSAFKDVLSTGFSGAK
ADDB_LEUMM        FIAQGNLSRSQQSEEVWQMLTKTLDEMVEIDGERSVS-------LTDIVTTLQAGLSGAK
ADDB_LACF3        AQESGQLTQLRDVQQIWQTFGTLLDEYVTILGDQVAPTEQPGQLVAEFADLMNAGFNAGR
ADDB_OENOB        GD--------DRGQQTWKLLLSTLDEVDQLIGDKKYS-------QKDFLQILKDGFAAAS
                                : *  :   :                           .  .:    

ADDB_LACLM        YRQIPANVDVVNVKDYELVEPKTNKYIYAIGLSQTNFPRIKKNSTLLSDEERL---EINQ
ADDB_LACLS        YRQIPANVDVVNVKDYELVEPKTNNYIYAIGLSQTNFPRIKKNSTLLSDEERL---EINQ
ADDB_LACLA        YRQIPANVDVVNIKDYELVEPKTNKYIYAIGLSQTNFPRIKKNSTLLSDEERL---EINQ
ADDB_STRPB        YRVVPATLDVVTIKSYDLVQPHSKPFVYAIGLTQSHFPKQIHHSGLLSDQERA---RINE
ADDB_STRPC        YRVVPATLDVVTIKSYDLVQPHSKPFVYAIGLTQSHFPKQIHHSGLLSDQERA---RINE
ADDB_STRPM        YRVVPATLDVVTIKSYDLVQPHSKPFVYAIGLTQSHFPKQIHHSGLLSDQERA---RINE
ADDB_STRP8        YRVVPATLDVVTIKSYDLVQPHSKPFVYAIGLTQSHFPKQIHHSGLLSDQERA---RINE
ADDB_STRP6        YRVVPATLDVVTIKSYDLVQPHSKPFVYAIGLTQSHFPKQIHHSGLLSDQERA---RINE
ADDB_STRPG        YRVVPATLDVVTIKSYDLVQPHSKPFVYAIGLTQSHFPKQIHHSGLLSDQERA---RINE
ADDB_STRPD        YRVVPATLDVVTIKSYDLVQPHSKPFVYAIGLTQSHFPKQIHHSGLLSDQERA---RINE
ADDB_STRPF        YRVVPATLDVVTIKSYDLVQPHSKPFVYAIGLTQSHFPKQIHHSGLLSDQERA---RINE
ADDB_STRPZ        YRVVPATLDVVTIKSYDLVQPHSKPFVYAIGLTQSHFPKQIHHSGLLSDQERA---RINE
ADDB_STRP1        YRVVPATLDVVTIKSYDLVQPHSKPFVYAIGLTQSHFPKQIHHSGLLSDQERA---RINE
ADDB_STRP3        YRVVPATLDVVTIKSYDLVQPHSKPFVYAIGLTQSHFPKQIHHSGLLSDQERA---RINE
ADDB_STRS7        YRTVPATLDVVSIKSYDLVEPHSKPFVFAIGLSRSHFPKQTKNTSLISDQERA---SINE
ADDB_STREM        YRTVPATLDVVSIKSYDLVEPHSKPFVFAIGLSRSHFPKQTKNTSLISDQERA---SINE
ADDB_STRU0        YRVVPATLDVVSVKSYDLVEPHSKSLVYALGLTRTHFPKTVQQTGLISDQERA---KTNE
ADDB_STRA1        YRMVPATVDVVTVKSYDLVEPHSNQFVYALGMTQSHFPKIAQNKSLISDIERQ---LIND
ADDB_STRA5        YRMVPATVDVVTVKSYDLVEPHSNQFVYALGMTQSHFPKIAQNKSLISDIERQ---LIND
ADDB_STRA3        YRMVPATVDVVTVKSYDLVEPHSNQFVYALGMTQSHFPKIAQNKSLISDIERQ---LIND
ADDB_STRMU        YRTVPASVDVVTVKSYDLVEPHSNKFVFALGMTQSHFPKIVQNKSLISDEERA---KINE
ADDB_STRT2        YRTVPATVDVVNVKKYDLIQPHSAPYVFALGMTQSHFPKVGQNKSLLSDEERS---RINE
ADDB_STRTD        YRTVPATVDVVNVKKYDLIQPHSAPYVFALGMTQSHFPKVGQNKSLLSDEERS---RINE
ADDB_STRGC        YRTVPATVDVVKVQSYDLIEPLAAPYVYAIGLTQERFPKIAQNKSLLSDEDRA---RLND
ADDB_STRSV        YRTVPATVDVVKVQSYDLIEPLAAPYVYAIGLTQERFPKIAQNKSLLSDEDRA---RLND
ADDB_STRPN        YRTIPATVDTVLVQSYDLIAPLTADFVYAIGLTQDNLPKISQNTSLLTDEERQ---NLNQ
ADDB_STRR6        YRTIPATVDTVLVQSYDLIAPLTADFVYAIGLTQDNLPKISQNTSLLTDEERQ---NLNQ
ADDB_STRP2        YRTIPATVDTVLVQSYDLIAPLTADFVYAIGLTQDNLPKISQNTSLLTDEERQ---NLNQ
ADDB_STRPS        YRTIPATVDTVLVQSYDLIAPLTADFVYAIGLTQDNLPKISQNTSLLTDEERQ---NLNQ
ADDB_STRPI        YRTIPATVDTVLVQSYDLIAPLTADFVYAIGLTQDNLPKISQNTSLLTDEERQ---NLNQ
ADDB_STRPJ        YRTIPATVDTVLVQSYDLIAPLTADFVYAIGLTQDNLPKISQNTSLLTDEERQ---NLNQ
ADDB_STRP4        YRTIPATVDTVLVQSYDLIAPLTADFVYAIGLTQDNLPKISQNTSLLTDEERQ---NLNQ
ADDB_STRSY        YRTVPATVDVVNVKSYDLIEPHTAKYVYAIGMGQSNFPKVAKNTSLLTEEEME---KVNL
ADDB_STRS2        YRTVPATVDVVNVKSYDLIEPHTAKYVYAIGMGQSNFPKVAKNTSLLTEEEME---KVNL
ADDB_LEVBA        FSQIPSTLDQVVISESGIVQANNRKITFIMGATADTMPDNQIPTTLLADNDRQDLSARLQ
ADDB_LACPL        YSQIPSTLDQVLISESGMVQSQDHKVVFMVGATDLVMPDRIMTNNLLSDVDKENLQLTLS
ADDB_LACS1        YRQVPSTLDQVIISETTATQMNDRKVTFIFGATDLVMPNRIQNTMLLTDMDRE---LVQG
ADDB_LACSS        YAQIPSTLDQVVLSESGMVQTKKRQITFMIGSTDQVMPDQIENTALLTDQDRQ--RLLDN
ADDB_PEDPA        YSQIPSTLDQILVSESGMVQMVDRKIVFIIGATDRVMPEQIQDNDFLNQDGKN---QIDP
ADDB_LACP3        YTQIPSTLDSVVISETGLVRLAKAKHVYVIGATNTAMPDVPNDSGVLNSEERQ---LLAA
ADDB_LACCB        YTQIPSTLDSVVISETGLVRLAKAKHVYVIGATNTAMPDVPNDSGVLNSEERQ---LLAA
ADDB_ENTFA        YSKVPTAIDQVQVRAMDLTRPGAAKVTFAIGMTEEIFPQKIENKTLLSDEERQ---TIND
G4L7W9_TETHN      FGKVPTAIDQVQINPLDLTRPLQAKVTFAIGLDETSFPRTVENKSLISTEERQ---QLNE
ADDB_LACAC        FSQIPSTLDAVNLSELGMVQTGGYKQVFIIGATSGNLPAIQKTPGFLTPENIN---QLQN
ADDB_LACH4        FSQIPSTLDAVNLSEMGMVQTSGYKQVFIIGATSGNLPSIEKKPGFLTTENLN---QLQS
ADDB_LACGA        FSQIPSTLDAVNISEMGMVQGQGYKQVFIIGATSSNLPQIEKIPGFFSSENLE---QLND
ADDB_LACJO        FSQIPSTLDAVNISELGMVQGQGYKQVFIIGATSTNLPQIEKIPGFFSSENLE---QLNE
ADDB_LACDA        FATIPASLDAVTLSEYGMVQTSGYKQVFIIGAANGSLPQINDQPNFLTTENLA---SLAD
ADDB_LACDB        FATIPASLDAVTLSEYGMVQTSGYKQVFIIGAANGSLPQINDQPNFLTTENLA---SLAD
ADDB_LIMRD        YSQIPATLDQVVVSETGIVQSENRKVVFMIGSTDDVMPEMQESDSLLTDQDKD--ILSAY
ADDB_LACRJ        YSQIPATLDQVVVSETGIVQSENRKVVFMIGSTDDVMPEMQESDSLLTDQDKD--ILSAY
ADDB_LEUCK        FSGIPNNLDQLTISEAGIVQSNDYQYLFFIGGTRNNLPAQLKSRALINDAERLIVQPALQ
D5T5I7_LEUKI      FSGIPNNLDQLTISEAGIVQNNHYKQLFFIGGTRSNLPAQAKTTALINDAERLIVQPALK
ADDB_LEUMM        FSGIPNNLDQLMISEAGIVQNTQYKQLYFIGGTRQNLPAQVKNAALINDAERSIVQPALQ
ADDB_LACF3        YAQIPSTLDQVLVSESGMIQDNQRKVLFIMGATDDVMPEVKASEGLLSDPDRE---LLKR
ADDB_OENOB        FSGIPASLDQITVSESGIVQRNDFKALYFIDASDASLPAQTNSSSLIDDFDRLQLIDDFS
                  :  :*  :* : :              : ..     :*       .:             

ADDB_LACLM        TTDENQFIEQLNVANYQKNQFTVLSLINSAKESLVLSMPQIMANEQ--GEFSPVFQLFLK
ADDB_LACLS        TTDENQFIEQLNVANYQKNQFTVLSLINSAKESLVLSMPQIMTNEQ--GEFSPVFQLFLK
ADDB_LACLA        TTDENQFIEQLNVVNYQKNQFTVLSLVNSAKETLVLSMPQIMANEQ--GEFSPVFQLFLN
ADDB_STRPB        -IRNYRHFDIASAENSKKNHQTALSLFNAATKELVLSVPTVINETF--DDLSPYLKELIN
ADDB_STRPC        -IRNYRHFDIASAENSKKNHQTALSLFNAATKELVLSVPTVINETF--DDLSPYLKELIN
ADDB_STRPM        -IRNYRHFDIASAENSKKNHQTALSLFNAATKELVLSVPTVINETF--DDLSPYLKELIS
ADDB_STRP8        -IRNYRHFDIASAENSKKNHQTALSLFNAATKELVLSVPTVINETF--DDLSPYLKELIN
ADDB_STRP6        -IRNYRHFDIASAENSKKNHQTALSLFNAATKELVLSVPTVINETF--DDLSPYLKELIN
ADDB_STRPG        -IRNYRHFDIASAENSKKNHQTALSLFNAATKELVLSVPTVINETF--DDLSPYLKELIN
ADDB_STRPD        -IRNYRHFDIASAENSKKNHQTALSLFNAATKELVLSVPTVINETF--DDLSPYLKELIN
ADDB_STRPF        -IRNYRHFDIASAENSKKNHQTALSLFNAATKELVLSVPTVINETF--DDLSPYLKELIN
ADDB_STRPZ        -IRNYRHFDIASAENSKKNHQTALSLFNAATKELVLSVPTVINETF--DDLSPYLKELIN
ADDB_STRP1        -IRNYRHFDIASAENSKKNHQTALSLFNAATKELVLSVSTVINETF--DDLSPYLKELIN
ADDB_STRP3        -IRNYRHFDIASAENSKKNHQTALSLFNAATKELVLSVPTVINETF--DDLSPYLKELIN
ADDB_STRS7        QTASYQRLDVPSFENIKKNHQTALSLFNAATQELVLSLPTSLTNSS--DDVSPYLKELIA
ADDB_STREM        QTASYQRLDVPSFENIKKNHQTALSLFNAATQELVLSLPTSLTNSS--DDVSPYLKELIA
ADDB_STRU0        KWDSHHRFDISSIENSKKNHYTALSLFNAATDKLVLSYPMVLNEVV--EEASPYLKLLHS
ADDB_STRA1        ANDTDGHFDIMTQENLKKNHFAALSLFNAAKQELVLTIPQLLNESE--DQMSPYLVELRD
ADDB_STRA5        ANDTDGHFDIMTQENLKKNHFAALSLFNAAKQELVLTIPQLLNESE--DQMSPYLVELRD
ADDB_STRA3        ANDTDGHFDIMTRENLKKNHFAALSLFNAAKQALVLTIPQLLNESE--DQMSPYLIELRD
ADDB_STRMU        ATPDNRRFDIVTKENLKKNHFTALSLFNAATQELVLTLPQILNEAE--DNTSSYLLELQD
ADDB_STRT2        ATDEHRRLDIVTQINSKRGHFVAMSLFNAASEQLVLSQPQIINESQ--DDMSVYLKELLD
ADDB_STRTD        ATDEHRRLDIVTQINSKRGHFVAMSLFNAASEQLVLSQPQIINESQ--DDMSVYLKELLD
ADDB_STRGC        ATDSQAELQIASSENLKKNRYTALSLMNSATKELVLSAPALVNEVE--DSMSTYLLELTA
ADDB_STRSV        ATDSQAELQIASSENLKKNRYTALSLMNSATKELVLSAPALVNEVE--DSMSTYLLELTA
