CLUSTAL format seed alignment for MF_01454

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

OBG_SYNY3       ------MQFIDQAEIEVQGGKGGDGMVSFR----REKYVPAGGPSGGNGGRGGSVIFEAD
OBG_SYNP2       ------MQFIDHAEIEVIAGKGGDGIVAFR----REKYVPAGGPAGGNGGWGGSVIFRAE
OBG_TRIEI       ------MQFIDQAEIQVEAGKGGDGMVAFR----REKFVPAGGPAGGNGGRGGSVVLVAV
OBG_ACAM1       ------MRFIDQTEIFVKAGDGGDGMVAFR----REKYVPAGGPAGGNGGRGGSVILQAS
OBG_SYNJA       ------MHFIDQAEIEVQAGNGGDGIVAFR----REKYVPAGGPSGGNGGRGGSVILVAD
OBG_GLOVI       ------MQFIDRSEIEVEGGRGGDGMVAYR----REKYVPAGGPAGGDGGHGGAVVLEAT
OBG_PAUCH       ------MQFIDQARIMVYAGRGGDGIVAFR----REKYVPAGGPSGGDGGRGGNVIFEAD
OBG_PROMP       ------MQFIDQANIILKAGKGGNGIVSFR----REKFVPAGGPSGGNGGKGGSIIIIAD
OBG_DEHM1       --------MFDRVEIRIKSGDGGSGKVSFR----REKFVPYGGPDGGDGGDGGNVYLEAD
OBG_SALRD       ------MKFLDQVDLRVSSGDGGKGVVAWR----REKYVPKGGPSGGDGGDGGSVYVEAD
OBG_PROA2       ------MKFVDSARIVVKAGDGGNGCVSFR----REKYVPKGGPDGGDGGRGGHVYLRAN
OBG_CHLT3       -------MFIDSAKIYVKAGDGGKGCVSFR----HEKFVPKGGPDGGDGGTGGSIFVKAD
OBG_COPPD       ------MIFIDTAEIIVYGGKGGDGAASFR----REKFIEKGGPDGGDGGKGGDVYLVTD
OBG_DESPS       ------MAFVDEAKFFVKAGDGGNGCVSFR----REKFVPKGGPNGGDGGKGGDVIMVAS
OBG_PHYAS       ---MFSLHFIDEAFNEVYAGNGGHGIVAFR----REKYVPFGGPAGGNGGNGGSVIFVGE
OBG_PHYMT       ------MYFIDEAINEIKAGNGGNGVVSFR----KEKYVPLGGPDGGNGGKGGSIFFIGE
OBG_ACHLI       -----MSAFVDAVTVEVKAGRGGNGKVAFR----REAHVEFGGPAGGNGGRGGHIYFIGD
OBG_MYCAP       -----MAKFIDEIKLTLIAGKGGDGIISFR----REAHVDKGGPDGGDGGKGGNIYFVGD
OBG_MYCS5       -----MAKFIDQVKIMLKAGKGGDGMISFR----REAHVDKGGPDGGDGGTGGNIYFVAD
OBG_MYCMO       ------MKFIDEVELELRGGKGGDGAISFR----REAHVANGGPDGGDGGKGGDIYFRPN
OBG_MYCPU       ------MKFIDEITLNVKAGKGGNGMIAFR----REAHVDRGGPSGGDGGNGGNIYFVGD
OBG_MYCA5       ------MKFIDEVNVLVKAGKGGDGIISFR----REANVDRGGPDGGNGGRGGNVYFRGD
OBG_MYCH2       ------MRFVDYVSIEVVAGKGGDGIISFR----REAHVDKGGPDGGDGGWGGSIYFVGD
OBG_MESFL       ------MKFIDTAKFTIKAGNGGNGAVSFH----TALFVPNGGPNGGDGGNGGSVIFEAD
OBG_MYCPN       ------MGLTDYCECRFSAGNGGNGIIAWR----REAHYDKGGPGGGNGGNGGNVVLQAD
OBG_MYCGA       ------MQFIDRCQIKLIAGNGGDGIIAWR----REAHYDKGGPAGGSGGKGGNIILVAD
OBG_MYCPE       -------MLIDKCTLFLRAGNGGNGVISWR----KEAHYPEGGPWGGDGGKGGDVYIIGD
OBG_UREU1       ------MAFIDKCKIVLIAGNGGDGIVSWR----RETHVPEGGPAGGNGGNGGSIWFVGN
OBG_ROSS1       ----MAGDFYDYARIFVQAGDGGDGAATFR----REKYVPRGGPDGGDGGRGGHIYLVAD
OBG_HERA2       -----MSDFIDRALITVKAGDGGDGMATFR----REKYVPRGGPDGGDGGRGGSVYLEVS
OBG_THERP       -------MFYDEAKIFVKAGNGGNGAVSFH----REKYIPRGGPDGGDGGRGGNVYLRVD
OBG_BACSU       -------MFVDQVKVYVKGGDGGNGMVAFR----REKYVPKGGPAGGDGGKGGDVVFEVD
OBG_STACT       -------MFVDQVKILLKAGDGGNGITAYR----REKYVPFGGPAGGDGGRGASVIFEVD
OBG_EXIS2       -------MFVDQVNIYVKAGDGGRGQVAFR----REKYVPDGGPAGGDGGHGAHVVLEVD
OBG_ENTFA       -----MSMFLDQVTIDVKAGKGGDGMVAFR----REKYVPDGGPAGGDGGRGGDVVLVVE
OBG_LACLA       -----MSLFLDTARIEVKAGKGGDGAVAFR----REKYVPDGGPAGGDGGKGGSVIFKVD
OBG_BREBN       -------MFVDQVKVYVKGGDGGNGAVSFR----REKYVPLGGPAGGDGGQGGDVVFVVD
OBG_LACJO       -------MFVDQTKIDVQAGKGGDGAVAFR----HEKYVPLGGPAGGDGGRGGSIILVAD
OBG_LACSS       -------MFVDQVKIDVKAGKGGDGAVAFR----REKFVPLGGPAGGDGGRGGSVILVVD
OBG_LACF3       -----MPTFVDQIKIEVHAGHGGNGMVAFR----REKYVPNGGPAGGDGGRGGSIILKVD
OBG_PEDPA       -------MFVDQVKINVKAGNGGNGIVAFR----REKYVPNGGPAGGDGGRGGNVVLKVD
OBG_LEUMM       ------MAFVDQAQIEVKAGKGGDGIVSFR----HEKFVAMGGPFGGDGGHGGSIIFKVD
OBG_OENOB       ------MAFVDQATIEMKAGNGGDGIISFR----HEKFVPLGGPFGGDGGKGGDIYFIVD
OBG_HELMI       -------MFYDQARIFVKGGDGGNGIVSFR----REKYVPEGGPNGGDGGDGGNVIFIGD
OBG_PELTS       -------MFYDRARIFVKGGDGGNGCVAMR----REKYVPEGGPWGGDGGRGGNVILRAD
OBG_DESHY       -------MFYDQAKIYVKGGDGGAGAVAFR----REKYVPEGGPSGGDGGRGGKVIFIAD
OBG_DESAP       -------MFKDYAKIHVKAGDGGNGCVAFR----REKYVPYGGPSGGDGGRGGHVILRAD
OBG_MOOTA       -------MFYDEAKIYVKGGDGGNGIVAFR----REKYVPRGGPNGGDGGRGGSVILEAD
OBG_CARHZ       -------MFYDTAKIYVKAGDGGNGCVSFR----REKYVPNGGPDGGDGGRGGSVILVGD
OBG_DESRM       -------MFYDRAKIYVKGGDGGNGCIAMR----REKYVPFGGPWGGDGGHGGDVTFIAD
OBG_SYNWW       -------MFVDQARIFVKGGDGGNGIVAFR----REKYVPMGGPSGGDGGRGANVILVAD
OBG_SYMTH       -------MFVDVARIYVKGGDGGRGSNSVR----REKYVPQGGPWGGDGGRGGDVVFVVD
OBG_HALOH       -------MFVDEVEIKVKGGQGGNGVVSFR----REKFEPMGGPDGGDGGDGGNVILRVD
OBG_NATTJ       -------MFIDRAKIYVKGGDGGNGIVAFR----REKYVPDGGPSGGDGGKGGNVILEVD
OBG_ALKOO       -------MFIDKAKIYLKAGKGGDGAVAFR----REIYVPAGGPAGGDGGKGGNIIFQVD
OBG_CLOD6       -------MFIDKARIFVKAGNGGNGSVAFR----REKYVPAGGPDGGDGGRGASIIFEVD
OBG_RUMCH       -------MFRDSAKIYVKAGNGGNGMVSFH----REKYIAAGGPDGGDGGKGGDVIFVVD
OBG_HUNT2       -------MFVDRARIYIKAGDGGDGAISFH----REKYISKGGPDGGDGGKGGDVIFVVD
OBG_LACP7       -------MFADSAKIFIRSGKGGDGHVSFR----REIFVPAGGPDGGDGGKGGNVIFEVD
OBG_CLOPS       -------MFIDTAKIFVKSGDGGHGSVSFR----REKYVPLGGPDGGDGGKGGDVTFVVD
OBG_CLOTE       -------MFIDKAKIYVKSGDGGNGSVSFR----REKYVPLGGPDGGDGGKGGDIVLVSD
OBG_CALS8       -------MFVDIAKIYVKAGDGGDGIVAFR----REKYVPAGGPAGGDGGKGGDVIFVAD
OBG_CALS4       ------MVFIDTARIYIKAGDGGNGFISFR----REKYVPYGGPDGGDGGKGGDVIFIAD
OBG_FUSNN       -------MFIDEVIITVKAGNGGDGSAAFR----REKFVQFGGPDGGDGGKGGDVIFVAD
OBG_FINM2       -------MFIDVAKIELKAGKGGDGSVAFR----REKYEPSGGPAGGDGGDGGSIIIVGD
OBG_ELUMP       ------MSFLDRVKIYVKAGKGGDGCLSFR----REKFIEFGGPNGGNGGKGGDVYIKTE
OBG_UNCTG       -------MFIDKVNTYLAAGRGGDGCISFR----REKYVPYGGPDGGNGGNGGDIYFESD
OBG_FRASN       -----MPTFVDRVVLHAAAGDGGHGCCSIH----REKFKPLGGPDGGNGGRGGNVLLRVD
OBG_SACEN       -MEAFVSRFVDRVTIHVAAGDGGNGCASVH----REKYKPLGGPDGGNGGRGGDVRLVVD
OBG_STRGG       -----MTTFVDRVELHAAAGNGGHGCASVH----REKFKPLGGPDGGNGGRGGDVILVVE
OBG_KINRD       ----MSTHFVDRVVVHASGGDGGNGCASVH----REKFKPLGGPDGGNGGKGGDVILEVD
OBG_NOCSJ       ---MAVPTFVDRVTLHVSAGRGGNGVASVH----REKFKPLGGPDGGNGGPGGSVTLRVD
OBG_SALTO       -----MTTFVDRVVLHLQAGDGGHGCVSVH----REKFKPFGGPDGGNGGHGGSVSLVVD
OBG_ACIC1       -----MTTFVDRVVVHVRGGDGGNGCASIR----REKFKPLGGPDGGNGGRGGDVVFVVD