ADDB_STRPN        ATEEGVQLLIASSENLKKNRYTMLSLVNSARKQLFLSAPSLFNESE--SKESAYLQELIH
ADDB_STRR6        ATEEGVQLLIASSENLKKNRYTMLSLVNSARKQLFLSAPSLFNESE--SKESAYLQELIH
ADDB_STRP2        ATEEGVQLLIASSENLKKNRYTMLSLVNSARKQLFLSAPSLFNESE--SKESAYLQELIH
ADDB_STRPS        ATEEGVQLLIASSENLKKNRYTMLSLVNSARKQLFLSAPSLFNESE--SKESAYLQELIH
ADDB_STRPI        TTEEGVQLLIASSENLKKNRYTMLSLVNSARKQLFLSAPSLFNESE--SKESAYLQELIH
ADDB_STRPJ        ATEEGVQLLIASSENLKKNRYTMLSLVNSARKQLFLSAPSLFNESE--SKESAYLQELIH
ADDB_STRP4        ATEEGVQLLIASSENLKKNRYTMLSLVNSARKQLFLSAPSLFNESE--SKESAYLQELIH
ADDB_STRSY        VSASSSRFDLVSRENIKKNHAAMMSLLNSATEQLVISTPQIYNEGE--DSLSPYIKILQK
ADDB_STRS2        VSASSSRFDLVSRENIKKNHAAMMSLLNSATEQLVISTPQIYNEGE--DSLSPYIKILQK
ADDB_LEVBA        QVDDGTYLRDDAATQLAGEPYLNYLAFMSGSERLIFSYPAMSDDARSGLQLSPYVARIKD
ADDB_LACPL        SLDGDHYLNDSAVVQLGDESCLNYLAFLSARRHLFFSAPLK-DDQETDLNWSNYVRRIQR
ADDB_LACS1        TLDDEKYLSDTAEGRMAAEPFMNYLAFMTPKERLYFSYPVA-GVNEDGLRMSPYVNRIMK
ADDB_LACSS        EGQVTPLLNESSVGKMNAEPYLNYLAFLSSQTTVYFTYPLG-NGEGTAFKISPYVERIRN
ADDB_PEDPA        FLDDDQFLRISNDRQMRQEPYLNYLTFMIGSDELIFSYPKS-GNDGVELKISPYVERIGK
ADDB_LACP3        QLPDDRFLPEQGPTTTLGDPFINYLGFMAASEKLTLSYPMQNTQENSENQASPYFRQLAQ
ADDB_LACCB        QLPDDRFLPEQGPTTTLGDPFINYLGFMAASEKLTLSYPMQNTQENSENQASPYFRQLAQ
ADDB_ENTFA        TLTENQYLRGTTGRKIAQEPYVAYLVFSSARERLYLTYPSVKDTAQ-EVKPSPYFKNIQK
G4L7W9_TETHN      NLQPGQYLKDQAEETIRKEPFVAYNMLLSASEKLYLSYPKNADSKQ-NIKMSSYLARILK
ADDB_LACAC        SFASDAYLEDNQQLNNLDQNYQFGLALALAQDKVYVSYPILNASNE-RLDSSIYYKRLFD
ADDB_LACH4        SFESDAYLEDNQRLNNLDQNYQFGLSLALAQDRVYISYPVLNASNE-KLDPSIYYQRLQD
ADDB_LACGA        GNNASGYLEDQQKINNLDQNYQFGNALSLASDKIYISYPVINTANE-QLEPSIFYKQLLR
ADDB_LACJO        GNEANGYLEDQQKINNLDQNYQFGNALSLASDKIYISYPVINTANE-QLEPSIFYKQLLK
ADDB_LACDA        FFDQDAYLEDSQQLRNLDQEYQFGNALALASDRVYISYPVINSNND-LLDPSIYYKRLLK
ADDB_LACDB        FFDQDAYLEDSQQLRNLDQEYQFGNALALASDRVYISYPVINSNND-LLDPSIYYKRLLK
ADDB_LIMRD        LDEDFQYLPGTAIDQLIDEPFVHYTGFMNAKEQLIFSAPQSDSDDK-ELSISPYMHDMAR
ADDB_LACRJ        LDEDFQYLPGTAIDQLIDEPFVHYTGFMNAKEQLIFSAPQSDSDDK-ELSISPYMHDMAR
ADDB_LEUCK        ENSTPKYLQNTAQQQMAEENLLFYGALTAATKNIVLSYPALDAGGQ-ISDMSPFFKRLVD
D5T5I7_LEUKI      EAGVSKYLQNTAQQQMTEENLLFYGALAATTDNLTLSYPMLEASGK-ISEMSPFFKRLIA
ADDB_LEUMM        SGTNPRYLQNTAQQQMAEENLLFYGSLMSSIGSITLSYPILEPSGQ-LAEMSPFFKRLVD
ADDB_LACF3        GLNDDQFLPISGTDQINNEPFLNYLSMLSVTERLYMSAPLMSSDDS-ELTLSPYLKGLAR
ADDB_OENOB        KAQKPYYLQDTSRQEMTAENFRFYSSVLSATDSVTFSYSKLRLDGK-QNELSPYLRRLSL
                         :                  .      : .: .            *     :  

ADDB_LACLM        DADEKILQKIQGVNLFESL-----------EHIGNSRSVIAMIGQIERELVESEETSEDK
ADDB_LACLS        DADEKILQKIQGVNLFESL-----------EHIGNSRSVIAMIGQIERELVESEETNEDK
ADDB_LACLA        HSDEKILQKIQEVNLFESL-----------EHIGNSRSVISMIGKIERELVETEEKNDDK
ADDB_STRPB        FGLPLLDKGKN--YLSYDN-----------SDIGNYKALLSQIIAINRQDLIE-MSDQD-
ADDB_STRPC        FGLPLLDKGKN--YLSYDN-----------SDIGNYKALLSQIIAINRQDLIE-MSDQD-
ADDB_STRPM        FGLPLLDKGKN--YLSYDN-----------SDIGNYKALLSQIIAINRQDLIE-MSDQD-
ADDB_STRP8        FGLPLLDKGKN--YLSYDN-----------SDIGNYKALLSQIIAINRQDLIE-MSDQD-
ADDB_STRP6        FGLPLLDKGKN--YLSYDN-----------SDIGNYKALLSQIIAINRQDLIE-MSDQD-
ADDB_STRPG        FGLPLLDKGKN--YLSYDN-----------SDIGNYKALLSQIIAINRQDLIE-MSDQD-
ADDB_STRPD        FGLPLLDKGKN--YLSYDN-----------SDIGNYKALLSQIIAINRQDLIE-MSDQD-
ADDB_STRPF        FGLPLLDKGKN--YLSYDN-----------SDIANYKALLSQIIAINRQDLIE-MSDQD-
ADDB_STRPZ        FGLPLLDKGKN--YLSYDN-----------SDIANYKALLSQIIAINRQDLIE-MADQD-
ADDB_STRP1        FGLPLLDKGKN--YLSYDN-----------SDIGNYKALLSQIIAINRQDLIE-MSDQD-
ADDB_STRP3        FGLPLLDKGKN--YLSYDN-----------SDIGNYKALLSQIIAINRQDLIE-MSDQD-
ADDB_STRS7        LGVPVIEKGKN--RLSHSA-----------ADIGNYKALLSRLVAINRQGIADDMTSED-
ADDB_STREM        LGVPVIEKGKN--RLSHSA-----------ADIGNYKALLSRLVAINRQGIADDMTSED-
ADDB_STRU0        FGIPIVEKQKN--TFSDLE-----------NGIGNYKSLLSQWIALNQEPLTEELYQEE-
ADDB_STRA1        IGVPFNHKGRQ--SLKEEA-----------DNIGNYKALLSRVVDLYRSAIDKEMTKEE-
ADDB_STRA5        IGVPFNHKGRQ--SLKEEA-----------DNIGNYKALLSRVVDLYRSAIDKEMTKEE-
ADDB_STRA3        IGVPFNHKGRQ--SLKEEA-----------DNIGNYKALLSRVVDLYRSAIDKEMTKEE-
ADDB_STRMU        MGVPVVEKGGN--RLAADP-----------EDIGNYKALLSRVIELNRSAIDQELSKEE-
ADDB_STRT2        LGIPLVEKGRN--RFEAKG-----------DQIGNYRDLLSTVIALNSSHLDLDLDKET-
ADDB_STRTD        LGIPLVEKGRN--RFEAKG-----------DQIGNYRDLLSTVIALNSSHLDLDLDKET-
ADDB_STRGC        APLSLPIIVKK--PQASS------------DDIGSYRALLSQIIELHQEEIDREWTAEE-
ADDB_STRSV        APLSLPIIVKK--PQASS------------DDIGSYRALLSQIIELHQEEIDREWTAEE-
ADDB_STRPN        FGFRRREKRMN--HKGLSK-----------EDMGSYHSLLSSLVAYHQQG-EMSDTEQD-
ADDB_STRR6        FGFRRREKRMN--HKGLSK-----------EDMGSYHSLLSSLVAYHQQG-EMSDTEQD-
ADDB_STRP2        FGFRRREKRMN--HKGLSK-----------EDMGSYHSLLSSLVAYHQQG-EMSDTEQD-
ADDB_STRPS        FGFRRREKRMN--HKGLSK-----------EDMGSYHSLLSSLVAYHQQG-EMSDTEQD-
ADDB_STRPI        FGFRRREKRMN--HKGLSK-----------EDMGSYHSLLSSLVAYHQQG-EMSDTEQD-
ADDB_STRPJ        FGFRRREKRMN--HKGLSK-----------EDMGSYHSLLSSLVAYHQQG-EMSDTEQD-
ADDB_STRP4        FGFRRREKRMN--HKGLSK-----------EDMGSYHSLLSSLVAYHQQG-EMSDTEQD-
ADDB_STRSY        MGLK-SEERGR--IKTLSP-----------QDIGHYKSLLSRLIESERPSLETEEWEGQ-
ADDB_STRS2        MGLK-SEERGR--IKTLSP-----------QDIGHYKSLLSRLIESERPSLETEEWEGQ-
ADDB_LEVBA        YFGLSIDIAAANPVAEDEA---------ILPFVGTRRTTLRHLVQASHDSQLREVPLSRS
ADDB_LACPL        QFNLREHTYLGTPDPTNAD---------ARPFVGTKRRTISHVIQVYRDVLTTNTDRNRV
ADDB_LACS1        QFDLPLYEANGEPTLEDKK---------VLKFVATKRTALSNLIGVARQAKGQKQPLPVM
ADDB_LACSS        HFDLTIQKIAAEQSLQSTE---------TPQ--GSWRSLLSDLIQVSRQAQENQTLIPEQ
ADDB_PEDPA        HFGIIAQSLPSRPTTEPVRLD----PPFIELFIGSNRSTLSHLIQYARAMHEAKSEADPR
ADDB_LACP3        ALQLTPATWAPAGLGTSLK-----------AVLGSQRAMLSDFVRAAGEAQHQKLPLSRS
ADDB_LACCB        ALQLTPATWAPAGLGTSLK-----------AVLGSPRAMLSDFVRAAGEAQHQKLPLSRS
ADDB_ENTFA        DLNLPVFEKNETTIFDDETT--------SLAHISTYRTLIGELTRLKRQRKETQEGLLPF
G4L7W9_TETHN      WTDLTLQDR---CSLDLTCD--------PHHYVGSYKSLIRQLNSLYRQAQEEKSALSGK
ADDB_LACAC        YV-DSEFEQHDLPEKFN----------DLLSFITSADASLGYLSYI-NSIDSSKEFDELL
ADDB_LACH4        YG-APEFSQHDLPEKMQ----------ELLSFITNPDASLGYLAYI-NSNTSDEAIDELL
ADDB_LACGA        LTQANEFSQHDLPSSAG----------DLLTFMTNPEASLGYLTYL-KGK-QEVNVDSIL
ADDB_LACJO        LTRADEFAQHDLPQNNG----------EVLTFITNPEASLGYLTYL-KNK-AATDVDSLL
ADDB_LACDA        LVNGREYRQRDLPDIAEKDRTE--FARQLLLFLTSPRASLGYLAYAEENSAQSPLVAKLV
ADDB_LACDB        LVNGREYRQRDLPDIAEKDRTE--FARQLLLFLTSPRASLGYLAYAEENSAQSPLVAKLV
ADDB_LIMRD        YFGQPVREYPLATSKAGQDN--------AIDFVSAPLATINRLVEVSRQIRDEQGVGIDR
ADDB_LACRJ        YFGQPVREYPLATSKAGQDN--------AIDFVSAPLATINRLVEVSRQIRDEQGVGIDR
ADDB_LEUCK        AFNITVNKVTATPATSQAL---------LKYYVGSVRSTLGELVKIAASQQQTSAYQALR
D5T5I7_LEUKI      TFNVSVEKVASKPHNGADL---------LKRYIGTARATLSELVKILPTQRTTAAFKAIQ
ADDB_LEUMM        TFNSEVEVIGSIPSSAASL---------LKQYVGTARATLSDLVKILPVYGQTAAFKAVQ