OBG_THEFY       -----MSDFVDEAVLHLKAGDGGHGCVSIH----REKFKPLGGPDGGNGGHGGDVILEVD
OBG_RENSM       -----MASFVDRVVLHVSGGSGGHGCVSVK----REKFKPLGGPDGGNGGDGGNVILRVS
OBG_KOCRD       -----MASFVDRVIVHATGGNGGHGCVSVK----REKFKPLGGPDGGNGGDGGSVILRVD
OBG_LEIXX       -----MATFVDRVTVHLRAGNGGNGCVSVR----REKFKPLAGPDGGNGGNGGDIVLVAD
OBG_BIFA0       -----MSDFVDRVTVHVKGGDGGNGSAGIR----REKYKPLAGPNGGNGGKGGSVILKAD
OBG_CUTAK       ---MAIPSFVDRATLTAVAGKGGHGCASVK----REKFKPLGGPDGGNGGHGGSVILRVD
OBG_CORDI       -----MARFVDRVVLHLEAGDGGNGCASVH----REKFKPLGGPDGGNGGHGGDIILTVS
OBG_CORU7       -----MSQFVDRVVLHLKAGDGGNGCNSVR----REKFMPLGGPDGGNGGHGGDIVLEVD
OBG_TROWT       MSGITLPEFVDCVTVEFSAGRGGNGCASVR----REKYKPLAGPDGGSGGHGGSIFLKAD
OBG_DEIRA       ------MAFRDVLNIEVAAGNGGDGSMSFH----RAKYMEKGGPDGGHGGRGGSIILRAI
OBG_THET8       -------MFQDVLVITVAAGRGGDGAVSFR----REKFVPKGGPDGGDGGRGGSVYLRAR
OBG_RUBXD       ------MQFIDEARFVVRGGRGGDGAVSFH----REKYRPRGGPDGGRGGDGGSVILRAT
OBG_AKKM8       -------MFVDNIRIFARAGKGGNGLVSFR----RAKFVPKGGPDGGDGGDGGSVILEVD
OBG_METI4       -------MFTDYVRILAKAGKGGNGCISFC----REAFRPHGGPDGGDGGKGGDVILEVN
OBG_OPITP       -------MFVDECVVKLQAGDGGRGCISFR----REKYEPWGGPNGGDGGRGGDVILLGD
OBG_CHLPN       -------MFVDQITLELRAGKGGNGVVAWR----KEKYLPKGGPYGGNGGNGGSVIIEAT
OBG_PARUW       -------MFVDRVIIELIAGKGGNGVVAWR----REKYIPKGGPAGGNGGRGGSVILEAD
OBG_RHOBA       -------MFFDRVEIEFQAGKGGDGCMSFR----KEKYVPKGGPDGGDGGRGASIVLEAR
OBG_SULSY       -------MFIDKAKIYVKAGDGGNGCVAFL----REKYVPFGGPAGGDGGKGGDIILIAD
OBG_AQUAE       -----MEKFVDRVKIFVKGGKGGDGAVAFL----REKYRPKGGPAGGDGGKGGDVILVAT
OBG_THEYD       ------MQFIDYVKIYVKAGDGGRGCISFR----REKYVPKGGPDGGDGGKGGDVIIQAS
OBG_HYDS0       ------MNFIDIAQIKVKAGDGGNGGVYFL----REKYRPYGGPAGGDGGKGGSVILQAD
OBG_THEM4       ---MERSDFVDRVIIYVKGGKGGDGSASFR----HEKYVPKGGPDGGDGGNGGYVFLRAN
OBG_FERNB       ---MERIEFIDVVDIYVKAGDGGNGAVTFR----REKYIPFGGPDGGDGGDGGYVFLVAD
OBG_THENN       -MNIKSAEFVDRVKIFVKAGDGGNGCVSFR----REKYVPKGGPDGGDGGDGGFVFLRAN
OBG_PSELT       ---MQKEDFVDRVTIFVKAGDGGNGAVSFR----REKYVPKGGPDGGDGGDGGFVILRAN
OBG_PETMO       ----MIGDFVDEVNIKVIAGKGGDGAVSFR----REKFVEKGGPDGGDGGDGGSIIIKST
OBG_DICTD       -------MFIDRAKIYVKAGDGGNGCIAFR----REKFVPKGGPAGGDGGKGGDVIIEAD
OBG_ACIC5       -------MFIDEAKIRVKAGDGGNGCMAFR----REKFVPRGGPSGGDGGRGGDIVMEST
OBG_PELCD       ------MKFIDRVKIHVKAGDGGRGCLSFR----REKFIPKGGPDGGDGGRGGNIVLRVD
OBG_SYNAS       ------MKFIDEAKIYVKAGDGGRGCVSFR----REKYVPFGGPNGGDGGKGGDVVIVAT
OBG_ANADF       ------MKFVDEVRIHVKAGDGGNGAVAWR----REKFIPRGGPAGGDGGNGADVVLVVD
OBG_MYXXD       ------MKFVDEVRIFVKAGDGGNGAVSFR----REKYIERGGPNGGDGGNGGSVVFVAD
OBG_SORC5       ------MRFVDRCRLKVIAGDGGNGAIAFR----REKYIPFGGPAGGDGGRGGDVVFVGD
OBG_SOLUE       -------MFIDEVRILVKAGDGGNGCLAFR----REKFVPRGGPSGGDGGRGGDVTLVCS
OBG_SYNFM       ------MKFVDEVKVHVLSGNGGNGCVSFR----REKYVPRGGPDGGDGGEGGSVIFVAS
OBG_PELPD       ------MKFIDEVTLFASSGHGGAGCVAFR----REKFIEFGGPNGGDGGKGGDVVFVAK
OBG_DESAH       ------MRFIDEASITVISGKGGPGCVSFR----RERFIERGGPNGGDGGKGGSVIFETD
OBG_DESOH       ------MKFIDEATITVSSGKGGRGCVSFR----RERFVPRGGPDGGDGGSGGSLLFRVN
OBG_DESAL       ------MKFVDEATLIVQSGDGGRGCVSFR----RERFIPRGGPDGGNGGKGGDVVLVAT
OBG_DESDA       ------MRFVDEARIQVRAGKGGHGCLSFR----REKFVPRGGPDGGNGGDGGSVYLRAD
OBG_LAWIP       ------MRFVDEVTISVSAGKGGNGCVSFR----REKFIPKGGPNGGDGGDGGNIIFKAD
OBG_BDEBA       ------MKFIDEVSISLASGRGGPGCVSFR----RESMQARGGPDGGNGGKGGDVIIRTS
OBG_BUCAP       ------MKFIDQTIIQVIAGNGGNGCVNFR----REKYIPKGGPDGGDGGDGGNVWLQSD
OBG_BUCBP       ------MKFLDKAIIHVIAGNGGHGRTSFR----REKYIPKGGPDGGDGGNGGNVWLQTV
OBG_BUCCC       ------MKFVDSVIINVSAGKGGDGCISFR----REKFVPKGGPDGGNGGDGGNIWIVSN
OBG_WIGBR       ------MNLTDNAVIFVKGGNGGKGCVSFR----REKYIPKGGPDGGNGGNGGNVWIYSD
OBG_PHOPR       ------MKFVDEAVIRADAGDGGNGTVSFR----TEKYVPRGGPDGGDGGDGGDVYLLAD
OBG_PSYIN       ------MKFVDEAKIKVDAGDGGNGCIGFR----TEKYIPRGGPNGGDGGDGGDVYLQAD
OBG_PSEHT       ------MKFVDEVEIRVEAGDGGAGIVSFR----REKYIPEGGPDGGDGGDGGSVYLQAD
OBG_COLP3       ------MKFVDEVEIRVEAGDGGNGCVSFR----KEKFIEYGGPNGGDGGDGGDVYLMAD
OBG_ECOLI       ------MKFVDEASILVVAGDGGNGCVSFR----REKYIPKGGPDGGDGGDGGDVWMEAD
OBG_BAUCH       ------MKFIDEATIIVAAGDGGNGCISFR----REKYIPFGPAEGGDGGNGGNVWLQAD
OBG_BLOPB       ------MKFVDMTNITVIAGNGGNGCVSFQKSGRRASFLKK--PNGSNGGNGGDVWLLAD
OBG_LEGPL       ------MKFVDEALIKVEAGKGGNGCLSFR----REKFIPRGGPDGGDGGDGGSIYFEAS
OBG_DICNV       ------MRFVDEVVINVKAGKGGNGIVSFR----REKYIEFGGPDGGDGGDGGSVYLRAS
OBG_ACIF5       ------MKFIDEVRIHVASGNGGHGAVSFR----REKFIPFGGPDGGDGGRGGSVYLVAQ
OBG_METPP       ------MKFVDEAYIDVIAGNGGNGCVSFR----REKFIPFGGPNGGDGGRGGSVYAVAD
OBG_JANMA       ------MKFIDEAKIEVIAGDGGNGVASFC----REKFRPFGGPDGGDGGKGGSIYAVAD
OBG_METFK       ------MKFIDEATIKVYAGDGGNGVATFR----REKYEAMGGPNGGDGGRGGSIYMIAD
OBG_NITMU       ------MKYIDEAIIHVIAGKGGDGVAAFR----REKYIPKGGPSGGDGGRGGSIYAMAD
OBG_DECAR       ------MKFIDEAKIYIKAGDGGNGAATFR----REKYIPMGGPNGGDGGRGGSIYAVAD
OBG_CHRVO       ------MKFIDEARIEVMAGRGGNGVASFR----REKFVPFGGPDGGDGGKGGSVYAVAD
OBG_BORPD       ------MKFVDEATIEVIAGKGGNGVASFR----REKFIPKGGPDGGDGGRGGSIYAVAD
OBG_ACIAD       ------MRFVDEAVITVEAGDGGNGVASFR----REKFVPFGGPDGGDGGRGGSVYIQAD
OBG_PSYWF       ------MRFIDEAIVTVKAGDGGNGIVSFR----REKYVPRGGPDGGDGGKGGDVFVVAD
OBG_ALCBS       ------MQFVDEATIDVHAGKGGDGCLSFR----REKYVEFGGPDGGDGGAGGHVFVQAD
OBG_CHRSD       ------MQFVDEASIIVEAGKGGNGCLSFR----REKYVPKGGPDGGDGGHGGSVYLIGD
OBG_HAHCH       ------MKFVDEATIYVEAGKGGNGCLSFR----REKYVPKGGPDGGDGGDGGSVILEAD
OBG_SACD2       ------MKFVDEAPIFVHAGKGGNGCMSFR----REKFIEKGGPDGGDGGDGGSVYLEAD
OBG_MARMS       ------MKFVDEASIYVRAGKGGNGALSFW----REKFVAKGGPDGGDGGNGGSVVLVAD
OBG_PSEU2       ------MKFVDEVSIRVKAGDGGNGCMSFR----REKFIENGGPNGGDGGDGGSIFMVAD
OBG_COXB1       ------MKFVDEAFVRVEAGNGGHGCLSFR----REKFIPRGGPDGGDGGDGGSVYFVAD
OBG_HYDCU       ------MQFVDEANIRVEAGRGGNGVASFR----REKYIPFGGPNGGDGGDGGSIYLIAD
OBG_NITOC       ------MKFIDEAIIKVQAGAGGHGCLSFR----REKFIPFGGPDGGDGGNGGSIYLIAD
OBG_THISH       ------MKFVDEATIKVKAGDGGNGCVSFR----REKFVPFGGPDGGDGGDGGSVYLVAT