ADDB_LACF3        HFNQWDDQNNAPTTDLPDRPNPRASEDDVWSFVAAPAVTMGNLIEVERLSKDTGRKLTSA
ADDB_OENOB        KNVSDLKIEKIPDLPQSQAD--------LVDYLGTANSSAAILSQTAQNFGEDFIDGLTD
                                                                              

ADDB_LACLM        -----------------------RVFWSSIFRILVKSNADFQKILLDLAKDIDTVNLAPD
ADDB_LACLS        -----------------------RVFWSSIFRILVKSNADFQKILLDLAKDIDTVNLAPD
ADDB_LACLA        -----------------------RVFWSSIFRILVKSNPDFQKILLDLAKDIDTVNLSQE
ADDB_STRPB        -----------------------KMFWTVVLRYLRKQLRKQQLELPTSDYRLSTKPLSKE
ADDB_STRPC        -----------------------KMFWTVVLRYLRKQLRKQQLELPTSDYRLSTKPLSKE
ADDB_STRPM        -----------------------KMFWTVVLRYLRKQLRKQQLELPTSDYRLSTKPLSKE
ADDB_STRP8        -----------------------KMFWTVVLRYLRKQLRKQQLELPTSDYRLSTKPLSKE
ADDB_STRP6        -----------------------KMFWTVVLRYLRKQLRKQQLELPTSDYRLSTKSLSKE
ADDB_STRPG        -----------------------KMFWTVVLRYLRKQLRKQQLELPTSDYRLSTKPLSKE
ADDB_STRPD        -----------------------KMFWTVVLRYLRKQLRKQQLELPTSDYRLSTKPLSKE
ADDB_STRPF        -----------------------KMFWTVVLRYLRKQLRKQQLELPTSDYRLSTKPLSKE
ADDB_STRPZ        -----------------------KMFWTGVLRYLRKQLRKQQLELPTSDYRLSTKPLSKE
ADDB_STRP1        -----------------------KMFWTVVLRYLRKQLRKQQLELPTSDYRLSTKPLSKE
ADDB_STRP3        -----------------------KMFWTVVLRYLRKQLRKQQLELPTSDYRLSTKSLSKE
ADDB_STRS7        -----------------------RNFWTVALRYLKRRLADEQLSLPAFEHHLTTKPVAPE
ADDB_STREM        -----------------------RNFWTVALRYLKRRLADEQLSLPAFEHHLTTKPVAPE
ADDB_STRU0        -----------------------KSFWLVMSRYLKKQLAAKKLTFPEQKSHLATSRLSPE
ADDB_STRA1        -----------------------QTFWSVAVRYLRRQLTSKGIEIPIITDSLDTVTVSSD
ADDB_STRA5        -----------------------QTFWSVAVRYLRRQLTSKGIEIPIITDSLDTVTVSSD
ADDB_STRA3        -----------------------QTFWSVAVRYLRRQLTSKGIEIPIITDSLDTVTVSSD
ADDB_STRMU        -----------------------QTFWSVAVRYLRQKLAKEGLTIPEVNDKMQTKQVAAE
ADDB_STRT2        -----------------------QTFWSVAVRYLRKRLDKDQVLIPKVIDDVTTTKVDDQ
ADDB_STRTD        -----------------------QTFWSVAVRYLRKRLDKDQVLIPKVIDDVTTTKVDDQ
ADDB_STRGC        -----------------------QTFWAVAVRVLRKKLAAEGISIPQISKELKTESLQPE
ADDB_STRSV        -----------------------QTFWAVAVRVLRKKLAAEGISIPHISKELKTETLQSE
ADDB_STRPN        -----------------------LTFVKVLSRVIGKKLDQQGLENPAIPTSPSSKTLAKD
ADDB_STRR6        -----------------------LTFVKVLSRVIGKKLDQQGLENPAIPTSPSSKTLAKD
ADDB_STRP2        -----------------------LTFVKVLSRVIGKKLDQQGLENPAIPTSPSSKTLAKD
ADDB_STRPS        -----------------------LTFVKVLSRVIGKKLDQQGLENPAIPTSPSSKTLAKD
ADDB_STRPI        -----------------------LTFVKVLSRVIGKKLDLQGLENPAIPTSPSSKTLTKD
ADDB_STRPJ        -----------------------LTFVKVLSRVIGKKLDLQGLENPAIPTSPSSKTLAKD
ADDB_STRP4        -----------------------LTFVKVLSRVIGKKLDLQGLENPAIPTSPSSKTLAKD
ADDB_STRSY        -----------------------RAFWTVLVRHLKKKLESQSIEIPTITGDIASKQLSDE
ADDB_STRS2        -----------------------RAFWTVLVRHLKKKLESQSIEIPTITGDIASKQLSDE
ADDB_LEVBA        -----------------------WLYVLNLLRTDPTYGELTTKLLGSLSYRNVPTQLTPD
ADDB_LACPL        G--------------APLQPAPVWVWLRQQLTRDPQFGELARQLMAGLSYRNQPVKLTPA
ADDB_LACS1        -----------------------WRYIYQKLQEDATYRRLTRKLMAGIEYSNIPERLKTE
ADDB_LACSS        -----------------------WLTTYRLLQQAPQSQFLTTQLFQSLNYRNEPERLTPE
ADDB_PEDPA        -----------------------WNLIYTILRQS-TLGSLTDQLLSSLEYKNIPEKLKPE
ADDB_LACP3        -----------------------WQGVLASLKQT-TLAPLAQKLAGSLTYQNDPGRLDPT
ADDB_LACCB        -----------------------WQGVLASLKQT-KLAPLAQKLAGSLTYQNNPGRLDPT
ADDB_ENTFA        ------------------------WLNMEKALMNQSIAPLAKQVFESLTHQNIPEKIDEV
G4L7W9_TETHN      ------------------------WQSLKDLLLMSDYRSLATKVFESQVHRNVPVHLSPE
ADDB_LACAC        ------------------------------RITHEQSPQKTEIVLQASEFNNQPEDIGQE
ADDB_LACH4        ------------------------------KITQKYLPQKVKAVLDASDFDNQPEDIGED
ADDB_LACGA        ------------------------------ELTEQEIGEVAQNVLEGSNFKNVPENLPPK
ADDB_LACJO        ------------------------------KMTEEKIGEVAKNVLEGSSFKNIPQDLSPE
ADDB_LACDA        ------------------------------ELSRQYEEEKAEEIAEGMAYDNNPQDISED
ADDB_LACDB        ------------------------------ELSRQYEEEKAEEIAEGMAYDNNPQDISED
ADDB_LIMRD        QPVMPVGWQTVAESLVKLAKQWQQSADAKVQAEGISLGQRLSLVAAGFHYQNKIDSLGNK
ADDB_LACRJ        QPVMPVGWQTVAESLVKLAKQWQQSADAKVQAEGISLGQRLSLVAAGFHYQNKIDSLGNK
ADDB_LEUCK        ------------------------------NTINQSEPERLERVLSAPNYKNQTETLKPE
D5T5I7_LEUKI      ------------------------------NTIADTQSDRLTRVLSAPNYKNTSQVLKPE
ADDB_LEUMM        ------------------------------NVISNTMQDRLERVLSAPNYQNNTTKLKPE
ADDB_LACF3        W----------------------RDVARALTRYDEGLTGRLNDIRDGQYAKNEAVPLQPE
ADDB_OENOB        --------------------------------LLIKRNPYFQRILQALHYNNQPVTLRPE
                                                                          :   

ADDB_LACLM        TLEQIY-------GDK--IYASVSSFERFYNCEYQYFLENTLSLETFENIDINSKIVGNF
ADDB_LACLS        TLEQIY-------GDK--IYASVSSFERFYNCEYQYFLENTLSLETFENIDINSKIVGNF
ADDB_LACLA        TLDQIY-------GDK--LYASVSSFERFYNCEYQYFLETTLGLETFENIDINSKIVGNF
ADDB_STRPB        VIEVCF-------PKGIPLKLSATALTVFYNNQYNYFLKYVLNLNKTESIHPDSRIHGQY
ADDB_STRPC        VIEVCF-------PKGIPLKLSATALTVFYNNQYNYFLKYVLNLNKTESIHPDSRIHGQY
ADDB_STRPM        VIEVCF-------PKGIPLKLSATALTVFYNNQYNYFLKYVLNLNKTESIHPDSRIHGQY
ADDB_STRP8        VIEVCF-------PKGIPLKLSATALTVFYNNQYNYFLKYVLNLNKTESIHPDSRIHGQY
ADDB_STRP6        VIEVCF-------PKGIPLKLSATALTVFYNNQYNYFLKYVLNLNKTESIHPDSRIHGQY
ADDB_STRPG        VIEVCF-------PKGIPLKLSATALTVFYNNQYNYFLKYVLNLNKTESIHPDSRIHGQY
ADDB_STRPD        VIEVCF-------PKGIPLKLSATALTVFYNNQYNYFLKYVLNLNKTESIHPDSRIHGQY
ADDB_STRPF        VIEVCF-------PKGIPLKLSATALTVFYNNQYNYFLKYVLNLNKTESIHPDSRIHGQY
ADDB_STRPZ        VIEVCF-------PKGIPLKLSATALTVFYNNQYNYFLKYVLNLNKTESIHPDSRIHGQY
ADDB_STRP1        VIEVCF-------PKGIPLKLSATALTVFYNNQYNYFLKYVLNLNKTESIHPDSRIHGQY
ADDB_STRP3        VIEVCF-------PKRIPLKLSATALTVFYNNQYNYFLKYVLNLNKTESIHPDSRIHGQY
ADDB_STRS7        VIETRF-------PSHQPLSLSSSALTVFYNNQYKYFLKYVLGLQEPESIHPDARIHGQY
ADDB_STREM        VIETRF-------PSQQPLSLSSSALTVFYNNQYKYFLKYVLGLQEPESIHPDARIHGQY
ADDB_STRU0        VLAIKY-------PDHQPLSLSSSALTVYHDNQYKYFLQYVLGLQELESIHPDARHHGTY
ADDB_STRA1        VMTRRF-------PEDDPLKLSSSALTTFYNNQYKYFLQYVLGLEEQDSIHPDMRHHGTY
ADDB_STRA5        VMTRRF-------PEDDPLKLSSSALTTFYNNQYKYFLQYVLGLEEQDSIHPDMRHHGTY
ADDB_STRA3        VMTRRF-------PEDDPLKLSSSALTTFYNNQYKYFLQYVLGLEEQDSIHPDMRHHGTY
ADDB_STRMU        VMAARF-------PIDQPLNLSSSALTTFYNNQYLYFLQYILGLQELETIHPDARNHGTY
ADDB_STRT2        VMQLVF-------PEEEPLKLSATALTTFYNNQYLYFLRYVLELEELESIHPDARHHGTY
ADDB_STRTD        VMQLVF-------PEEEPLKLSATALTTFYNNQYLYFLRYVLELEELESIHPDARHHGTY
ADDB_STRGC        TLHALY-------PKDQPLRLSASALSEYFKNQYGYFIKYILGLQEEWTIHPDARSHGNF
ADDB_STRSV        TLQALY-------PQEQPLRLSASALNEYFRHQYAYFLKYVLRLQEEWTIHPDARSHGIF
ADDB_STRPN        TLQALY-------PAKQEFYLSTSGLTEFYRNEYSYFLRYVLGLQEELRLHPDARSHGNF