OBG_METCA       ------MKFVDEAEIRVDAGDGGNGCISFR----REKYIPFGGPDGGDGGDGGSVYLVAS
OBG_ALKEH       ------MKFVDEVTIRVEGGDGGDGCASFR----REKYIPRGGPDGGDGGHGGSVWLRAD
OBG_HALHL       ------MRFVDEVTFVVRAGDGGDGCVHFR----REKYVPRGGPDGGDGGRGGSVYLEGD
OBG_XYLFT       ------MKFVDEAEIQVIAGNGGDGCVSFR----REKFIPLGGPDGGDGGDGGSVWLVAD
OBG_FRAP2       ------MRFVDEVVIKLQAGKGGNGCVSFR----REKYVPRGGPDGGDGGHGGSIYLKAD
OBG_VESOH       ------MKFVDSASVRIEAGKGGAGCLGFR----RERYISDGGPDGGDGGDGGHVYFQGQ
OBG_CAUVN       ------MKFLDQCKIYIRSGNGGGGSVSFR----REKYIEYGGPDGGDGGRGGDVWIEAV
OBG_HYPNA       ------MKFLDQAKVYIRSGGGGAGCVSFR----REKFVEYGGPDGGDGGRGGDVWIEAV
OBG_METSB       ------MKFLDSAKIYIRSGDGGAGCLSFR----REKFIEFGGPDGGDGGRGGDVVVECV
OBG_OLICO       ------MKFLDEAKVYIRSGDGGNGCVAFR----REKFIEYGGPNGGNGGRGGDVIIETV
OBG_RHOCS       ------MKFLDQCKIYLKSGDGGPGAVAFR----REKFIEFGGPDGGNGGRGGDVIIEAV
OBG_RHORT       ------MKFLDQAKIFVKSGDGGNGCVAFR----REKNIEFGGPDGGHGGRGADVIVEAV
OBG_GLUOX       ------MKFLDQAKIYVRSGDGGDGVIAFR----REKYIEFGGPDGGDGGRGGDIIFRAV
OBG_RHOS5       ------MKFLDLCKVYIRSGGGGGGCVSFR----REKFIEFGGPDGGDGGNGGSVWAEAV
OBG_SPHAL       ------MHFLDQAKIFIKSGDGGPGAVSFR----REKYIEYGGPDGGNGGKGGDIVFEAV
OBG_ZYMMO       ------MQFLDQAKIYLRSGAGGPGAVSFR----HEKYIEYGGPDGGNGGKGGDIVFEAV
OBG_MAGMM       ------MKFLDEAKIYLKSGDGGGGCISFR----REKYIPFGGPDGGDGGRGGDVIFQAD
OBG1_ANAMM      ------MSFVDEAKIHVKGGKGGDGCVSFR----REKFIEFGGPDGGNGGNGGSVIFIAS
OBG_ANAPZ       ------MSFIDEAKVFVKGGNGGNGCVSFR----REKYIEFGGPDGGNGGDGGSVILEAS
OBG_EHRRW       ------MSFIDEAKVYLKAGKGGDGCSSFR----REKFIEFGGPDGGNGGNGGSIIFIAS
OBG_WOLTR       ------MDFIDEVKLYLKAGDGGDGCVSFR----REKFVEFGGPNGGNGGKGGNIVFVSD
OBG_NEOSM       ------MKFIDEVKVFLKAGNGGDGCSSFR----REKFVEFGGPDGGCGGDGGNVIFITD
OBG_PELUB       ------MKFLDQVKIYVKAGNGGHGSPSFR----REKFIEYGGPDGGDGGKGGTIYLRSE
OBG_ORITI       ------MQFIDEAKIFIKGGNGGDGCVSFR----REKFVPNGGPDGGNGGRGGDIIFIGD
OBG_RICBR       ------MNFIDEVKIYIKGGNGGNGCVSFH----REKFIDRGGPDGGDGGRGGSIIFRSN
OBG_BACV8       ---MAESNFVDYVKIYCRSGKGGRGSAHMR----REKYVPNGGPDGGDGGRGGHVILRGN
OBG_PORG3       --MAAESNFVDYVKIYCRSGKGGRGSTHFR----REKYIPKGGPDGGDGGRGGHVFLRGN
OBG_CYTH3       ---MASSNFIDYVKVCCRSGKGGAGAVHFR----KEKHTPLGGPDGGNGGRGGHIILRGN
OBG_GRAFK       ---MTEGNFVDYVKIHVFSGKGGKGSAHLH----REKYITKGGPDGGDGGRGGHVILKGS
OBG_AZOPC       ---MTKSNFVDYAKIHIRSGKGGKGSIHFR----HEKYIPWGGSDGGNGGKGGDIILRGS
OBG_AMOA5       ---MASFDFIDEVKKYVQAGHGGPGVVHFR----REKFVPKGGPDGGDGGKGGDIILKGN
OBG_SULMW       ----MLNKFTDFIKIYCKSGDGGSGIIHFR----KEKFINRGGPDGGDGGKGGNILIRGN
OBG_CAMFF       -------MFVDSASFSVSSGKGGPGCASFR----REKHVPLGGPDGGDGGNGGDVYFIVD
OBG_CAMHC       -------MFVDNVKFHTKAGKGGAGCVSFR----REKFILFGGPDGGDGGDGGNVYFKAD
OBG_ARCB4       -------MFIDSAKFTVISGKGGQGCASFR----REKFVVQGGPDGGDGGKGGNVYFLVD
OBG_NITSB       -------MFIDNVELTVHSGKGGQGAVSFR----REKFVPKGGPDGGDGGDGGNVYFLVD
OBG_NAUPA       -------MFVDNIKLKVKSGKGGQGCVSFR----REKFVVKGGPDGGDGGKGGDVIVECD
OBG_SULNB       -------MFVDSVELLISSGKGGAGAISFW----TEKFVIKGGPDGGDGGRGGSVFFKVD
OBG_WOLSU       -------MFVDNVDIYVSSGKGGAGAVSFR----REKYVIQGGPDGGDGGKGGDLYFEVN
OBG_SULDN       -------MFTDVVELTVSSGKGGQGCVSFR----REKFVVNGGPNGGDGGKGGDIWFKCD
OBG_CAMLR       -------MFIDNVKLVLSSGNGGKGAVSFR----REKHVPLGGPDGGDGGNGGDVYFICD
OBG_HELHP       -------MFVDSVDIFIASGKGGAGAVSFR----REKFVIHGGPDGGDGGDGGDVYVEVD
OBG_HELAH       -------MFVDSVEIIIASGKGGPGMVSFR----REKFVIKGGPDGGDGGDGGDVYFEVD
OBG_BORBZ       -----MYNFKDSVNITVVSGNGGSGCVSFL----REKFNAKGGPDGGNGGSGGSVIFKVR
OBG_BORT9       -----MHTFKDSLNITVSSGSGGAGCVSFL----RERFKAKGGPDGGDGGRGGNVVFKVK
OBG_TREPS       -----MASFVDEVLIRVSSGRGGNGCVAFR----REKYVPRGGPAGGDGGRGGDVVFQVR
OBG_TREDE       -----MVKFADESKIRVSSGKGGNGCIAFR----REKYVPMGGPSGGDGGRGGDLIFEIR
OBG_LEPBP       -----MSGFIDEVPIQIRAGHGGAGSVHFH----KEKFVEFGGPDGGDGGKGGDVIFLAE
OBG_LEPIC       -----MESFVDEVAIEVFAGHGGAGSVHFR----REKYVEFGGPDGGDGGIGGNVVIRPN
                          *       .* ** *                  . *. ** *. :     

OBG_SYNY3       ANLQTLLDFRYARIFKAEDGKKGGSSNCTGANGKDVVVQVPCGTMVYDLDGE--------
OBG_SYNP2       ENLQTLLDFRYARTFKAQDGERGGPNNCTGASGEDLIVDVPCGTVIYDRETD--------
OBG_TRIEI       ANLQTLLDFKFQRVFKAENGKRGGPKNMTGAGGSDRLIEVPPGTMIYDRETE--------
OBG_ACAM1       TQLQTLLDFKYKHQFVAEDGKRGGPKNLTGASGQDRLIEVPCGTVIYDADSM--------
OBG_SYNJA       PGLQTLLDFRFQPVIKAEHGAKGGPNHRSGASGADRLVRVPCGTMVFDTETG--------
OBG_GLOVI       ANLQTLLDFKYRHRFEADDGTKGGPKNLTGAKGKDLVIAVPCGTVVQDAVTG--------
OBG_PAUCH       SNLQTLLDFKYKRIFYAEDGNRGGPNRCSGVSGSNLVIKVPCGTEVRHLGSG--------
OBG_PROMP       NNLQTLLDFKFNREIFAKDGFKGGPNKRSGASGENTILKVPCGTEIRDFNTG--------
OBG_DEHM1       SGLYSLLNFKHKRVHKAANGENGMGSRCTGHNGADLVIKVPVGTVATIVEENGQK-----
OBG_SALRD       ENLYTLMDLSHNTQVFAEDGEPGGRREQTGASGEDKVIRVPPGTVVKTQTGE--------
OBG_PROA2       SQLATLLDFRYKKNYEALRGVHGQGSKKAGKTGKDIVINVPCGTLVKNSVSG--------
OBG_CHLT3       ANLATLLDFRYQRHYKAERGEHGQGSRKTGRSAKDVIIKVPVGTIVKDSETG--------
OBG_COPPD       PALLTLYDFKYQKEFRAEDGEPGRSQKQFGKDGKDLFIRIPVGVIVADLETQ--------
OBG_DESPS       SKVQSLIDFRYRSHFKAERGVHGQGRDMHGRGGKDCYMDIPVGSVVKDSETG--------
OBG_PHYAS       QGETTLLKLKYQKHLKASHGFNGKNKSQNGANAPHLYVKVPLGTVFFTM-DNH-------
OBG_PHYMT       QSENNLLKLKYQKHLKAKNGENGKNKNKHGANAENIYIKVPLGTIIYNL-QNE-------
OBG_ACHLI       EGKNTLIDLKYNRHIKAANGVHGGPKGMHGAHAEDTYVRVPLGTIVYDD-KEN-------
OBG_MYCAP       KGKNTLLSLYGNKQISAEDGINGGPKNLYGATGKSTYVKVPIGTMVFK--NDK-------
OBG_MYCS5       LGKNTLLSFYKNKFIIAEDGVKGGPKNLYGAKGKDTIVKVPLGTLVYK--NKK-------
OBG_MYCMO       YGINTLLDLQFRKIIRAEDGENGKRKNQYGKGAEDTIIEVPFGTLVYE--NDK-------
OBG_MYCPU       LGKNTLLHLYLQKSIVGNNGVNGGRKNLYGAAGEDKFIKVPVGTVVYE--GQK-------
OBG_MYCA5       SGLNTLLAFHYQNKISAKDGESGKPKNAYGAAGADEIVKVPLGTLVYY--EDN-------
OBG_MYCH2       SGMNTLLPFYQTKKIFGYNGENGRPKRQTGANGKDIFIKVPLGTQVFL--KKS-------
OBG_MESFL       GGKHSLLDLKLQKQLSAQDGFKGDIKNMHGAQGKDLIVRVPVGTLIIENKTGT-------
OBG_MYCPN       HNCDSLFFLKNKKHLFAESGGNGKPDLAHGKNGEDLVIKVPVGTTVRDLDTNQ-------