ADDB_STRR6        TLQALY-------PAKQEFYLSTSGLTEFYRNEYSYFLRYVLGLQEELRLHPDARSHGNF
ADDB_STRP2        TLQALY-------PAKQEFYLSTSGLTEFYRNEYSYFLRYVLGLQEELRLHPDARSHGNF
ADDB_STRPS        TLQALY-------PAKQEFYLSTSGLTEFYRNEYSYFLRYVLGLQEELRLHPDARSHGNF
ADDB_STRPI        TLQALY-------PAKQEFYLSTSGLTEFYLNEYSYFLRYVLGLQEELRLRPDARSHGNF
ADDB_STRPJ        TLQALY-------PAKQEFYLSTSGLTEFYRNEYSYFLRYVLGLQEELRLRPDARSHGNF
ADDB_STRP4        TLQALY-------PAKQEFYLSTSGLTEFYRNEYSYFLRYVLGLQEELRLRPDARSHGNF
ADDB_STRSY        TLAALY-------PEDKPLNLSASSLTNFYNNQYLYFVRNVLRLREQESIHPTAFQHGLF
ADDB_STRS2        TLAALY-------PEDKPLNLSASSLTNFYNNQYLYFVRNVLRLREQESIHPTAFQHGLF
ADDB_LEVBA        IVTQLY---------GTKINTSISKLEEYYANPYAYFLKYGLNLQERDVFALSPASTGEF
ADDB_LACPL        SVEALY---------GHQIYTSISKLEEFYRNQYAYFLKYGLKLRERDVFELSAASTGEF
ADDB_LACS1        YAEKLY---------GKTLNTSVSKFEEFFKNHYAFFLKYGLKLKERDVFELSPANTGEF
ADDB_LACSS        IVTGLY---------GNEIHTSISKLEEFYQNQYAYFLKYGLKLQERPVFELTPANTGNF
ADDB_PEDPA        IVEGLY---------GDTIYASVSKLEEFYRNEYSYFLKYGLKLQERETSDLSPADTGQY
ADDB_LACP3        LAVQLY---------GRDMNVSVSRLETYYRNQFEYFLKYGLLLQPRPEFELSPADTGSL
ADDB_LACCB        LAVQLY---------GRDMNVSVSRLETYYRNQFEYFLKYGLLLQPRPEFELSPADTGSL
ADDB_ENTFA        LAEPLY---------GKDIYTSVSRMESFYRCQYQYFSRYGLRLKERDVFGLSPAATGEF
G4L7W9_TETHN      LAEQLY---------GKNIYSSISQIETFYDYQYDYFLKFGLGLKEREIYGLNSAMTGEI
ADDB_LACAC        LAEKLY---------GQNLNSSVSQLETFYENSYEYFLTYGLRLHRRLENEFDVIQAGNY
ADDB_LACH4        LAAELY---------GKNLYSSVSQLETFYENSYEYFLTYGLKLRRRLENEFDVIQAGNY
ADDB_LACGA        LAQELY---------GDRIETSVSQLETYYQNSFEYFLNYGLHLKKRFENELDVIQAGNY
ADDB_LACJO        LAQQLY---------GDRIETSVSQLETYYQNSFEYFLNYGLHLKKRFENELDVIQAGNY
ADDB_LACDA        LAERLY---------GKDLLSSVSQLESYYQNSFEYFLNYGLRLRPRAENELNAIQSGNY
ADDB_LACDB        LAERLY---------GKDLLSSVSQLESYYQNSFEYFLNYGLRLRPRAENELNAIQSGNY
ADDB_LIMRD        LAQALYLRAAPDDERGRVLYASISQLQDFYINQYEYFLKYGLRLQKRDELTLSNDRIGTF
ADDB_LACRJ        LAQALYLRAAPDDERGRVLYASISQLQDFYINQYEYFLKYGLRLQKRDELTLSNDRIGTF
ADDB_LEUCK        LVQALF---------GETLNMSISQLESYYNNPLAYFLQYGLALKERLTNRLNVAQTGTL
D5T5I7_LEUKI      FVHALF---------GDQLNVSISQLESYYRNPLGYFIQYGLKLKERATNELDVAQTGTL
ADDB_LEUMM        FISALF---------GERLNVSISQLESYYSNPFAYFLQYGLKLQERATNELNVAQTGTL
ADDB_LACF3        LAARLYTTNRQG-QVTNQLTASISQLEKFYQNPYDYFLRYGLHLKKRDELEVSSDKSGTL
ADDB_OENOB        LIKKLF---------GEDLRLSISQIEKYYSNPYEYFLQYGLRLKKRNQFTVDAALSGTY
                       :            :  * : :  :.     :*    * *.            *  

ADDB_LACLM        FHEVFEKVMKETDLS-AENFDEKLTLVLQEVDKNYSRYFTQ---------------DATA
ADDB_LACLS        FHEVFEKVMKETDLS-AENFDEKLTLFLQEVDKNYSRYFTQ---------------DATA
ADDB_LACLA        FHEVFEKVMQEEALS-AENFDEKLTKVLHDVDSNYSRYFTH---------------DATA
ADDB_STRPB        LHRVFERLMKDHTQE-PFDNKLKQAIYHTNQESFFQQVYQD---------------NAEA
ADDB_STRPC        LHRVFERLMKDHTQE-PFDNKLKQAIYHTNQESFFQQVYQD---------------NAEA
ADDB_STRPM        LHRVFERLMKDHTQE-PFDNKLKQAIYHTNQESFFQQVYQD---------------NAEA
ADDB_STRP8        LHRVFERLMKDHTQE-PFDNKLKQAIYHTNQESFFQQVYQD---------------NAEA
ADDB_STRP6        LHRVFERLMKDHTQE-PFDNKLKQAIYHTNQESFFQQVYQD---------------NAEA
ADDB_STRPG        LHRVFERLMKDHTQE-PFDNKLKQAIYHTNQESFFQQVYQD---------------NAEA
ADDB_STRPD        LHRVFERLMKDHTQE-PFDNKLKQAIYHTNQESFFQQVYQD---------------NAEA
ADDB_STRPF        LHRVFERLMKDHTQE-PFDNKLKQAIYHTNQESFFQQVYQD---------------NAEA
ADDB_STRPZ        LHRVFERLMKDHTQE-PFDNKLKQAIYHTNQESFFQQVYQD---------------NAEA
ADDB_STRP1        LHRVFERLMKDHTQE-PFDNKLKQAIYHTNQESFFQQVYQD---------------NAEA
ADDB_STRP3        LHRVFERLMKDHTQE-PFDNKLKQAIYHTNQESFFQQIYQD---------------NAEA
ADDB_STRS7        LHRIFELVTKDRTDA-AFDQKLGAAIAAVNQQSAFQQVYQA---------------DAEG
ADDB_STREM        LHRIFELVTKDRSNA-AFDQKLGAAIAAVNQQSAFQQVYQA---------------DAEG
ADDB_STRU0        LHRVFEYVVDDQRSI-PFDDKIEEAIQRTNQERLFQTYYQS---------------DAES
ADDB_STRA1        LHRVFEILMKNQGIE-SFEEKLNSAINKTNQEDVFKSLYSE---------------DAES
ADDB_STRA5        LHRVFEILMKNQGIE-SFEEKLNSAINKTNQEDVFKSLYSE---------------DAES
ADDB_STRA3        LHRVFEILMKNQGIE-SFEEKLNSAINKTNQEDVFKSLYSE---------------DAES
ADDB_STRMU        LHRVFELVMQDQSTD-DFDSKLNRAIDITNHEDSFHLVYNE---------------DEES
ADDB_STRT2        LHRVFERVMGDSSSE-SFDDKLEKAIAQTNQDQPFEILYTE---------------DQES
ADDB_STRTD        LHRVFERVMGDSSSE-SFDDKLEKAIAQTNQDQPFEILYTE---------------DQES
ADDB_STRGC        LHRIFEKVLQEDTSR-DFDQRLEVAIDETMRETEFESLYNE---------------SSES
ADDB_STRSV        LHRIFEKVLQDDSSA-DFDRRLAQAMEETSREAEFESIYSE---------------SGQT
ADDB_STRPN        LHRIFERALQLPNED-SFDQRLEQAIQETSQEREFEAIYQE---------------SLEA
ADDB_STRR6        LHRIFERALQLPNED-SFDQRLEQAIQETSQEREFEAIYQE---------------SLEA
ADDB_STRP2        LHRIFERALQLPNED-SFDQRLEQAIQETSQEREFEAIYQE---------------SLEA
ADDB_STRPS        LHRIFERALQLPNED-SFDQRLEQAIQETSQEREFEAIYQE---------------SLEA
ADDB_STRPI        LHRIFERALQLPNED-SFDQRLEQAIQETSQEREFEAIYQE---------------SLEA
ADDB_STRPJ        LHRIFERALQLPNED-SFDQRLEQAIQETSQEREFEAIYQE---------------SLEA
ADDB_STRP4        LHRIFERALQLPNED-SFDQRLEQAIQETSQEREFEAIYQE---------------SLEA
ADDB_STRSY        LHRIFERVVMDQSEL-DFDQKVDKAILRTRDEAEFAMFYNQ---------------DADA
ADDB_STRS2        LHRIFERVVMDQSEL-DFDQKVDKAILRTRDEAEFAMFYNQ---------------DADA
ADDB_LEVBA        FHATLDGLMKLVNDQ-KLNLAALDDQQLREMTDEVMAKLLDTTE---NPQFAILESSHRM
ADDB_LACPL        FHAVLDGLIKALRSD-QIPLAQASDQQLGQYLETVTRQILD------QPQFTILTSSNRM
ADDB_LACS1        YHMALDKLLKTLKQD-KVSITDINKSQFDAYLQQVLGGMEQ------LPQFQILQSSNRM
ADDB_LACSS        YHEVMDRFIKLIQGQ-QIALPELDDQQIDKLVSEVLAKTYE------QPEFKILNKTARM
ADDB_PEDPA        FHAAMDKLIKMITTE-NLNFNEVNQEQIEQIAKRLVQQMEQ------DQQFDQFNGTYRM
ADDB_LACP3        FHAVLDQYLTQLRDA-GQTLADVTAADVAAAVPPLVAAITK------RPGYEILGSTHRM
ADDB_LACCB        FHAVLDQYLTQLRDA-GQTLADVTAADVAAAVPPLVAAITK------RPGYEILGSTHRM
ADDB_ENTFA        FHEALDQFFKLLIMN-QRNLSELTDQEVNLLAEEVLNSILG------DARFSVLTTSSRM
G4L7W9_TETHN      FHEALDNFLKAVFQD-DLSLTQMSEEQRQLLIDRVLKNIFG------QERYAFMEKNARM
ADDB_LACAC        FHETFDRLVKQLNKE-HIDLASLNSFELERMLNSVRNVMKN------EGKYAQLMNDPFN
ADDB_LACH4        FHETFDRLVKRLNEQ-HIDLADLSSVELEQQLNQVRDVIKD------ESKYAQLMNDPFN
ADDB_LACGA        YHETFDYLVKKIKEK-NLDFADLTDSKLNQLLIEVREELKE------KGRYRQLLNDPFN
ADDB_LACJO        YHETFDYLVKRIKEK-KLNFADLTEEKLGELLIEVREELKE------KGRYRQLLNDPFN
ADDB_LACDA        FHRTFELLLKEMQKK-NIEIDKLSELDLELLLKQVRSEILQ------EPLYQQFLRDPFN
ADDB_LACDB        FHRTFELLLKEMQKK-NIEIDKLSELDLELLLKQVRSEILQ------EPLYQQFLRDPFN
ADDB_LIMRD        FHKAMETFVTTIREN-NLSFADLAHKDNQMQRDQLIDHALVTAQENQPTLLRLINSSAQA
ADDB_LACRJ        FHKAMETFVTTIREN-NLSFADLAHKDNQMQRDQLIDHALVTAQENQPTLLRLINSSAQA
ADDB_LEUCK        YHAVFEGVVQQLIIQ-QLSLRDISQKALQQLVADNMAEITA------QPAYQMLQETGKM
D5T5I7_LEUKI      YHAVLEGVLKALIKE-NMSLRDITTPDLLILVQQKMTEIIQ------SPEYQLLQENGKM
ADDB_LEUMM        YHAVFENVLHELIVK-NKSLRDITGDELRALVRQHMQSQLA------LPAFEILNDSGKM
ADDB_LACF3        NHDALAFFVQSVIDEPDLQLADLVKEEHQGRQAELIDQAFEQAMNQQEELRELAANNSRV
ADDB_OENOB        YHSIFEQVINRLIGK-RTDFHDLSDQELKKLSQESAQNLIE------LPDFQILQSDDHF