OBG_MYCGA       HNQSTLLSLKYSKIIRASNGDNGKPDLSSGQNGMDKYVKVPIGTTVYDEQTNE-------
OBG_MYCPE       HNLNSLIDLRYKKKIEAEDGENGKTKLATGKNGNDIYIKVPVGTTITNSITNE-------
OBG_UREU1       HNETSLEFLKYKKIIRAKHGEKGDIKNQHGANAEDVFINVPLGTVVYDAITNE-------
OBG_ROSS1       PGLNTLLPFRERTRFVAERGGNGGRSRKHGRNGRDVFIRVPVGTVARTIIDGE-------
OBG_HERA2       PHLNTLLPFRFETHFEADKGLNAGRQRKRGRTGEDTFIRVPPGTIVSAEIEGE-------
OBG_THERP       PSLNTLLPFSYQRQFRAEDGQPGQGNNKNGRDGADLYIDVPPGTVVYDEATGA-------
OBG_BACSU       EGLRTLMDFRYKKHFKAIRGEHGMSKNQHGRNADDMVIKVPPGTVVTDDDTKQ-------
OBG_STACT       EGLRTLLDFRYQRQFKAKRGEGGQGSNMHGKNAEDLVLKVPPGTLIKDAETEE-------
OBG_EXIS2       EGLRTLMDFRYKRHFKAVQGENGMSKGMHGRKAEHLVVKVPPGTVVYDDDTDA-------
OBG_ENTFA       EGLRTLMDFRFNRHFKATPGENGMSKGMHGRGSEDLLVKVPPGTTVRDAETGA-------
OBG_LACLA       EGMSTLMDFRYNRIFRGKPGEKGMNKGMHGRGAEDLIVHVPQGTTVKDNETGD-------
OBG_BREBN       EGLRTLVDFRYQRHFKAPRGEHGRNKSQHGAGAEDMVVRVPPGTTVIDDDTKE-------
OBG_LACJO       SGLRTLMDFRFRRKFKADNGENGRIKSQYGRGAKDVRLKVPMGTSVYDFNTGE-------
OBG_LACSS       EGLRTLMDFRYRHHFKANSGGNGQNKQMYGRGAEDTFVQVPPGTTVRDADTNE-------
OBG_LACF3       EGLRTLMDFRYHRIFKAKNGQNGMSKQMTGAAADDTVIAVPQGTTVRDLDTGQ-------
OBG_PEDPA       PGLRTLMDFRYRHKFKADSGKNGMNKQMTGRSSQDLVISVPGGTIVRDLTTGR-------
OBG_LEUMM       EGLRTLMDFRYNRHFKAQPGGNGGTKGMTGASADNRVVKVPQGTTVSDADTGE-------
OBG_OENOB       EGLRTLMDFRYNRHFRAKHGEKGGTKGMTGASADDLYVKVPAGTIISNADTNQ-------
OBG_HELMI       EGLRTLVDFRYQRHYKAERGEHGMGKNMHGRNGQDMTVRVPIGTVVKDAETGK-------
OBG_PELTS       GGLRTLVDFRYKRHYKAERGRHGEGKNMHGASGEDLVIRVPAGTVVKDAATGE-------
OBG_DESHY       EGLRTLVDFRYKRHYKADRGEHGQGKNMHGKSGEDMSVRIPVGTVVKDADTGE-------
OBG_DESAP       GGLRTLVDFRYRTHYKAGRGTHGQGKNMHGRKGEDLVLRVPVGTEVRRAGDAT-------
OBG_MOOTA       AGLRTLVDFRYRAHYRAERGQHGQGKNKHGRSAPDLILRVPVGVVVRDATSGQ-------
OBG_CARHZ       EGLNTLLDFRYKRHYKAPRGEHGKGSNRHGKAGENLYIRVPVGTVVKDEATGE-------
OBG_DESRM       EGLNTLQDFRYKKHFKAERGGHGMGKNMNGPAGEDLLVKVPTGTVVREAETGR-------
OBG_SYNWW       EGLKTLMDFKYRRHFKAERGAHGQGKNMHGAWGQDLRVKVPVGTVIKDDESGE-------
OBG_SYMTH       PGLNTLVDFKYQKHFKAERGEHGGPKGMHGRKGEDLVIKVPPGTVVKDDDTGE-------
OBG_HALOH       EGLNTLADFRYQRHYEAERGYHGSGKNKHGRSGEDLVLKVPPGTVVYDADTDE-------
OBG_NATTJ       PGLKSLMDYKYNIHIKGKRGEHGQGSNQHGKSGQDKVIKVPPGTVVKEATSGK-------
OBG_ALKOO       EGMRTLMDFRYQKHYSAENGEDGKNRNMYGKDGTDLVLKVPPGTIVREENTGE-------
OBG_CLOD6       LGLRTLMDFKYQKKYQAQNGGDGSKGKRAGKNGENLVLKVPAGTVIRDEATGL-------
OBG_RUMCH       EGLNTLIDFRYKKNFKAEPGQDGGTSNRSGKNGEDLIIKVPLGTVVKDELTDM-------
OBG_HUNT2       EGLRTLQDFRYKTRYRAEDGQNGGSSNCSGRSGEDLIIKVPPGTLVKDEQTGR-------
OBG_LACP7       EGLNTLGDFRLKRKYSAGDGENGQKKRCSGKDGEDLIIKVPEGTIIKETETGK-------
OBG_CLOPS       PGMTTLLDFKYKRKFVAGRGQDGQGSKCYGRDGENLTIKVPMGTIIRDVETNK-------
OBG_CLOTE       PDMTTLLDFSYKRKYKADAGEGGSRSRSYGKDAEDLYIKVPMGTVVKEASTGK-------
OBG_CALS8       RELNTLLDFKYKRHYKAQNGERGGPNNMHGKDGEDLIIKVPVGTVIKDAETGE-------
OBG_CALS4       PNLSTLLDFKYKRKYIAENGENGKSKNQYGKDGEDLYIKVPVGTTIINDETGE-------
OBG_FUSNN       SNINTLIDFKFKKLFKAQNGENGQKKQMYGKKGEDLIIKVPVGTQVRDFTTGK-------
OBG_FINM2       KDIKTLMDYSYRSIYKAESGGDGRNKKQFGKKGEDLILKVPVGTLVKDYDTDT-------
OBG_ELUMP       RNLTTLLELAYNPHIEAKNGEKGGTYNKTGVGADDLTIYVPCGTIVKKDGE---------
OBG_UNCTG       QHKTTLLDLSYRPKFKAEDGQKGSSGDKSGRYGEDLIIKIPLGTLIFKNGE---------
OBG_FRASN       SGVTTLLDFHFHPHQRAGGGRPGQGSNRHGADGDDLVLSVPDGTVVLSPDGE--------
OBG_SACEN       PGVHTLLDFHHRPHARASNGKQGRGSMRNGAIGEDLVLPVPEGTVVLTPDGE--------
OBG_STRGG       QSVTTLLDYHHSPHRKATNGQPGAGDNRSGKDGQDLVLPVPDGTVVLDKAGN--------
OBG_KINRD       PQVTTLLDLQRRPHRSAPDGRFGMGSHRNGADGDDLVIGVPDGTIVRSASGE--------
OBG_NOCSJ       PDVTTLLDYHHSPKRRAEHGGHGAGAHRNGAHGADLVLPVPDGTVVSDPQGH--------
OBG_SALTO       PQVHTLLDFHFRPHVKAANGRGGAGSNRDGANGANLVLKVPNGTVVQSGDGT--------
OBG_ACIC1       PGTTTLLDLHRRPHRRAAPGSPGQGNNKHGADGADLLIPVPDGTVVKDLDGQ--------
OBG_THEFY       RNTATLLEYQRRPHRKAENGAPGQGSNRSGASGADLVLPVPDGTVVTTLDGE--------
OBG_RENSM       HQTTTLLDYHHAPHRHASNGGQGMGDWRGGKQGETLILPVPDGTVVKTKDGE--------
OBG_KOCRD       GQSTTLLGFHHAPHQKAPNGEPGKGDMRHGFKGQDLVLSVPDGTVVKDREGN--------
OBG_LEIXX       PQVTTLLGYHRRPHRSSGNGGFGMGDHRSGHTGEDLELPVPVGTVVKSSEGA--------
OBG_BIFA0       QNATSLLDFRFMPHRTADSGTMGLGDTKDGSNGADLVLPVPVGTVVFEARGAQGFPKKPG
OBG_CUTAK       PQVTTLVDYHWQSTRKATNGESGRGDNQAGANGSDMILAVPEGTVVSDADTGE-------
OBG_CORDI       PQAHTLLDLHYRPHLKAQRGANGAGDHRNGARGQDLVLEVPAGTVVMSESGE--------
OBG_CORU7       PQVHTLLDFRFSPHVRAERGNNGAGDDRHGARGKDLTLHVPPGTVVIDEDGE--------
OBG_TROWT       TSERTLISFRRKGHYSASNGAHGLSRLRNGARGKDLEVSVPCGTSVYDEGGR--------
OBG_DEIRA       EGVESLERLVGRRKFKAENGRYGEGRLRQGADGQDTYIDVPVGTTAFDEDSGK-------
OBG_THET8       GSVDSLSRLS-KRTYKAEDGEHGRGSQQHGRGGEDLVIEVPRGTRVFDADTGE-------
OBG_RUBXD       EDLQTLERYSRRKVISAGRGGHGSGNNRAGERGRDVVLDVPVGTLVYD-ESG--------
OBG_AKKM8       PHTNDLRSFFYDPKLIATDGVGGQSAKKHGKNGKSVIGKVPPGTIIYRSNASSMAEATW-
OBG_METI4       PQLSDLSHFLFSPHQFAEDGQPGKGQKRKGRDGKNLKLEVPPGVVVYQLDPNRIFHSSRD
OBG_OPITP       DDTNNLVDYKYQPHWNAERGEHGLGKDQHGKDGAHRVLKMPLGTVVIDEATG--------
OBG_CHLPN       TSVYSFEAYRNIRFLKAPDGQSGATNNRTGRSGKDLIVSVPTGTLLRDAETG--------
OBG_PARUW       TQISSLDWFRHRRILKAQSGGDGGGNCRQGKNGTDLILKVPCGTLLKDAKSG--------
OBG_RHOBA       LGVNSLAQFATRKFFRAEKGGFGMGALRHGRKGREMRLFVPCGTSIIDAKDG--------
OBG_SULSY       SSLQTLMDFKYKRHYKAERGQHGQGGNKKGKDGEDLILKVPIGTVVKDAETGE-------
OBG_AQUAE       SSKHTLLDFKYKKHYIAQNGEPGKGKKMHGKDGEDLIIYVPVGTVVKDAQTGE-------
OBG_THEYD       SELHTLLDHRYQKVYKAQRGQHGKGSNMKGKDGENLIIKVPVGTVVKDAETEE-------
OBG_HYDS0       SSKTTFLDFKYKRHFVAQNGEHGKPKNQHGKNGKDIVIKVPVGTIVIDKKTND-------
OBG_THEM4       SNLSTLLTVAEKKKYIAENGENGKGKKMHGRNGKDIIIDVPLGTVVKDFETGE-------
OBG_FERNB       TTLSTLYHLTEKKKYFAENAQNGRSRKQNGKNGADLVLRVPVGTIVKDYDTGE-------
OBG_THENN       PSLSTLIEFVNKRKFFAENGKHGMGKKMKGRNGRDLYIDVPVGTVVKDASTGQ-------
OBG_PSELT       PGLSTLLNFKYQRRFIAQNGQHGKGKKQSGKSGEDLVIDVPVGTIVKDANTGE-------
OBG_PETMO       LNKNTLVDFKYKKIFRAENGENGKNKNKAGKAGEDVLIEVPVGTCIYDLETNE-------