                   *  :                                                       

ADDB_LACLM        RFTWSNLEEIVRQTATVLKATVSTDELKTLLTESSFGLPKSE-----------------L
ADDB_LACLS        RFTWSNLEEIVRQTATVLKATVSTDELKTLLTESSFGLSKSE-----------------L
ADDB_LACLA        RFTWTNLEEIVRQTATVLKETVSTDELKTLLTESSFGLPKSE-----------------L
ADDB_STRPB        EYSLAILEDIVRSTAPILQ---LNQNIKVIDQEKNF------------------------
ADDB_STRPC        EYSLAILEDIVRSTAPILQ---LNQNIKVIDQEKNF------------------------
ADDB_STRPM        EYSLAILEDIVRSTAPILQ---LNQNIKVIDQEKNF------------------------
ADDB_STRP8        EYSLAILEDIVRSTAPILQ---LNQNIKVIDQEKNF------------------------
ADDB_STRP6        EYSLAILEDIVRSTAPILQ---LNQNIKVIDQEKNF------------------------
ADDB_STRPG        EYSLAILEDIVRSTAPTLQ---LNQNIKVIDQEKNF------------------------
ADDB_STRPD        EYSLAMLEDIVRSTAPILQ---LNQNIQVIDQEKNF------------------------
ADDB_STRPF        EYSLAILEDIVRSTAPILQ---LNQNIQVIDQEKNF------------------------
ADDB_STRPZ        EYSLAILEDIVRSTAPILQ---LNQNIQVIDQEKNF------------------------
ADDB_STRP1        EYSLAILEDIVRSTAPILQ---LNQNIQVIDQEKNF------------------------
ADDB_STRP3        EYSLAILEDIVRSTAPILQ---LNQNIQVIDQEKNF------------------------
ADDB_STRS7        RYSLEVLKGIAYSTAPVLN---LNQGMQVAKQEEAF------------------------
ADDB_STREM        RYSLEVLKGIAYSTAPVLN---LNQGMQVAKQEEAF------------------------
ADDB_STRU0        RFSLSLLEDIAKSTASIFP---ITPT-KVLSQEERF------------------------
ADDB_STRA1        RYSLEILEDIARATATILR---QDSQMTVESEEERF------------------------
ADDB_STRA5        RYSLEILEDIARATATILR---QDSQMTVESEEERF------------------------
ADDB_STRA3        RYSLEILEDIARATATILR---QDSQMTVESEEERF------------------------
ADDB_STRMU        RYALGILEDIARSTATVLK---GDNPVQAESEEEAF------------------------
ADDB_STRT2        RFSRQILEDIARSTASVLR---DNAAVKVECEEVKF------------------------
ADDB_STRTD        RFSRQILEDIARSTASVLR---DNAAVKVEREEVKF------------------------
ADDB_STRGC        LFTRQLLLDTAKSTGQVLA---QSAGIETIGEETVFGNSKEPF----------------L
ADDB_STRSV        RFARQLLLDTARATGRVLA---HPSGIETIGEETGFGSASTPF----------------L
ADDB_STRPN        QFTKEVLLDVARTTGHILR---HNPAIETIKEEANFGGKDQAF----------------I
ADDB_STRR6        QFTKEVLLDVARTTGHILR---HNPAIETIKEEANFGGKDQAF----------------I
ADDB_STRP2        QFTKEVLLDVARTTGHILR---HNPAIETIKEEANFGGKDQAF----------------I
ADDB_STRPS        QFTKEVLLDVARTTGHILR---HNPAIETIKEEANFGGKDQAF----------------I
ADDB_STRPI        QFTKEVLLDVARTTGHILR---HNPAIETIKEEANFGGKDQAF----------------I
ADDB_STRPJ        QFTKEVLLDVARTTGHILR---HNPAIETIKEEANFGGKDQAF----------------I
ADDB_STRP4        QFTKEVLLDVARTTGHILR---HNPAIETIKEEANFGGKDQAF----------------I
ADDB_STRSY        RYTEEVLDKIARSSATILR---DNDLVEIDGQEKSFRQDKALV----------------F
ADDB_STRS2        RYTEEVLDKIARSSATILR---DNDLVEIDGQEKSFRQDKALV----------------F
ADDB_LEVBA        GYIRQQLMKTMRQMAKTLQEQSKRTKLRPKRTEVQFG-LGDER---------GLAALSFD
ADDB_LACPL        AYLQRQLINTVRQIAFAIRNQSKLSAAEPKQTEILFGNVGKEH---------GLKALDFQ
ADDB_LACS1        QFILKQLGATVSQMGWALHNQGQRTKMRPLETEVLFGHVGTEN---------GLKALTYD
ADDB_LACSS        GYIRQQLMQTVKRVSLALRNQSLSTNLRPLATEVLFGQVGAEK---------GLQGLNFM
ADDB_PEDPA        GFLRKQLDRTVQAMVEAIFKQLARTRMRPIASEQLFGQIGSQS---------GLPALNFK
ADDB_LACP3        AYLTSRLSRLLIQVLTNMRQQQRRTGFRPMRTELQFGRIGDTR---------GLPGLSWP
ADDB_LACCB        AYLTSRLSRLLIQVLTNMRQQQRRTGFRPMRTELQFGQIGDTR---------GLPGLSWP
ADDB_ENTFA        NYIRYQLSQTIKKVSWALKRQSQRSGMTTVQTEVLFGQIAAKK---------GISGLELP
G4L7W9_TETHN      SFIRYRLGKTVQHVSWGLKKQAEKTQLTPVQTEVLFGEIAGNQ---------GIPGLEIP
ADDB_LACAC        EYLFKCLDHTTSKVAHNWCKNLNKTPLRAKYSELSFGVGEKLK---------GLSLDVPN
ADDB_LACH4        QYLFHCLDHTTSKVAQNWRKSLAETPLRAKYSELSFGLDQKIK---------GISLDIPD
ADDB_LACGA        KYLFHKLDQTTSNVAHYWHSNVNKTTFRPQYSELSFGKNQKVT---------GLSYSWKD
ADDB_LACJO        KYLFHKLDQTTANVAHYWHSNVNKTTFRPQYSELSFGKNQKVS---------GLSYSWKD
ADDB_LACDA        EYLFKVFDKTTSKVAQSYRRKQQENKMRATYGELAFGPAEKLA---------GLVLPLKK
ADDB_LACDB        EYLFKVFDKTTSKVAQSYRRKQQENKMRATYGELAFGPAEKLA---------GLVLPLKK
ADDB_LIMRD        QFQYQQLTAIVKTMLITLCRQAEYTGSQPVKTEVQFGRIGNQQPG-------NLGSLDYP
ADDB_LACRJ        QFQYQQLTAIVKTMLITLCRQAEYTGSQPVKTEVQFGRIGNQQPG-------NLGSLDYP
ADDB_LEUCK        RATQHYLAKVSEILAVNMQRAARVNHAQPKAVERLFGFPNRQS----------LPALVVS
D5T5I7_LEUKI      RATRDYLQRVSATLLMNLQRSARVNSAKPSHVEQLFGFPSQAS----------LPPLKFS
ADDB_LEUMM        RATTNYLTRVCETLVLNLQAAARENTSKPEAVEQLFGFS-KES----------LPPLSFA
ADDB_LACF3        NLQLQVAKQLITTMAKTLCLQATQTDAQPVAVEKAFGQADWTGESQAAELPALTFDLTGA
ADDB_OENOB        RAVARSLTDDVLLTLKLMHRANRLNNSRPIKTEAVFGKLSSDQQR------EQSLSGLDF
                                                  *  *                        

ADDB_LACLM        GNFSVDDIYLRGRIDRLDQLS-----TDYLGAIDYKSSAHSFKLQEAYDGLSLQFMTYLD
ADDB_LACLS        GNFSVDDIYLRGRIDRLDQLS-----TDYLGVIDYKSSAHSFKLQEAYDGLSLQFMTYLD
ADDB_LACLA        GNFSVDDIYLRGRIDRLDQLS-----SDYLGAIDYKSSAHSFKLQDAYDGLSLQFMTYLD
ADDB_STRPB        HLDMGNEILVHGIIDRIDQLS-----DGSLGIVDYKSSANQFDIGTFYNGLSPQLVTYLA
ADDB_STRPC        HLDMGNEILVHGIIDRIDQLS-----DGSLGIVDYKSSANQFDIGTFYNGLSPQLVTYLA
ADDB_STRPM        HLDMGNEILVHGIIDRIDQLS-----DGSLGIVDYKSSANQFDIGTFYNGLSPQLVTYLA
ADDB_STRP8        HLDMGNEILVHGIIDRIDQLS-----DGSLGVVDYKSSANQFDIGTFYNGLSPQLVTYLA
ADDB_STRP6        HLDMGNEILVHGIIDRIDQLS-----DGSLGVVDYKSSANQFDIGTFYNGLSPQLVTYLA
ADDB_STRPG        HLDMGNEILVHGIIDRIDQLS-----DGSLGVVDYKSSANQFDIGTFYNGLSPQLVTYLA
ADDB_STRPD        QLDMGNEILVHGIIDRIDQLS-----DGSLGIVDYKSSANQFDIGTFYNGLSPQLVTYLA
ADDB_STRPF        QLDMGNEILVHGIIDRIDQLS-----DGSLGIVDYKSSANQFDIGTFYNGLSPQLVTYLA
ADDB_STRPZ        QLDMGNEILVHGIIDRIDQLS-----DGSLGIVDYKSSANQFDIGTFYNGLSPQLVTYLA
ADDB_STRP1        QLDMGNEILVHGIIDRIDQLS-----DGSLGIVDYKSSANQFDIGTFYNGLSPQLMTYLA
ADDB_STRP3        HLDMGNEILVHGIIDRIDQLS-----DGSLGIVDYKSSANQFDIGTFYNGLSPQLVTYLA
ADDB_STRS7        ELALGHQALIRGVIDRIDQLA-----DGRLGIVDYKSSARVFDIGAFYNGLSPQLVTYLA
ADDB_STREM        ELALGHQALIRGVIDRIDQLA-----DGRLGIVDYKSSARVFDIGAFYNGLSPQLVTYLA
ADDB_STRU0        QLHFDEKVRVNGIIDRIDQLD-----DGSIGIVDYKSSQTVFDIGKFYNGLNSQLPTYLE
ADDB_STRA1        ELMIDNTIKINGIIDRIDRLS-----DGSLGVVDYKSSAQKFDIQKFYNGLSPQLVTYID
ADDB_STRA5        ELMIDNTIKINGIIDRIDRLS-----DGSLGVVDYKSSAQKFDIQKFYNGLSPQLVTYID
ADDB_STRA3        ELMIDNTIKINGIIDRIDRLS-----DGSLGVVDYKSSAQKFDIQKFYNGLSPQLVTYID
ADDB_STRMU        ELMLDQAVKIRGVIDRIDRLS-----DGSLGIVDYKSSKNTFDLQKFYNGLSPQLVTYIE
ADDB_STRT2        DLLLANSIKITGIIDRVDRLT-----DGALGVVDYKTGKNVFDIQKFYNGLSPQLVTYLE
ADDB_STRTD        DLLLANSIKITGIIDRVDRLT-----DGALGVVDYKTGKNVFDIQKFYNGLSPQLVTYLE
ADDB_STRGC        ILEDGRAVSVRGKVDRIDRLLA----DGSLGVVDYKSSETKFSYEKFFNGLNSQLPTYLA
ADDB_STRSV        TLENGRAVTVSGKVDRIDRLTK----TESLGVVDYKSGDIKFSFEKFFNGLNSQLPTYLA
ADDB_STRPN        QLDNGRSVFVRGKVDRIDRLKA----NGAIGVVDYKSSLTQFQFPHFFNGLNSQLPTYLA
ADDB_STRR6        QLDNGRSVFVRGKVDRIDRLKA----NGAIGVVDYKSSLTQFQFPHFFNGLNSQLPTYLA
ADDB_STRP2        QLDNGRSVFVRGKVDRIDRLKA----NGAIGVVDYKSSLTQFQFPHFFNGLNSQLPTYLA