OBG_DICTD       ENLDTLLDFHYKRHYYAERGEHGKGKNQKGKDGKDLVIKVPVGTLIFDVETGE-------
OBG_ACIC5       QRHNTLLYFRYNPEHKAERGEHGMGSNCTGRDGKDIILKVPVGTVVYNAESGE-------
OBG_PELCD       EGLGTLLDLRYQIHYKAQRGAHGMGKNCHGKNGEDLEIRVPPGVLVYDAETDE-------
OBG_SYNAS       SSHNTLLDLKYKQHHVAKHGGHGEGSNRTGRSAPDLTIPVPVGTLVMDSESGE-------
OBG_ANADF       PQLSTLLDYRYVREHRAKSGEHGQGSDMNGRDGEPLVLRVPPGTVVKDAATGE-------
OBG_MYXXD       PQLTTLLDYRYQQHHRARNGEHGMGSDCNGRAAEDMVLKVPVGTLVKDANTGE-------
OBG_SORC5       GGLSTLLDFTYARTLEADRGEHGMGSDCHGRAGADRVEKLPVGTQIFDAESGE-------
OBG_SOLUE       EHANTLLQFRFNPEHKAERGRHGEGSQRTGAEGRSIDVAVPVGTVVYDEATGE-------
OBG_SYNFM       EGKNTLLDFRYRHLFKAESGKHGQGRNRHGKGGRDLVLEVPAGTVIKDAETGE-------
OBG_PELPD       AGLSSLLELRHRPHQKAEKGHNGQGKNRHGASGADLVIKVPVGTVISDAESGE-------
OBG_DESAH       PAKRTLFDLRRQKIIRAKNGMPGLGSNKHGKNGVDLIIPVPPGTLVTDQETGA-------
OBG_DESOH       PSKRTLYAFRSKKQFAAPNGAPGEGRQKTGKSGDDLVIEVPPGTLIFDADTGA-------
OBG_DESAL       RAKHTLYHFRYKHRFQAQRGGYGSGANRHGKNGEDLLIEVPVGTIVRDAETSE-------
OBG_DESDA       NRLLSLYDFRLKRLYEAQNGRPGEGSQCDGRKGENLVLNLPVGTLVYAEGPEG-E-----
OBG_LAWIP       SRLLTLYDFRVQRHYRAQNGEGGKGSQRHGKKGEDLILHLPVGTIIFEQLLDK-E-----
OBG_BDEBA       RHINSLVDIRQNKRYAAQSGRMGEGRQKSGMDGEDLILIVPQGTVFRNMDGEI-------
OBG_BUCAP       NNLNTLIDLRFKKTFQAPHGENGSGKNCSGKKGSDIKIYVPVGTKIINYQTRE-------
OBG_BUCBP       TNLNTLIDFKFTKIFKAQDGQQGFNKKKTGKKGSDIVIQIPIGTKIIDHNTNE-------
OBG_BUCCC       TNINTLTDYRIKKIFQSENGKNGLNSNRSGKNGKDIYIPVPLGTRIIDNDTKK-------
OBG_WIGBR       KNTHDLYHCLVRKNFIAEDGENGKKNNSSGKNGKDVIIKVPIGTNIFFIKNSE-------
OBG_PHOPR       ENVNTLIDFRFERFHAAERGENGRGGNCTGHRGEDKILTVPVGTRAIDEETGE-------
OBG_PSYIN       ENLNTLVDFRFVRFYDAERGENGQTRDCTGSRGKDKIIQVPVGTRCRDADTGE-------
OBG_PSEHT       ENLNTLIDYQFERFHRADRGTNGRSRNCTGKKSDDLIIMVPVGTRIMDVDTQE-------
OBG_COLP3       EGLNTLIDYRFERFHRAKRGQNGQPQNCTGKGSEDLVLKVPVGTRAVDQDTGE-------
OBG_ECOLI       ENLNTLIDYRFEKSFRAERGQNGASRDCTGKRGKDVTIKVPVGTRVIDQGTGE-------
OBG_BAUCH       ENLNTLIDYHFQHNFHAENGKHGQGKNFTGKCGKDLTIKVPIGTRVVDQNTNE-------
OBG_BLOPB       PNINTLNYFHSNCVFRAGHGQSGRSRGCTGKRGKDVIVKVPWGTRVSYKKTNK-------
OBG_LEGPL       SDLNTLIDFRYTRQYKAENGQSGMGGNCTGKKGEDLTIKVPVGTMVYDADTGE-------
OBG_DICNV       DGLNTLSDFRYTRHFEAENGAAGEGRNKRGRSGEDLYIDVPLGTQVFVAETDE-------
OBG_ACIF5       ASLNTLIDFRYQRRYRAENGHGGAGRQMTGRAGHDLEIKVPVGTLVYDDDTHE-------
OBG_METPP       RNLNTLIDFRFARRHEARHGEHGRGSDQFGAAAEDIVMRMPVGTIISDAETGA-------
OBG_JANMA       RNINTLVDFRFAKMHKAKNGENGRGADCYGKGADDIKLRMPVGTLIIDNNDGE-------
OBG_METFK       RNINTLVDYRYTRVFRAQRGENGRGSDQYGASGEDMVLRVPVGTVVSDKATGQ-------
OBG_NITMU       RNINTLVDYRFARIHRAKNGENGQGSDRYGKSAHDIVLRMPVGTVITNEATGE-------
OBG_DECAR       RNINTLVDYRYTRKFIGKRGENGGGADQYGAGGDDIILRMPVGTVIYNLNTEE-------
OBG_CHRVO       ENVNTLVEYRFVKKYLAQHGERGRGADCYGKGGDDIELKMPVGTVIHDADTGE-------
OBG_BORPD       RNINTLIDFRYARLHRAKNGENGRGSDQYGAAAPDITLRVPVGTVVHDADTGE-------
OBG_ACIAD       DDTGTLVDYRYTRKFRAERGKNGAGANCTGRGGEDVVLKVPVGTTIVDVESGD-------
OBG_PSYWF       DNTNTLVDYRYTRRYDAGRGENGHSKNCSGKGADNIYLRVPIGTTIVNNETGE-------
OBG_ALCBS       TNINTLVDYRYDRIFKARNGEPGKGRQMTGKSAEDIILYVPVGTTVVDLDTDE-------
OBG_CHRSD       ESLNTLIDFKYQRFYKAPNGQPGQGRQMSGRNGEDLHVKVPVGTTVIDEDTLE-------
OBG_HAHCH       ESINTLIDYRYTRKFKAANGESGRGGNCTGASGADLVLKVPVGTTIIDTDIDE-------
OBG_SACD2       ENLNTLVDYRYQRSFRAQSGEGGRGRNCTGAKGEDLILPVPVGTSVIDMETEE-------
OBG_MARMS       EALNTLIDFRFTKKYIAESGEGGQGRDMTGSKGADLEIKVPVGTTVIDEDTGE-------
OBG_PSEU2       VNLNTLVDYRYTRHFDAERGSNGGSADCTGRKGEELVLRVPVGTTIIDATTQE-------
OBG_COXB1       KSVNTLVEFRYQRLLRAQNGQPGMGRLRSGKKGEDLIVPVPLGTTVYDKETSE-------
OBG_HYDCU       RNINTLIDFRYTRDYKAQNGQAGMGQQKTGRAGQDLIIPVPEGTIVRDLDTQE-------
OBG_NITOC       KNINTLVDFRHQHHFRARRGENGRGRLQTGKSSEDIYIPVPLGTEAWEAETGE-------
OBG_THISH       HDLNTLADFRFQRHYEAQRGENGSGRNMTGASGADLEVPVPVGTLAYDAETEE-------
OBG_METCA       DNLNTLADFRFHSHFRAQRGENGSGNNCTGKSGEDCFIHVPTGTIVTDADTGE-------
OBG_ALKEH       EGLNTLADFRHERKFTAQRGENGMGKQRYGKSGQDREIAVPVGTLVSDADTGE-------
OBG_HALHL       EGLNTLVDYRHDRFFSAESGEAGGGRQCTGRSGVDRILPVPVGTLVMDEGTGE-------
OBG_XYLFT       ENLNTLVDFRHERIFKAQRGVNGMGQQMYGKAGQDKIISVPIGTVVINVQTDE-------
OBG_FRAP2       ENVNTLIDYRYKREYYAENGRPGEGRNCYGKAGEDMYLIVPVGTSVFDLETNK-------
OBG_VESOH       DGLNTLSEFCFKRLFRAKNGQPGSGQNKRGKSAQHLTVEIPLGTKVYDLVTDE-------
OBG_CAUVN       EGLNTLIDYRYQQHFKAGTGVHGMGRARHGAAGEDVVLKVPVGTEVLEEDKE--------
OBG_HYPNA       EGLNTLIDFRYQQHFKAARGGHGMGKQRTGARGEDAVLKVPVGTQIYEEDQE--------
OBG_METSB       GGLNTLIDYRYQQHFKAKTGVHGMGKNRAGGRGADAVLKVPVGTQILDEDGE--------
OBG_OLICO       DGLNTLIDYRYQQHFKAQKGGHGMGSDRHGAGGDDIVLKVPVGTQVFDEDRE--------
OBG_RHOCS       DGLNTLIDYRYQQHFKAKRGGHGMGRSRSGAKGEDAVLRVPVGTQVLDDDQE--------
OBG_RHORT       PNLNTLIDFRYQQHFKAARGRDGSGDNRTGKSGEATIIKVPVGTQIFEDDRK--------
OBG_GLUOX       PGLNTLIDFRYTQHFKARKGGNGAGSNRTGAAAANVTINVPVGTQIFDEDRE--------
OBG_RHOS5       EGLNTLIDFRYQQHFFAKSGQPGMGSQRTGKSGEDIVLKVPVGTEIIDEDEE--------
OBG_SPHAL       AGLNTLIDFRYTQHFKAKRGTPGAGRDRTGAGGPDLVIQVPVGTQILADDEER-------
OBG_ZYMMO       PGLNTLIDFRYTQHFRAARGASGAGSNKTGAGAKDLVIHVPVGTQVLSEDKE--------
OBG_MAGMM       GHLNTLIDFRYKQHFKAKRGTHGMGSQCTGASAEALIIKVPVGTIIRDDADG--------
OBG1_ANAMM      SAVNTLLYFRYNQHIRAENGKAGSGKGKFGAAGRNRVVEVPVGTQLYDEDGN--------
OBG_ANAPZ       SAVNTLLFFRYHQHLRAENGKSGSGKKKSGASGRDLVIKVPIGTQVFDSPGG--------
OBG_EHRRW       HHVNTLIYFKYKQHIKAENGHPGLSKNKFGLSGRDITIEVPIGTQIYDEEG---------
OBG_WOLTR       ANLNTLLNFRYRRHVKAGSGKSGASRDRSGTAGKNIVLKVPVGTQIIDEESE--------
OBG_NEOSM       ENLNTLLDYRHRVHLKAENGKPGRKSNKRGESGSDLVCKVPIGTQILTQDR---------
OBG_PELUB       RNLNTLIDYRFQQHHKAGRGVNGSGQNRTGHSGEDLILKVPIGTQVFEEDNK--------
OBG_ORITI       RHLNTLINFKFKQHFLAQNGRAGAGNNRTGKSGQNLVLKVPVGTQILSNNKE--------
OBG_RICBR       HHLNTLVNYRYKQHFIADSGENGKGSNKSGKSGKSLTLDVPIGTQIFAEDSD--------
OBG_BACV8       RNYWTLLHLKYDRHVFATHGGNGSKNKSFGKDGEDKVIEVPCGTVVYNAETG--------
OBG_PORG3       RNYWTLLHLRYDRHIMATNGQSGGAKRSTGANGEDRIIEVPCGTAVYDADTG--------
OBG_CYTH3       VQLWTLLHLKYTKHIMAEDGERGGTNRASGAQGKDQIVEVPLGTIARDPETG--------
OBG_GRAFK       KNLWTLFHLKFKRHVKAEHGGNGSKQRSSGSQGSDEYIDVPLGTVIRDTETN--------
OBG_AZOPC       RNYWTLLHLKHKYHIFADHGKAGEGKLRHGKDGQNKTIELPIGTAVFDGTTG--------
OBG_AMOA5       KQLSTLLHLKYRKHIVAEDGKSGEGGCRTGADGTSIILEVPLGTVAKDIDSG--------
OBG_SULMW       NKLFTISHLKYKKHIIAENGKNGGRNRITGSNGKDSIIEVPIGTIVKDI-YN--------
OBG_CAMFF       NNTHTLANYKGKRAMKAANGVPGLPRNMTGKKGDNLELIVPPGTAVYDADSN--------
OBG_CAMHC       KNSHTLSKYKGKKLLKAENGAGGEGRKKFGKKGADLVLIVPPGTSIYDDKTG--------
OBG_ARCB4       NNTDTLSSYKGRKLFKAENGKQGMGGNMTGKSGDSLVLVVPPGTQVIDDETN--------
OBG_NITSB       KNTHTLSHFKGKKVLKAQNGRPGEGRRKHGKKGEDLILIVPPGTQVYDAQSG--------
OBG_NAUPA       KNTHTLSHYKGRKLLKAKNGRPGEGRKKHGANGEDLILKVPPGTVIKNAETG--------
OBG_SULNB       NNTDTLSGLRGRNHIKAENGRPGEGRKKYGRKGQDTTIIVPPGTTVVDMETG--------
OBG_WOLSU       ANTDTLSKFKGAKHYRAKNGQPGMGRRMSGKSGEEMVIVVPPGTQVFDYESN--------
OBG_SULDN       NNTHTLSHFQKKMHIKADNGAPGESSNMSGKSGVKKVIIVPPGTQIIDMDSE--------
OBG_CAMLR       NNTHTLAHFKGKKELKAQNGQPGLGRNKNGKRGESLELIVPQGTQVIDAQSG--------
OBG_HELHP       NNTDTLSKFRGARHYKAKNGQPGGSRRCSGKRGNDVVIKVPLGTQILDFDTK--------
OBG_HELAH       NNTDTLASFRGTKHHKAKNGAPGGTRNCTGKKGEDKIIIVPPGTQVFADG----------
OBG_BORBZ       ENLSTLSFYKNGHVLCAENGKPGMGFKRSGANGKDLTLFVPPNTEVYNENDG--------
OBG_BORT9       PDLKTLSFYKNGQKLAANNGKPGMGSRKSGASGEDLVIFVPPNTRVYDVFTD--------
OBG_TREPS       RNMRTLVHLRYGRVFRAKNGQDGEGARRFGAKGHDCVIPLPPGCLLRDAQTH--------
OBG_TREDE       RNMRTLVHLRHKRVYKAKNGGGGEGSQRFGKKGDDCIIPLPPGCVIKDPETG--------
OBG_LEPBP       GRMMTLENYLPDRMYAAQDGEPGLGQNRNGKNGEDLILKVPVGTQIIDSVTM--------
OBG_LEPIC       LSMYTLDKYLSKRKFKAQAGFPGVGDNCSGKKGEDLVLFVPLGTQIYDEETG--------
                     :          .  .  .      *  .      :* .                 

OBG_SYNY3       ------------CLLGDLVSPGQR-LCVAAGGKGGLGNQHFLSNRNRAPEYALPGLEGEQ
OBG_SYNP2       ------------EEIGDLVFHGQI-FCVAKGGKGGLGNKHFLSNKNRAPEYALPGLEGEI
OBG_TRIEI       ------------ELLGDLVKPGQT-CCVAQGGKGGLGNKHFLSNSNRAPEYALPGLDGEV
OBG_ACAM1       ------------TLLGDLTTNGQT-LTVAQGGKGGLGNKHFLSNRNRAPEHALPGLPGEE
OBG_SYNJA       ------------ELLGDLVQPGDR-LLVARGGKGGLGNAHFLSNHNRAPRQFTRGQPGER
OBG_GLOVI       ------------ETIGDLTEPGQR-LVVAVGGRGGHGNTHFASNQNRAPDYATEGRLGQQ
OBG_PAUCH       ------------ILLGDLTEPSQQ-LMIAFGGRGGLGNAHYLSNRNRVPEKFTLGREGEE
OBG_PROMP       ------------IILGDLTEDKQS-LTIAHGGRGGHGNAYYLSNQNRAPESFTEGKEGEI
OBG_DEHM1       ------------RVLADLAADGDR-TLVARGGQGGLGNTHFVSSTNQAPMLAQKGQPGGE
OBG_SALRD       -------------VLGEVVEPGQR-ICVAEGGQGGRGNAFFKSSTNQAPRESQPGEPGEE
OBG_PROA2       ------------EVICDLVEDGEE-FLLARGGDGGRGNPHFTTSTRQAPRYAEPGGKGEE
OBG_CHLT3       ------------EPLADLVYAGQE-VLIAKGGHGGKGNQHFATPTNRAPRYSEPAGVGEE
OBG_COPPD       ------------TVV-DMDKPGMK-LLVARGGRGGKGNARMATATRRAPRFRELGHEGEM
OBG_DESPS       ------------RVLADLSEEGEE-FVVAQGGSGGMGNPHFSSGSNRTPRVATKGKLGEE
OBG_PHYAS       -------------FLGEILHHQET-LVIAKGGKGGRGNKALANFKNPAPSYAEKGDLGEH
OBG_PHYMT       -------------ITGEILKHGEI-LTIAKGGRGGKGNKSLATFKNPVPKYAEKGGIGES
OBG_ACHLI       -------------LIGEVLEHGQT-LLIAQGGKGGRGNMAFASNNNKAPDFAEQGDLGQI
OBG_MYCAP       -------------LVADIIEEKE--YLVAQGGIGGRGNAKFKSNRNTAPRICENGTPGEK
OBG_MYCS5       -------------IVADVIKENHL-YLVAKGGKGGRGNNKFKTSKNTAPRIAENGMPGEK
OBG_MYCMO       -------------LIEDIVEERD--YLIVKGGQGGRGNLKFKTPRNGAPFMNENGSFGEK
OBG_MYCPU       -------------VIADIVEEKP--YLIAKGGRGGRGNTKFKTAKNKAPRISENGLPGES
OBG_MYCA5       -------------LIADVIEPKD--YLIAKGGRGGRGNLMFKSAKNTAPRICENGESGEK
OBG_MYCH2       -------------LICDIILEKK--YLIAKGGRGGLGNFHFRNSKNKAPRISENGELGQN
OBG_MESFL       -------------ILADMDEDKKQ-VLVAKGGKGGKGNARFANSRNKAPTIFEAGEIGQF
OBG_MYCPN       -------------ILMDFVHDQQS-FILCYGGKGGKGNAAFKSPIMRAPNLYENGDKGQS
OBG_MYCGA       -------------VIVDLIRDKQE-YIICHGGKGGRGNAAFKSSTLRAPNLYELGDEGEE
OBG_MYCPE       -------------VIVDILVTGQK-YLICKGGMGGKGNAYFKSSKNRIPNLCENGELGET
OBG_UREU1       -------------ILADINIDQQK-YLVAQGGLGGHGNTHFKSAFNKAPNLYELGELGEN
OBG_ROSS1       ------------TYTVDLDAPGLQ-LLAARGGRGGLGNVHFATSSYQVPRIAELGEPGER
OBG_HERA2       ------------VQTVDLLFPGQK-LLVARGGKGGLGNTHFATASNQVPRIAELGQPGEE
OBG_THERP       ------------VLG-DLLEPGEV-LLVARGGFGGRGNQHFATPSRQAPRFAEKGEPGEE
OBG_BACSU       -----------VIA--DLTEHGQR-AVIARGGRGGRGNSRFATPANPAPQLSENGEPGKE
OBG_STACT       -----------VLA--DLVEAGQR-AVVAKGGRGGRGNSRFATPRNPAPDFSENGEPGEE
OBG_EXIS2       -----------VIA--DLVHHGQQ-AIVAKGGRGGRGNSRFATPANPAPEHAENGEPGEE
OBG_ENTFA       ------------LIG-DLIENGQT-LVVAKGGRGGRGNIRFASPRNPAPEIAENGEPGQE
OBG_LACLA       -----------VLV--DLIEKDQE-FAVAKGGRGGRGNIRFATPRNPAPEVAENGEPGED
OBG_BREBN       -----------VIA--DLVEQGQR-AVIAKGGRGGRGNNRFANSSNPAPHISENGEPGQE
OBG_LACJO       -----------LLG--DLVENGQE-LVVAHGGKGGRGNIHFATPTRTAPEIAENGEPGEF
OBG_LACSS       -----------LLG--DLTEDGQE-LVIAKGGRGGRGNMHFATAKNSAPEIAENGEPGQE
OBG_LACF3       -----------IVG--DLVEQGQE-LVVAKGGRGGRGNIHFASPKNPAPEIAENGEPGED
OBG_PEDPA       -----------VIG--DLTDNGQE-LVVAKGGRGGRGNMRFASPRNPAPEISENGEPGEE
OBG_LEUMM       -----------VLA--DMLENGQE-LVVAKGGRGGRGNIHFATPANPAPELSENGEPGQI
OBG_OENOB       -----------QIV--DLTENGKK-FLIAHGGRGGRGNMRFATPSNPAPEISENGEPGET
OBG_HELMI       -----------ILV--DITCDGQQ-YIAARGGRGGRGNAKFVSSTNRVPLIAEKGEPGEE
OBG_PELTS       -----------LIA--DLVRDGQE-AVVARGGRGGRGNARFVTPQNRAPRMAEKGEPGEE
OBG_DESHY       -----------ILA--DLIEHGQK-VVVANGGRGGRGNARFMSNTNKAPTVAENGEPGEE
OBG_DESAP       -----------LMA--DLTVDGQE-YRVARGGRGGRGNARFAAANRRAPSFAEKGEPGEE
OBG_MOOTA       -----------VLA--DLVEDGQR-VVVAAGGRGGRGNARFVTSTDRAPTFAEKGEPGEE
OBG_CARHZ       -----------ILA--DITEHGQE-VVVARGGRGGRGNAHFASPTHQAPKFAELGEPGEE
OBG_DESRM       -----------LIA--DLLENGQQ-VVIAKGGRGGRGNVHFASSSNKAPRIAEKGEPGEE
OBG_SYNWW       -----------VLA--DLLLQGQE-AVVAKGGRGGRGNARFSSAINKAPSFSENGEPGEE
OBG_SYMTH       -----------VLF--DLVEPGQR-AVVARGGRGGRGNMRFATPTNKCPTFYEKGEPGEE