ADDB_STRPS        QLDNGRSVFVRGKVDRIDRLKA----NGAIGVVDYKSSLTQFQFPHFFNGLNSQLPTYLA
ADDB_STRPI        QLDNGRSVFVRGKVDRIDRLKA----NGAIGVVDYKSSLTQFQFPHFFNGLNSQLPTYLA
ADDB_STRPJ        QLDNGRSVFVRGKVDRIDRLKA----NGAIGVVDYKSSLTQFQFPHFFNGLNSQLPTYLA
ADDB_STRP4        QLDNGRSVFVRGKVDRIDRLKA----NGAIGVVDYKSSLTQFQFPHFFNGLNSQLPTYLA
ADDB_STRSY        DLQNGKSVHVNGTIDRLDTLQI----NQAVGVVDYKSSDQSFSVGDFYNGLKPQLVTYLA
ADDB_STRS2        DLQNGKSVHVNGTIDRLDTLQI----NQAVGVVDYKSSDQSFSVGDFYNGLKPQLVTYLA
ADDB_LEVBA        VGK-RRQVTVRGRIDRLDAVQVKDK--TYLGIVDYKSSEHKFSYQEAYYGRAMQMLTYLD
ADDB_LACPL        IDA-THSVHVRGKIDRLDQIQVADQ--SYLGIVDYKSSQHKFDFQEAYYGLAMQMLTYLD
ADDB_LACS1        LGN-GHKVNVRGKIDRIDQMIIDNQ--RYLGIVDYKSSSHKFNYQDAYYGLALQMLTYLN
ADDB_LACSS        LDD-HREVKVRGKIDRIDQLTINNQ--PYLGIVDYKSSQHSFNFRDAYYGLALQMLTYLE
ADDB_PEDPA        VGE-GKEINVRGKIDRIDKIEIGDK--DYLGIVDYKSSNRKFDFTDAYYGLAMQMLMYLD
ADDB_LACP3        LPH-GGRVNVRGKIDRLDVYRESDA--QRFMVVDYKSTQHRFDDSDAYYGIALQMLTYVE
ADDB_LACCB        LPH-GGRVNVRGKIDRLDVYRESDA--QRFMVVDYKSTQHRFDDSDAYYGIALQMLTYVE
ADDB_ENTFA        LKN-QGKIHVRGKIDRIDQLVTPES--TYLGVIDYKSSHRKFNMTEAYYGLAMQMLTYLD
G4L7W9_TETHN      LSN-GGKLYLRGKIDRVDTTTIDGK--PWLAVMDYKSSAHQFDITDSYYGLAMQLLTYLD
ADDB_LACAC        LSG-NHRVDLRGKMDRVDIAHLADKNQVLAQVIDYKSSAKKFDLSMFYNGIAMQMVSYLD
ADDB_LACH4        LPG-NHQVNLRGKIDRVDLANFAEKDQVLAQVIDYKSSAKKFDLGMFYNGIALQMISYLD
ADDB_LACGA        ENNQKKIVDLRGKMDRVDLAKVNDR--VLGEVIDYKSSAKKFDLGLFANGISMQMISYLE
ADDB_LACJO        DNNKKKIVDLRGKMDRVDLAQVNDR--VLGEVIDYKSSAKKFDLGLFANGISMQMISYLE
ADDB_LACDA        FAG-QRKISLRGKIDRVDLFNGDQH--VLGQLIDYKSSDHSFNLARFASGVDLQMIAYLD
ADDB_LACDB        FAG-QRKISLRGKIDRVDLFNGDQH--VLGQLIDYKSSDHSFNLARFASGVDLQMIAYLD
ADDB_LIMRD        LKD-NHHIYLRGRIDRIDNLKQGNN--NFLTVVDYKSSNHLFDLTSAYYGLSLQLLTYLN
ADDB_LACRJ        LKD-NHHIYLRGRIDRIDNLKQGNN--NFLTVVDYKSSNHLFDLTSAYYGLSLQLLTYLN
ADDB_LEUCK        TPQ--ATVHLRGKIDRLDSQDPSQV---YGTIIDYKSNGKHFDWGQAYDGRQMQLLTYWQ
D5T5I7_LEUKI      RGK--VNVQVRGKIDRFDIQDQAHV---FGTIIDYKSSGKQFDWGQAFDGLQMQLLTYWQ
ADDB_LEUMM        R------MQVRGKLDRFDKQDVNGE---FGTIIDYKSNGKTFNWGQAYDGLQMQLLTYWD
ADDB_LACF3        GLGEGAKVSLRGRIDRLDELKLGEQ--TYQLVVDYKSYNKAFDLVDAYAGQALQMLAYLN
ADDB_OENOB        TLANGRKIYLRGKVDRIDQQDLEHI---FGTIIDYKSNGKVFDFRDAYVGTELQLLTYWL
                           : * :**.*              :***:    *.      *   *:  *  

ADDB_LACLM        VIK----QAFPN-----QKIWGALYLQFKNQPINLSEIN--------QLSEI-ANILKES
ADDB_LACLS        VIK----QAFPN-----QKIWGALYLQFKNQPINLSEIN--------QLSEI-ANILKES
ADDB_LACLA        VIK----EAFPN-----QKIWGALYLQFKNQPINLSEIN--------HLSEI-AGLLKES
ADDB_STRPB        ALK--QIAPHDI-----NQLFGAMYLHLQDPKLDLVTFK--------QIDNTLVESIYKA
ADDB_STRPC        ALK--QIAPHDI-----NQLFGAMYLHLQDPKLDLVTFK--------QIDNTLVESIYKA
ADDB_STRPM        ALK--QIAPHDI-----NQLFGAMYLHLQDPKLDLVTFK--------QIDNTLVESIYKA
ADDB_STRP8        ALK--QIAPHDI-----NQLFGAMYLHLQDPKLDLVTFK--------QIDNTLVESIYKA
ADDB_STRP6        ALK--QIAPHDI-----NQLFGAMYLHLQDPKLDLVTFK--------QIDNTLVESIYKA
ADDB_STRPG        ALK--QIAPHDI-----NQLFGAMYLHLQDPKLDLVTFK--------QIDNTLVESIYKA
ADDB_STRPD        ALK--QIAPHDI-----NQLFGAMYLHLQDPKLDLVTFK--------QIDNTLVESIYKA
ADDB_STRPF        ALK--QIAPHDI-----NQLFGAMYLHLQDPKLDLVTFK--------QIDNTLVESIYKA
ADDB_STRPZ        ALK--QIAPHDI-----NQLFGAMYLHLQDPKLDLVTFK--------QIDNTLVESIYKA
ADDB_STRP1        ALK--QIAPHDI-----NQLFGAMYLHLQDPKLDLVTFK--------QIDNTLVESIYKA
ADDB_STRP3        ALK--QITPHDI-----NQLFGAMYLHLQDPKLDLVTFK--------QIDNTLVESIYKA
ADDB_STRS7        ALK--NKG---------QGLFGAMYLHMQEPRLSLSDFK--------VLDDQLVAAAYKE
ADDB_STREM        ALK--NKG---------QGLFGAMYLHMQEPRLSLSDFK--------VLDDQLVAAAYKE
ADDB_STRU0        ALNTREKSKDMP-----PQLFGAMYLHMQDPKMDLNEFK--------LFDDKVVEKLYSR
ADDB_STRA1        AIS-RDKEVEQK-----PPIFGAMYLHMQEPRQDLSKIK--------NLDDL-VTKNHQA
ADDB_STRA5        AIS-RDKEVEQK-----PPIFGAMYLHMQEPRQDLSKIK--------NLDDL-VTKNHQA
ADDB_STRA3        AIS-RDKEVEQK-----PPIFGAMYLHMQEPKQDLSKIK--------NLDDL-VTKNHQA
ADDB_STRMU        ALR-SCKNLNDT-----DKIFGAMYLHMQEPKTDLANMK--------SIEKI-PETVHKN
ADDB_STRT2        ALR-QTYKV-DA-----DQLFGAMYLHMQVPQLNLSQI---------GLEKL-AAQAHKE
ADDB_STRTD        ALR-QTYKV-DA-----DQLFGAMYLHMQVPQLNLAQI---------GLEKL-AAQAHKE
ADDB_STRGC        AIQ-ELQGQQEG-----RDLFGAMYLQMTEPIVALKDTK--------ELGDA-VKEVAKT
ADDB_STRSV        AIE-ELADYQED-----KGTFGAMYLQMTDPIVALKDTK--------TLADA-VSQSMKP
ADDB_STRPN        ALK-REGEQN---------FFGAMYLEMAEPVQSLMAVK--------SLAGA-VVEASKS
ADDB_STRR6        ALK-REGEQN---------FFGAMYLEMAEPVQSLMAVK--------SLAGA-VVEASKS
ADDB_STRP2        ALK-REGEQN---------FFGAMYLEMAEPVQSLMAVK--------SLAGA-VVEASKS
ADDB_STRPS        ALK-REGEQN---------FFGAMYLEMAEPVQSLMAVK--------SLAGA-VVEASKS
ADDB_STRPI        ALK-REGEQN---------FFGAMYLEMAEPVQSLMAVK--------SLAGA-VVEASKS
ADDB_STRPJ        ALK-REGKQN---------FFGAMYLEMAEPVQSLMAVK--------SLAGA-VVEASKS
ADDB_STRP4        ALK-REGEQN---------FFGAMYLEMAEPVQSLMAVK--------SLAGA-VVEASKS
ADDB_STRSY        ALQ-ELDETK-D-----KPVFGAMYLHLQDPIIKLKDTK--------NLEQL-EGAANTS
ADDB_STRS2        ALQ-ELDETK-D-----KPVFGAMYLHLQDPIIKLKDTK--------NLEQL-EGAANTS
ADDB_LEVBA        AVKQNLPTLLDAPTAKDAELAGAVYLHLQNPILKAAE----------VLGEDPLTSLLKA
ADDB_LACPL        AVLHNEQALVGS-DQAAVKLAGALYMHIQNPTLKPKD----------IQG-GFEAALLKK
ADDB_LACS1        AMLQNTDLLLDLNAGEEIKPAGAVYMHLQNPVIKQKD----------ILKNPYSEVLLKQ
ADDB_LACSS        TVLQDQQAILPA--NSAVKPAGAFYLHLKNPTLTLKQLTK--KKMGQLQKGEFDQMLLDQ
ADDB_PEDPA        VVQRNKEKIDPA---TKAEISSALYMIFQYPLLKSKEWK-------GSDANQLNQSIFKK
ADDB_LACP3        AMANVPA-------DPPFVPAGALYFHLQDPKFKFST------------DLDLDIDRLKA
ADDB_LACCB        AMANVPA-------DPPFVPAGALYFHLQDPKFKFST------------DLDLDIDRLKA
ADDB_ENTFA        VALMDAVQLVGQ----EAKPAGSLYLHVHNPTLSYEGKDD------------IEQQMLKK
G4L7W9_TETHN      IALKDAVELIGKK---DVSGAGAYYFHVYDPILAPKKAS--------------EKERLKQ
ADDB_LACAC        ILVKNNQFFAGN---NELSLLGAFYQTVTRQLERLNSN---KLIDSQLNIRDNVIDGKPK
ADDB_LACH4        VLTNNNRFFAEE---DKLSLLGAFYQTVTRQLERLNSN---KLIDSSLNLRENAIDSKPK
ADDB_LACGA        VLKKNNKFFAQG---KNLDVLGAFYQNITSSLERLSSD---KMILSNYQIKDLLKESTKK
ADDB_LACJO        VLKNNNKFFAQG---KDLDVLGAFYQNITSSLERLSSE---KMILSNYQIKDLAKESTKK
ADDB_LACDA        VLEKNRDLLAGG---RQFDLLGAFYQYVTRKLNSVNSSSTGALFDSKLQLKENLLGGEDK
ADDB_LACDB        VLEKNRDLLAGG---RQFDLLGAFYQYVTRKLNSVNSSSTGALFDSKLQLKENLLGGEDK
ADDB_LIMRD        GLQANLTELETN----NPRLAGALYLRLNNPTIKAAELK----------KSSLDDLKLKE
ADDB_LACRJ        GLQANLTELETN----NPRLAGALYLRLNNPTIKAAELK----------KSSLDDLKLKE
ADDB_LEUCK        AAQLSAEQLGIE------AIGGAFFAKIAPEKLTIKDF------KGDVRAMLRGEIKPEQ
D5T5I7_LEUKI      AAQMNAQLLGVE------AIGGAFFAQIAPEKQLIANF------KGDIDDLLAGNVKPDI
ADDB_LEUMM        AAQQSAEKLGVA------AIGGAFFAKISPEKTKITD-------KTDLNALFTGKLIPET
ADDB_LACF3        ALQAANPGKQ---------LLGSLYLRLYVPTVDAGKEG--------------TAEELKE
ADDB_OENOB        ALSKNSSRIGIN------QPGGAVFVQIRNKPADISQALA-HQIQLDQLIGDRAKQQVPD
                                       .: :  .                                