OBG_HALOH       -----------LLA--DLTEDGEE-YIVAHGGKGGRGNARFKKSTRKAPRFAEKGEPGEE
OBG_NATTJ       -----------VLA--DLVHEHDS-YIAAEGGRGGRGNTRFANPKNKAPRFSEDGKPGEE
OBG_ALKOO       -----------IIA--DLTGSEDQ-VVVARGGKGGKGNSHFKSSVRQAPRFAIAGERGQE
OBG_CLOD6       -----------VLA--DLKKEGDT-AIVAKGGIGGKGNQHFANAVRQAPAFAKSGTDGEE
OBG_RUMCH       -----------VLV--DLIKPGQT-CVIAKGGRGGKGNQHFATPTRQVPNFAKSGDLGEE
OBG_HUNT2       -----------ILA--DLVKPGKK-VVIAKGGKGGAGNQHFATPTRQVPSFAKPGEPGEE
OBG_LACP7       -----------VIT--DMSHENRR-EVILRGGRGGKGNQHYATPTMQVPKYAQPGQKAME
OBG_CLOPS       -----------VMA--DLSHRDDT-YTICRGGKGGKGNCKFCTPTRQAPTFAEPGMPGEE
OBG_CLOTE       -----------IMA--DLSHENDK-VVVVKGGRGGRGNARFATATRQAPNFAEPGMPGEE
OBG_CALS8       -----------IIA--DLSREGDR-AIVAHGGRGGRGNAHFATATRQVPRFAEVGEKGDE
OBG_CALS4       -----------VIA--DLIKPYQK-AIVLKGGKGGRGNAKFATPTLKTPRFAESGEKGRE
OBG_FUSNN       -----------LIL--DMSVNGEQ-RVLLKGGKGGYGNVHFKNSIRKAPKIAEKGGEGAE
OBG_FINM2       -----------VIY--DVKHDKEE-FVICKGGKGGKGNVHFKSSIRQAPRFAEPGEKGEE
OBG_ELUMP       -------------IIADLTEEGQS-VLVAKGGRGGRGNQSFKTHSNTAPRISEIGQPGEE
OBG_UNCTG       -------------FFADLKTVGER-ILIVKGGRGGRGNASFKTGRHTVPRIAEKGAPGET
OBG_FRASN       -------------QIVDLVGAGST-YVLAHGGRGGRGNASLASARRKAPGFAELGEPGEQ
OBG_SACEN       -------------VLADLVGVGTT-FVAAQGGRGGLGNAALSSKARRAPGFALLGEPGDE
OBG_STRGG       -------------VLADLVGQGTT-FVAGQGGRGGLGNAALASARRKAPGFALLGEPGES
OBG_KINRD       -------------LLADLVGPGTR-YVAAPGGRGGLGNAALASAKRKAPGFALLGEPGEV
OBG_NOCSJ       -------------LLADLVGPGTE-LVVAQGGRGGLGNAALASAKRKAPGFALLGEPGDE
OBG_SALTO       -------------VLADLVGVGTT-FEVARGGRGGRGNASLANARRKAPGFAELGEPGDQ
OBG_ACIC1       -------------VLADLVGAGTR-YVAARGGRGGLGNAALASARRKAPGFALRGEPGEE
OBG_THEFY       -------------VIADLVGHGTR-LVVARGGRGGLGNAALASPKRKAPGFALKGEPGEK
OBG_RENSM       -------------VLADLVGEGTE-YVAAAGGQGGLGNSSLSSQKRRAPGFALLGVDGEA
OBG_KOCRD       -------------VLADLLGEGSE-YVLAAGGQGGRGNAALASPKRKAPGFALLGTPGEE
OBG_LEIXX       -------------ELADLTEPGMR-IVAAPGGIGGLGNAALSNPKRKAPGFALLGTPGWE
OBG_BIFA0       ------------AVLADLRHAGDT-YVAAAGGAGGLGNAALANRTRRAPGFALLGEPGDE
OBG_CUTAK       -------------LLGDLVGVGAE-LVVAAGGRGGLGNAALANSARKAPGFALLGEAGEE
OBG_CORDI       -------------TLADLTSPGMT-FIAAKGGFGGLGNAALASAARKAPGFALKGEPGEQ
OBG_CORU7       -------------VLADLVSPGQK-VIVAQGGFGGLGNASLASKTRKAPGFALLGEPGEQ
OBG_TROWT       -------------QIADLVSPGSC-LQVVRGGTGGLGNAALAGYRRKTPRFALLGLPGQK
OBG_DEIRA       -------------VIADLVNVGQE-KVIAKGGLGGRGNSTFTSSTRQAPRFAELGTPGQK
OBG_THET8       -------------LLADLTEEGQT-VLVARGGAGGRGNMHFVSPTRQAPRFAEAGEEGEK
OBG_RUBXD       -------------LLADLAEPGQT-FVAARGGEGGRGNASFATSRRQAPAFRELGLPGEE
OBG_AKKM8       --LEREGEGIELEKIADLTEIGTR-FTLCQGGLGGKGNWHFRSATNQAPTEAEMGTEGEE
OBG_METI4       L-LPIPKPGEPLKKIGELIEPGMR-FILCKGGKGGRGNFQFRSPINQSPRYCEEGEEGQS
OBG_OPITP       ------------KPVAEVVEDGQQ-IVLCKGGNGGWGNTHFKTATTRAPKRANDGHPGER
OBG_CHLPN       ------------EILHDFTVDGER-LLVSQGGKGGKGNTFFKTSVNRAPTKATPGKPGEI
OBG_PARUW       ------------KVIHDFVEDKER-FVLCKGGRGGRGNDSFKTPTHQAPNICTEGTLGEI
OBG_RHOBA       ------------FVIKDLTQVGEE-FVICRGGKGGHGNARFKTPQNQAPRERELGQPGET
OBG_SULSY       ------------IIA-DLVKKGQS-VVVAKGGKGGRGNAAFKSPTNQAPMVAEKGELGEE
OBG_AQUAE       ------------VIC-DLVKEGQK-CIVAKGGKGGRGNARFATPTNQAPTYAEKGQKGEE
OBG_THEYD       ------------VLA-DLDEEEKY-FIVAKGGRGGFGNAHFATPTNQAPRYAQPGEKGQE
OBG_HYDS0       ------------VLC-DLVKHGQS-CVVAKGGDGGLGNAHFATPTNQTPRKFTHGKKGEE
OBG_THEM4       ------------IIA-DLDKNGMV-VCVARGGKGGRGNVHFKSSTMRTPKISERGAEGEE
OBG_FERNB       ------------IIA-DLDEPGKY-CCVARGGKGGRGNTHFKSSTNQAPKFAEQGAKGEE
OBG_THENN       ------------IIA-DLDEPGKV-VCVARGGRGGRGNAHFSTPTRQAPLIAEKGEKGEA
OBG_PSELT       ------------VLA-DLDRSWMM-VCVARGGKGGRGNIHFATSVFRAPRIAEKGDKGEE
OBG_PETMO       ------------LLS-DLKAPQQY-LVVARGGKGGRGNARFATSTLQVPRIAEKGVEGEV
OBG_DICTD       ------------LLA-DLVSHGQR-VVVAKGGKGGRGNAHFATSTRQTPYFAEKGEKGEE
OBG_ACIC5       ------------LLH-DFQQPDER-LIVAHGGRGGRGNQHFATSTHQAPREHEMGYPGEE
OBG_PELCD       ------------LLA-DLTEGCHE-LVVVRGGMGGRGNARFATSTNRAPRHVQPGVEGEE
OBG_SYNAS       ------------ILA-DLVTEGQE-YIVAHGGIGGRGNARFATATNQAPRYAQSGIPGEE
OBG_ANADF       ------------LIA-DLGAADER-LVVAKGGRGGLGNMNFATSTNQAPRYAEDGTLGEE
OBG_MYXXD       ------------LLV-DLSEAGQR-WVAAKGGRGGLGNMNFATSTRQTPRFAQDGTKGEE
OBG_SORC5       ------------LLA-DVTEHGQR-VIVARGGKGGRGNLHFKSPHDRAPRRAEPGEPGEA
OBG_SOLUE       ------------RLY-DFTVPGER-FVVARGGRGGRGNQHFATPTHQAPTEHEPGRPGEE
OBG_SYNFM       ------------PLV-DLSHPGDR-WVAARGGRGGRGNARFVSSTRQAPRIAEDGREGED
OBG_PELPD       ------------QLA-DLAENGQR-VVLLKGGRGGQGNARFASATHKTPRFAQPGEEGQE
OBG_DESAH       ------------VLF-DLTEPGTR-ITIAKGGRGGQGNKRFATSTHKAPRFAQPGMPGEE
OBG_DESOH       ------------IIR-DMVSPEED-FVFLTGGRGGKGNKHFATSTHQTPRFAQPGEPAQT
OBG_DESAL       ------------IIA-DLSVEEER-CIVCHGGRGGKGNKHFTSSTYRAPRFAQDGEEGEE
OBG_DESDA       ------------VLVADLSEPDAE-VLVASGGRGGKGNEHFKSSTMRAPRFSQPGEPGEE
OBG_LAWIP       ------------YFLVDLDRPGVE-FLIARGGRGGKGNEHFKSSTMRTPRFAQKGEMGEE
OBG_BDEBA       --------------IIDMTGISEH-TLLK-GGRGGKGNEFFKNSVNQAPEHAQPGEEGQE
OBG_BUCAP       -------------IIGDLIKHKQK-ILIAKGGWHGLGNTRFKSSINRTPRQRTLGSVGEK
OBG_BUCBP       -------------IIEDMIQDKQL-VLVAKGGWHGLGNTRFKSSTNRIPIKHTKGTQGEF
OBG_BUCCC       -------------IIIEILKINQK-FLVAKGGKRGLGNTNFKSSINQTPRKKTYGTLGEN
OBG_WIGBR       ------------NIIFGHTRFHNQKFLVAKGGVRGLGNNYFKSPTNRTPMESTLGKLGES
OBG_PHOPR       -------------VIADLTDHGVK-VMVSKGGFHGLGNTRFKSSVNRAPRQKSMGSKGEI
OBG_PSYIN       -------------VLGDLTRDGQQ-LMVAKGGFHGLGNARFKSSTNRAPRQKTDGTPGEV
OBG_PSEHT       -------------GLGDLTQHGQK-ILVAKGGFHGLGNARFKSSTNRAPRQKTLGTEGEV
OBG_COLP3       -------------QIGDLTYKGQK-MLVAKGGWHGLGNLRFKSSTNRSPRQRTDGTPGEI
OBG_ECOLI       -------------TMGDMTKHGQR-LLVAKGGWHGLGNTRFKSSVNRTPRQKTNGTPGDK
OBG_BAUCH       -------------ILGDLIVHQQY-LLVAKGGLRGLGNNHFKSSANCTPRKKTNGTKGEI