ADDB_LACLM        MRYEGLVLEDAAEQIKGIENIALKK--------------------------------TNI
ADDB_LACLS        MRYDGLVLEDAAEQIKGIENIALKN--------------------------------TNS
ADDB_LACLA        MRYDGLVLEEAADQIKAIENITVKK--------------------------------SNI
ADDB_STRPB        LTYKGIFSEVEKEHLSTGAYQTKNA--------------------------------LYS
ADDB_STRPC        LTYKGIFSEVEKEHLSTGAYQTKNA--------------------------------LYS
ADDB_STRPM        LTYKGIFSEVEKEHLSTGAYQTKNA--------------------------------LYS
ADDB_STRP8        LTYKGIFSEVEKEHLSTGAYQTKNA--------------------------------LYS
ADDB_STRP6        LTYKGIFSEVEKEHLSTGAYQTKNA--------------------------------LYS
ADDB_STRPG        LTYKGIFSEVEKEHLSTGAYQTKNA--------------------------------LYS
ADDB_STRPD        LTYKGIFSEVEKEHLSTGAYQTKNA--------------------------------LYS
ADDB_STRPF        LTYKGIFSEVEKEHLSTGAYQTKNA--------------------------------LYS
ADDB_STRPZ        LTYKGIFSEVEKEHLSTGAYQTKNA--------------------------------LYS
ADDB_STRP1        LTYKGIFSEVEKEHLSTGAYQTKNA--------------------------------LYS
ADDB_STRP3        LTYKGIFSEVEKEHLSTGAYQTKNA--------------------------------LYS
ADDB_STRS7        LTYKGIFLAQAKEYLANGSYHLNNT--------------------------------LYE
ADDB_STREM        LTYKGIFLAQAKEYLANGSYHLNNT--------------------------------LYE
ADDB_STRU0        LTYKGIFLEREKEHLASGAYQMKSN--------------------------------LYS
ADDB_STRA1        LTYKGLFSEAEKEFLANGKYHLKDS--------------------------------LYS
ADDB_STRA5        LTYKGLFSEAEKEFLANGKYHLKDS--------------------------------LYS
ADDB_STRA3        LTYKGLFSEAEKEFLANGKYHLKDS--------------------------------LYS
ADDB_STRMU        LSYKGLFLEDEKAHLANGKYHLHDA--------------------------------VYS
ADDB_STRT2        LTYKGLFVASETEHLTGGNYDLQKT--------------------------------VTY
ADDB_STRTD        LTYKGLFVSSETEHLTGGNYDLQKT--------------------------------VTY
ADDB_STRGC        MQYKGLFLADKLASLGPVYEKSKVN--------------------------------SLS
ADDB_STRSV        LQYKGLFVADAVKELGPLYEKNKTN--------------------------------LLS
ADDB_STRPN        MKYQGLFLEKESSYLGEFYNKNKAN--------------------------------QLT
ADDB_STRR6        MKYQGLFLEKESSYLGEFYNKNKAN--------------------------------QLT
ADDB_STRP2        MKYQGLFLEKESSYLGEFYNKNKAN--------------------------------QLT
ADDB_STRPS        MKYQGLFLEKESSYLGEFYNKNKAN--------------------------------QLT
ADDB_STRPI        MKYQGLFLEKESSYLGEFYNKNKAN--------------------------------QLT
ADDB_STRPJ        MKYQGLFLEKESSYLGEFYNKNKAN--------------------------------QLT
ADDB_STRP4        MKYQGLFLEKESSYLGEFYNKNKAN--------------------------------QLT
ADDB_STRSY        LVYKGLFLKEESLGLNHFY-QTRNQ--------------------------------LYT
ADDB_STRS2        LVYKGLFLKEESLGLNHFY-QTRNQ--------------------------------LYT
ADDB_LEVBA        EQYQGLLLDDPDLLTNLDTLFGTPDYSGSSLLFRGLR-----RTKTGKITSY--GKLLVN
ADDB_LACPL        NKYKGILLDDPQLLEHLDSELQQGN--GTSKVYPFAR-----KKDGSYSGGR--AASLVT
ADDB_LACS1        NKYDGLVLDDQELLSNLDTSIEKAG---NSIVYPVRK-----YADGHFGGIKN-SGNVIT
ADDB_LACSS        FKYNGLIVNDEELLENLDTTLVNGQ----SPLFAFSK-----LKSGKFSSKQ-----LVT
ADDB_PEDPA        FSLNGFLLKDEELIKEIDKTIEDTR---KSDVFPIAF-----TTKGTLTKVS--ENSILS
ADDB_LACP3        FKYLGFLVAKDGADLAAVDKTISAETGGRSMMVPLGF-----KKDGAFNYNQ---SNILT
ADDB_LACCB        FKYLGFLVAKDGADLAAVDKTISAETGGRSMMVPLGF-----KKDGAFNYNQ---SNILT
ADDB_ENTFA        YQFDGLLMKDPDLLDHLDTSLQAKQ---SSLLFPIEE-----SAKEQIKPGRRQEDKFVT
G4L7W9_TETHN      YKLDGLFADDPEVFEAFDETLNKSE---HSLVFPIQK-----DKNEQIKGSVRSKEKFYT
ADDB_LACAC        LMYTGLINNNPQVLTEAEPFLD-NSSRQSELYSMVKT-----KKNG---TFSLPTDRSFS
ADDB_LACH4        LMYTGLISNNPEILLEAEPLLDGKSSQASQLYTGVGT-----KARG---GFKLPADRNFS
ADDB_LACGA        LMYNGILVADEEILDLIEPGME-KDRATSEIYSSIKR-----KVNG---DISWPRNQSFT
ADDB_LACJO        LMYNGILIADEEMLDLIEPGME-KDRAVSDLYTSVKR-----KVNG---YISWPQNQSFT
ADDB_LACDA        LKLSGVFVSEPAWYQEVDKALE--KKATSSVYRGLKL-----NKSG---GFGK-KDNFFS
ADDB_LACDB        LKLSGVFVSEPAWYQEVDKALE--KKATSSVYRGLKL-----NKSG---GFGK-KDNFFS
ADDB_LIMRD        HQYKGILLNDPQLLRELDKSLDKQA-----FLYPLKE-----YKNGKIKANK--EALLVT
ADDB_LACRJ        HQYKGILLNDPQLLRELDKSLDKQA-----FLYPLKE-----YKNGKIKANK--EALLVT
ADDB_LEUCK        FKYRGLFISEPAYIDSLETLAEGEG----SQFYQLKK-----KANGEL----YANSDVIS
D5T5I7_LEUKI      FKYRGLFVSEEDYIDSLDHSDDSRA----SQFYQLKR-----KNDGAL----YANSDFVD
ADDB_LEUMM        FKYRGLFISEPAYVSALTTLEPQEK----SAHYPVVL-----LKNGALG---KIGVDAVD
ADDB_LACF3        HLYQGITINDDAVLAALDHGLGEKGATLLSIKKKSKKDTSRFKVSADDQFSAKAGSNLVS
ADDB_OENOB        FQFHGILLDDQNYLANLQTVLAGQKAKYYNFGLTKKG-------------QKTARSDLVS
                      *.                                                      

ADDB_LACLM        YNEEEFEQLLKLNEEHYRAAGQRLKKGKIAINPIM----KRSEGIDQSGNVRGCRYCPLK
ADDB_LACLS        YNEEEFEQLLKLNEEHYRAAGQRLKNGKIAINPIM----KRSEGIDQSGNVRGCRYCPLK
ADDB_LACLA        YNQEEFEQLLKLNENHYQHAGQRLKSGQIAINPIM----KRSEGIDQTGNVRGCRYCPLK
ADDB_STRPB        NDE--LETLLNYNKYLYLKAAKHIKKGHFLINPYT----SDGKTVQG---------DQLK
ADDB_STRPC        NDE--LETLLNYNKYLYLKAAKHIKKGHFLINPYT----SDGKTVQG---------DQLK
ADDB_STRPM        NDE--LETLLNYNKYLYLKAAKHIKKGHFLINPYT----SDGKTVQG---------DQLK
ADDB_STRP8        NDE--LETLLNYNKYLYLKAVKHIKKGHFLINPYT----SDGKTVQG---------DQLK
ADDB_STRP6        NDE--LETLLNYNKYLYLKAVKHIKKGHFLINPYT----SDGKTVQG---------DQLK
ADDB_STRPG        NDE--LETLLNYNKYLYLKAAKHIKKGHFLINPYT----SDGKTVQG---------DQLK
ADDB_STRPD        NDE--LETLLNYNKYLYLKAAKHIKKGHFLINPYT----SDGKTVQG---------DQLK
ADDB_STRPF        NDE--LETLLNYNKYLYLKAAKHIKKGHFLINPYT----SDGKTVQG---------DQLK
ADDB_STRPZ        NDE--LETLLNYNKYLYLKAAKHIKKGHFLINPYT----SDGKTVQG---------DQLK
ADDB_STRP1        NDE--LETLLNYNKYLYLKAAKHIKKGHFLINPYT----SDGKTVQG---------DQLK
ADDB_STRP3        NDE--LETLLNYNRYLYLKAAKHIKKGHFLINPYT----SDGKTVQG---------DQLK
ADDB_STRS7        TDE--LETLLAYNEQLYLSAVKQIKTGHFLINPYT----ADGKSVQG---------DQLK
ADDB_STREM        TDE--LETLLAYNEQLYLSAVKQIKTGHFLINPYT----ADGKSVQG---------DQLK
ADDB_STRU0        EEE--LRNLLDYNQFLYLKAEKEIRAGHFLINPYT----EDGKTVKG---------DQLK
ADDB_STRA1        ETE--IAILQAHNQSLYKKASETIKSGKFLINPYT----EDAKTVDG---------DQFK
ADDB_STRA5        ETE--IAILQAHNQSLYKKASETIKSGKFLINPYT----EDAKTVDG---------DQFK
ADDB_STRA3        EAE--IAILQAHNQLLYKKASETIKSGKFLINPYT----EDAKTVDG---------DQFK
ADDB_STRMU        QKE--VDLLLDYNKRLYRSAAKQIRKGNFLINPYS----QDGKSVQG---------EQLK
ADDB_STRT2        DKED-LETLLDYNIKLFRSAAEVIRSGNFAINPYT----EDGKSVQG---------DQIK
ADDB_STRTD        DKED-LETLLDYNIKLFRSAAEVIRSGNFAINPYT----EDGKSVQG---------DQIK
ADDB_STRGC        QEE--LAVLLAYNEILYKKVAEGILAGHFEVNPYT----ENGRNIAPY-------VDQFK
ADDB_STRSV        QED--LDLLLAYNAYLYKKAAEGILSGHFAVNPYT----ENGRSIAPY-------VEQFK
ADDB_STRPN        DEE--FQLLLDYNAYLYKKAAEKILAGRFAINPYT----ENGRSIAPY-------VQQHQ
ADDB_STRR6        DEE--FQLLLDYNAYLYKKAAEKILAGRFAINPYT----ENGRSIAPY-------VQQHQ
ADDB_STRP2        DEE--FQLLLDYNAYLYKKAAEKILAGRFAINPYT----ENGRSIAPY-------VQQHQ
ADDB_STRPS        DEE--FQLLLDYNAYLYKKAAEKILAGRFAINPYT----ENGRSIAPY-------VQQHQ
ADDB_STRPI        DEE--FQLLLDYNAYLYKKAAEKILAGRFAINPYT----ENGRSIAPY-------VQQHQ
ADDB_STRPJ        DEE--FQLLLDYNAYLYKKAAEKILAGRFAINPYT----ENGRSIAPY-------VQQHQ
ADDB_STRP4        DEE--FQLLLDYNAYLYKKAAEKILAGRFAINPYT----ENGRSIAPY-------VQQHQ
ADDB_STRSY        EDE--FAVLLNHNQELYKQAAMDILAGRFAINPYT----KDGRSVAG---------EQLK
ADDB_STRS2        EDE--FAVLLNHNQELYKQAAMDILAGRFAINPYT----KDGRSVAG---------EQLK
ADDB_LEVBA        SNE--LDLLLTHTERLIKRAATDIFDGRVDLAPFR---EQNR-TALQY--------SPYK
ADDB_LACPL        NDQ--LERLLQHNSQLIIAAAEAIFAGEIQLNPIR---LNDKTTALQY--------SPYL
ADDB_LACS1        FDN--LMLLLKRNEELIQEAAKLIFAGDVALNPVL---WPDRRSALQY--------SPYK
ADDB_LACSS        LNQ--LDLLMAHNEDLIKEAGQAIFAGDTALNPIM---RPDRTNALTL--------SPFK
ADDB_PEDPA        EDE--LQNLIKHAELKVREAGEKIFKGELDMNPVQ---WPNRRTVMEY--------SPYK
ADDB_LACP3        PED--LSAYLLHNQALIIDAASRILAGDIALAPFQ---YGQESTVISN--------SDYQ
ADDB_LACCB        PED--LSAYLLHNQALIIDAASRILAGDIALAPFQ---YGQESTVISN--------SDYQ
ADDB_ENTFA        EPE--LGALLSHNRNKFIEAGNQIIGGEVQLNPAYQ--GKE-RIACRY--------CPFR
G4L7W9_TETHN      IEE--MNTLMAHNRKKLKEAAERILSGEIKMNPSYK--MKDKRRATQY--------SPFR
ADDB_LACAC        EEE--LELLLEYDEFLIKEASNQILSGKIELNPYR---QGKSKSALTY--------SDYK
ADDB_LACH4        EEE--FQLLLEYDEYLIKEASRQILSGQIKLNPYR---YGRSKNALTY--------SDFK
ADDB_LACGA        PDQ--LELLLAYNSYLIKNAGSEILSGKIKLDPYT---YGQ-QSSLTY--------SDFK
ADDB_LACJO        PDQ--LDLLLAYNSYLIKNAGNEILSGKIELDPYS---YGQ-QTSLTY--------SDFK
ADDB_LACDA        QDE--MRELLEYVEALIEDAASEILSGQIALNPFR---QGN-NTGLAF--------SDYK
ADDB_LACDB        QDE--MRELLEYVEALIEDAASEILSGQIALNPFR---QGN-NTGLAF--------SDYK
ADDB_LIMRD        PQQ--LDWLQNMNKELVINAGNQILSGDLKLNPYRLLTGSNRRTGLDY--------SDFL
ADDB_LACRJ        PQQ--LDWLQNMNKELVINAGNQILSGDLKLNPYRLLTGSNRRTGLDY--------SDFL
ADDB_LEUCK        PED--FELLLKRNLDNIQRASAAILSGDFPLSPAE--------GSLQF--------TPFT
D5T5I7_LEUKI      PED--FELLLSRNRDNINRAGEHILAGLFPLEPTI--------ASLRY--------TSFA
ADDB_LEUMM        PDE--FALLLQRNRENIITAGDLILSGYFPIMPVE--------GGLTY--------SPYL
ADDB_LACF3        PTD--LKRLMDHNAELIKEAAVQILQGQNEIRPYRRQVGTTAETGLAF--------SDFL
ADDB_OENOB        KED--LTVLLKHDEKKLVEAGNKIIHGEFPLYPIK---KNEQRSALTY--------SDYT
                    :  .             .   :  *   : *                           

ADDB_LACLM        SICRFEANIHMNEHSREIGQK------------SQAEILAELKGEERDE-----------
ADDB_LACLS        SICRFEANIHMNEHSREIGQK------------SQAEILAELKGEGRDE-----------
ADDB_LACLA        SICRFEANVHMNDHSREIGQK------------SQAEILAELKGEGRNE-----------
ADDB_STRPB        AITRFEADLDMAQARRLVTLP---------AKEKKECFLTLMRKESHL------------
ADDB_STRPC        AITRFEADLDMAQARRLVTLP---------AKEKKECFLTLMRKESRL------------
ADDB_STRPM        AITRFEADLDMAQARRLVTLP---------AKEKKECFLTLMRKESHL------------
ADDB_STRP8        AITRFEADLDMAQARRLVTLP---------AKEKKECFLTLMRKESHL------------
ADDB_STRP6        AITRFEADLDMAQARRLVTLP---------AKEKKECFLTLMRKESHL------------
ADDB_STRPG        AITRFEADLDMAQARRLVTLP---------AKEKKECFLTLMRKESHL------------
ADDB_STRPD        AITRFEADLDMAQARRLVTLP---------AKEKKECFLTLMRKESHL------------
ADDB_STRPF        AITRFEADLDMGQARRLVTLP---------AKEKKECFLTLMRKESHL------------
ADDB_STRPZ        AITRFEADLDMGQARRLVTLP---------AKEKKECFLTLMRKESHL------------
ADDB_STRP1        AITRFEADLDMGQARRLVTLP---------AKEKKECFLTLMRKESHL------------
ADDB_STRP3        AITRFEADLDMGQARRLVTLP---------AKEKKECFLTLMRKESHL------------
ADDB_STRS7        AITRFEADLDLGYARRLVVLP---------VKERRQAFLTRMNEEIKHED----------
ADDB_STREM        AITRFEADLDLGYARRLVVLP---------AKERRQAFLTRMNEEIKHED----------
ADDB_STRU0        AITRFEADLDLGQARMLLKLP---------TKEKREGFLKLMKEDMKGGKKDEI------
ADDB_STRA1        SITGFEADRHMARARALYKLP---------AKEKRQGFLTLMQ--QEEENDDL-------
ADDB_STRA5        SITGFEADRHMARARALYKLP---------AKEKRQGFLTLMQ--QEEENDDL-------
ADDB_STRA3        SITGFEADRHMARARALYKLP---------AKEKRQGFLTLMQ--QEEENDDL-------
ADDB_STRMU        AITHFEADRHMPYARKLYQLP---------RKEKRQGFLALMQSKKEEEGNDL-------
ADDB_STRT2        SITHFEADRHMGQARKLLRLP---------KKGKKEAYLELMAKTEEENQMQVSENTISF
ADDB_STRTD        SITHFEADRHMGQARKLLRLP---------KKGKKEAYLELMAKTEEENQMQVSENTISF
ADDB_STRGC        AITGFEANRHLGQARQLDKLDLSKFEKRPVGEKLRRAWIEKMREELEK------------
ADDB_STRSV        AITGFEANLHLGQARQLEKLDASKFDRRPTGDKLRQAWLEKMREEMEK------------
ADDB_STRPN        AITGFEANYHLGQARFLEKLDLADG-KRLVGEKLKQAWLEKIREELNR------------
ADDB_STRR6        AITGFEANYHLGQARFLEKLDLADG-KRLVGEKLKQAWLEKIREELNR------------
ADDB_STRP2        AITGFEANYHLGQARFLEKLDLADG-KRLVGEKLKQAWLEKIREELNR------------
ADDB_STRPS        AITGFEANYHLGQARFLEKLDLADG-KRLVGEKLKQAWLEKIREELNR------------
ADDB_STRPI        AITGFEANYHLGQARFLEKLDLADG-KRLVGEKLKQAWLEKIREELNR------------
ADDB_STRPJ        AITGFEANYHLGQARFLKKLDLADG-KRLVGEKLKQAWFEKIREELNR------------
ADDB_STRP4        AITGFEANYHLGQARFLEKLDLADG-KRLVGEKLKQAWFEKIREELNR------------
ADDB_STRSY        AITGFEADRHMGMAR------------RLVKEAKRQDWMERMKGGQD-------------
ADDB_STRS2        AITGFEADRHMGMAR------------RLVKEAKRQDWMERMKGGQD-------------
ADDB_LEVBA        SVMQFDPLLKENNYRDLPSL-------------NKDDVMARIAAEQEQEATDEHEI----
ADDB_LACPL        SIMQFDAMLAENAYRDLPPL-------------SAKQVLDLLKTQKGGENHE--------
ADDB_LACS1        AIMQFDELLG-NQYYRLPKE-------------NTADILQKLAQENSAESEV--------
ADDB_LACSS        SIFQFDAMLPENNYRQLEAL-------------DEKAVLERLMSKKGDGNLE--------
ADDB_PEDPA        DVMQFDAMLPENNYRIIEKL-------------DKDKVLEQIREEQEKNGR---------
ADDB_LACP3        SIMLFDPATGFDHYNHVPKL-------------KRKEVLGRVTTDPTQIPHHRQEDSQA-
ADDB_LACCB        SIMLFDPATGFDHYNHVPKL-------------KRKEVLGRVTTDPTQIPHHRQEDSQA-
ADDB_ENTFA        SVCDFDVMLKENNYHRIENL-------------SKEEIMARLLNKDEEGATEDE------
G4L7W9_TETHN      SISLFDPMLEENDYHRIHSL-------------SKEEIMERLKEEKDD------------
ADDB_LACAC        DIFFFDAMLRQNQYHEITRL-------------SKKDLLSKIKERLGKED----------
ADDB_LACH4        DIFFFDAMLRHNQYHEISNM-------------SKKDLLVKIKEKLGKKD----------
ADDB_LACGA        DIFFFDAMLKENNYHKIKAI-------------DKKTLLNLIKEKLDLDGDE--------
ADDB_LACJO        DIFFFDAMLKENNYHKIKSI-------------DKKTLLTLIREKLDLDGEE--------
ADDB_LACDA        DIFYFDQQLPTNSYRDLPNL-------------KKADLLALVEKRLRQRE----------
ADDB_LACDB        DIFYFDQQLPTNSYRDLPNL-------------KKADLLALVEKRLRQRE----------
ADDB_LIMRD        DVFQFDNMLDQQNYRDLNPN-------------LAKEAFDNVVQDDDEEDKK--------
ADDB_LACRJ        DVFQFDNMLDQQNYRDLNPN-------------LAKEAFDNVVQDDDEEDKK--------
ADDB_LEUCK        DVLRFDRALGDQYKNNTPK--------------NKSDILKLLKADEE-------------
D5T5I7_LEUKI      DILRFDRSLGDTYRPEAPK--------------GKANILKILRERDDHGDTIYD------
ADDB_LEUMM        DIIRFDRALGDAYKVQSPA--------------DKNTIIKLLKGGQD-------------
ADDB_LACF3        DVSRFDQALDDYKEIELTDA----------------DVEAKFEQEEE-------------
ADDB_OENOB        EIMNFDRNFGNQYNNLTRYPK------------NKSELISKMREEEGEN-----------
                   :  *:                                   .                  

ADDB_LACLM        --------------------
ADDB_LACLS        --------------------
ADDB_LACLA        --------------------
ADDB_STRPB        --------------------
ADDB_STRPC        --------------------
ADDB_STRPM        --------------------
ADDB_STRP8        --------------------
ADDB_STRP6        --------------------
ADDB_STRPG        --------------------
ADDB_STRPD        --------------------
ADDB_STRPF        --------------------
ADDB_STRPZ        --------------------
ADDB_STRP1        --------------------
ADDB_STRP3        --------------------
ADDB_STRS7        --------------------
ADDB_STREM        --------------------
ADDB_STRU0        --------------------
ADDB_STRA1        --------------------
ADDB_STRA5        --------------------
ADDB_STRA3        --------------------
ADDB_STRMU        --------------------
ADDB_STRT2        PVIDHAVRVDKKDQEDNHVD
ADDB_STRTD        PVIDHAVRVDKKDQEDNHVD
ADDB_STRGC        --------------------
ADDB_STRSV        --------------------
ADDB_STRPN        --------------------
ADDB_STRR6        --------------------
ADDB_STRP2        --------------------
ADDB_STRPS        --------------------
ADDB_STRPI        --------------------
ADDB_STRPJ        --------------------
ADDB_STRP4        --------------------
ADDB_STRSY        --------------------
ADDB_STRS2        --------------------
ADDB_LEVBA        --------------------
ADDB_LACPL        --------------------
ADDB_LACS1        --------------------
ADDB_LACSS        --------------------
ADDB_PEDPA        --------------------
ADDB_LACP3        --------------------
ADDB_LACCB        --------------------
ADDB_ENTFA        --------------------
G4L7W9_TETHN      --------------------
ADDB_LACAC        --------------------
ADDB_LACH4        --------------------
ADDB_LACGA        --------------------
ADDB_LACJO        --------------------
ADDB_LACDA        --------------------
ADDB_LACDB        --------------------
ADDB_LIMRD        --------------------
ADDB_LACRJ        --------------------
ADDB_LEUCK        --------------------
D5T5I7_LEUKI      --------------------
ADDB_LEUMM        --------------------
ADDB_LACF3        --------------------
ADDB_OENOB        --------------------