OBG_BLOPB       -------------LLGDMGIHHKR-LMVAKGGRHGLGNGHFKSSLHYCKVLNTNGSTGEF
OBG_LEGPL       -------------LLADISQPGVP-MLIAQGGFHGLGNTRYKSSVNRSPRQTTPGSPGES
OBG_DICNV       -------------LMGDLTAVGQT-LLVAKGGFHGIGNTRYKSSVNRAPRQCKAGGLGEE
OBG_ACIF5       -------------LLGDLRFEGER-LLIARSGRGGHGNLFYKSSTNRAPRQFEKGGAGEE
OBG_METPP       -------------PVAELLEPGER-ILIAKGGDGGFGNLHYKTSTNRAPRQKTPGWPGEQ
OBG_JANMA       -------------LIADLTEHGQE-VLIAKGGEGGWGNIHFKSSTNRAPRQKSEGKEGER
OBG_METFK       -------------VLTDLAEHGQK-VMVAKGGKGGLGNIHFKSSVNRAPRQCTKGDPGEE
OBG_NITMU       -------------RVADLVQHDQK-ILLAKGGTGGLGNLHFKSSTNRTPRQFTLGEPGEE
OBG_DECAR       -------------IIADLSEHDQK-VMIAKGGKGGLGNIHFKSSTNRAPRQKTNGEQGEE
OBG_CHRVO       -------------LVADLTHHGQR-VMIAKGGKGGLGNIHFKSSTNRAPRQCTPGEQGEQ
OBG_BORPD       -------------LLFDLNRHGEK-VTLAAGGQGGMGNLHFKSSTNRAPRQWTPGKEGEQ
OBG_ACIAD       -------------IIGDLVEDGQR-VMVATGGDGGLGNTHFKSSTNRSPRKFTTGVKGEF
OBG_PSYWF       -------------VIGDLTEIGQE-LLIAKGGDGGLGNTHFKSSTNQAPRKATSGFEGEL
OBG_ALCBS       -------------VLADLTDTDKP-VMVAQAGRGGLGNIHFKSSVNQAPRKTTKGKPGES
OBG_CHRSD       -------------VIADVTEAGQV-VLVAQAGRRGLGNIHFKSSTNRAPRKTTPGTEGER
OBG_HAHCH       -------------VLGDLVEVGQQ-IKVAQGGFHGLGNTRYKSSVNQAPRQTKPGQPGES
OBG_SACD2       -------------VIGDLTKAGDR-LLVAQGGFHGLGNARFKSSVNRAPRQTKPGSEGED
OBG_MARMS       -------------TLGDLVRDGQK-LKVAQGGHHGLGNTRFKSSTNRAPRQTTKGTVGEE
OBG_PSEU2       -------------IIGDLTKDGQR-LMVAQGGWHGLGNTRFKSSTNRAPRQTTPGKPGDQ
OBG_COXB1       -------------LIGDLIEAGDK-LCVARGGRHGLGNTHFKSSTNRAPRRTTSGEEGEA
OBG_HYDCU       -------------MIGDLVEHGQK-LLVAQGGRHGLGNVHFKSSTNRTPRQCTPGEPGDE
OBG_NITOC       -------------LLGDLTRPGQT-LLVAKGGAHGLGNARFKSSTNRAPRKTTQGKPGEE
OBG_THISH       -------------LIGDLVEHGQR-LLVAQGGFHGLGNTRYKTSTNRAPRQSKPGTPGEL
OBG_METCA       -------------HMGDLTRSGDR-LLVARGGFHGIGNARFKSSTNRAPRRATPGTPGER
OBG_ALKEH       -------------LIGELLEHGQR-LLVARGGKGGLGNVHFKSSTNRAPRQYTPGTKADR
OBG_HALHL       -------------VIGDVTRDGER-LLVAAGGRGGLGNLHFKSSTNRAPRQSTEGTAGES
OBG_XYLFT       -------------VIGDMVRHGDR-LLVAKGGTGGLGNMHFKSSINRAPRQARPGEQGEE
OBG_FRAP2       -------------KIGEVLNNGEI-LKLVSGGKRGIGNTHFKSSTNQAPRKFTLGEEGEY
OBG_VESOH       -------------LIGEMTKHEQT-ILVAKGGFHGLGNTRFKSSINRAPRETTPGFPGEV
OBG_CAUVN       ------------TLIADLDHAGMR-LLLAKGGNGGWGNLHFKGPVNQAPKYANPGQEGEE
OBG_HYPNA       ------------TMIADLTEVGQR-VLLAPGGNGGWGNLRFKSSINQAPRRSNPGEEGEE
OBG_METSB       ------------TMIADMTEAGQR-LVLARGGNGGFGNAHFKSATNQAPRRVNPGQEGVE
OBG_OLICO       ------------TLLHDFTRLGER-FVIAKGGNGGFGNAHFKSSTNRAPRHANPGQPGEE
OBG_RHOCS       ------------TVLADMTEVGQR-IVLLKGGDGGFGNEHYKSSTNRAPRQFTPGWPGEE
OBG_RHORT       ------------TLIADLSRPGQR-VRLAKGGDGGFGNAHYKSSTNQAPRRADPGWPGQE
OBG_GLUOX       ------------TLLADLDAEGKE-VLLCRGGDGGLGNTHFKSSTNRAPRRADKGWPGEE
OBG_RHOS5       ------------TVIADLTEVGQR-ILLAQGGNGGWGNLRFKSSTNRAPARANPGQPGID
OBG_SPHAL       ------------TLLADLTKAGER-VHFLRGGDGGRGNASYKTSTNRAPRQHGPGWPGEE
OBG_ZYMMO       ------------EILHDFTKVGER-IIFLKGGDGGRGNASYKSSTNRAPRQHGPGWPAQE
OBG_MAGMM       ------------TILVDMVEDGQQ-FLACKGGDGGRGNMHFKSSTNQAPRRADPGFPGEE
OBG1_ANAMM      ------------TLIADLNNIGQQ-YTVAAGGRGGIGNAQYKSSTNRAPTYFTYGTLGEE
OBG_ANAPZ       ------------SLIADLSTVGQR-YVVASGGKGGVGNAQYKSSTNRAPVYYTLGAVEEE
OBG_EHRRW       ------------TLITDLNSENQK-FIAAQGGKGGIGNSRYKTSTNRAPRYFTLGEQGEE
OBG_WOLTR       ------------KIILDFNKPDME-FLIAQGGKGGLGNTNFKSSINRAPRHFTCGQFGEE
OBG_NEOSM       ------------VLLSDLEQPKQS-FISAFGGKGGRGNATFKNSLNRAATEFTCGEPGEE
OBG_PELUB       ------------TLIYDFKKEGEE-FIVANGGKGGLGNTRFKSSTNRAPKKFTKGAPGEE
OBG_ORITI       ------------HVIFDLTKDGQE-FIIIRGGKGGLGNTYFKSSINQKPRKNTVGEIGDS
OBG_RICBR       ------------ILLHDFTEDDQT-FEIIKGGNGGLGNSHFKTSVNQAPRRRTEGEIAEE
OBG_BACV8       ------------EYICDITEHGQE-IILLKGGRGGLGNWHFRTATRQAPRFAQPGEPMQE
OBG_PORG3       ------------EFITDITEHGQQ-VMLLQGGRGGHGNTFFKTATNQAPRYAQPGEPAQE
OBG_CYTH3       ------------EKIAEITEDGQE-IILIPAGRGGLGNEQFKTSTNQAPHYAQPGEPGIE
OBG_GRAFK       ------------EIIKEITEDGQE-FIVAEGGMGGRGNWHFKSSTNQTPRYAQPGVDGQQ
OBG_AZOPC       ------------KFITDIKYDKQE-IVLLKGGRGGRGNNYFKSAVNQTPKHSQPGEPYEE
OBG_AMOA5       ------------NILVDITEDGQQ-TILLHGGRGGQGNVHFKTPTQQAPRHAQPGESGEE
OBG_SULMW       ------------NIIIEILNNNEE-KILLFGGKGGKGNCHFKNSLCKTPFYSEKGESGKE
OBG_CAMFF       ------------ELLLDLISEGQK-ELFLSGGKGGLGNVHFKTSVNQAPTKAQPGLPGET
OBG_CAMHC       ------------ELLFDLKEDGEK-VLALKGGKGGLGNVHFKSPVNQRPEYAQPGLSGEE
OBG_ARCB4       ------------EVLFDLLENGEK-ILFLEGGKGGLGNVHFKNSRNQRPTYFQPGLPGST
OBG_NITSB       ------------ELIFDLVEDGQK-VLFLQGGKGGKGNWHFKSASNQRPTYAQPGLPGKV
OBG_NAUPA       ------------EVLLDMKEDGER-KVLLEGGRGGLGNWHFRGPRNQTPRYAQPGEEGQE
OBG_SULNB       ------------EELLDLVEEGQV-VKFLEGGKGGLGNMHFKSSTNQRPTYAQPGLPGIT
OBG_WOLSU       ------------ELLLDLKEEGMR-VKFLEGGKGGLGNYHFKNSVNQRPTYAQPGIAGEE
OBG_SULDN       ------------EVLFDMLIDGQE-ELFISGGRGGLGNTHFKSSTNQRPTYAQPGEKGET
OBG_CAMLR       ------------EVLLDMLVEGQK-ELFLKGGKGGLGNTHFKNSTNQRPDYAQSGVAGKT
OBG_HELHP       ------------ELIVDMDTCPMR-VCLLKGGKGGLGNTHFKNAANQAPTYAQSGLSGEE
OBG_HELAH       ------------ALWLDLITPKER-VLALKGGKGGLGNAHFKSATKQQPTYAQKGLEGVE
OBG_BORBZ       ------------TLLYRLKNLNDE-FVVLKGGRGGLGNWNFKTSVRRVPRFAQPGESGNS
OBG_BORT9       ------------SMLFELQNFDDE-VIALKGGRGGLGNVNFKSSTKRTPRFAQPGESGTT
OBG_TREPS       ------------EVLHDFGHAHEGCVTLLSGGRGGWGNYHFRGPVQQAPQRAHSGQPGQE
OBG_TREDE       ------------KTILDFGDAEEGRFVFLKGGNGGWGNCHFKTSTNQAPKTALPGQEGET
OBG_LEPBP       ------------ELIYDFNHDGES-FTIATGGRGGKGNTFFKTSVQQAPRYSQPGEEGGA
OBG_LEPIC       ------------DLLFDFVSDSQE-FVVARGGRGGKGNAHFKTSTNQTPRFAQPGEEGEY
                                              .*  * **                .     

OBG_SYNY3       RQLRLELKLLAEVGIIGLPNAGKSTLIAALSAARPKIADYPFTTLVPNLGVVRKPTGDG-
OBG_SYNP2       KQLRLELKLLAEVGIIGLPNAGKSTLISALSAARPKIGAYPFTTLIPNLGVVKRPTGDG-
OBG_TRIEI       RMLRLELKLLAEVGIIGLPNAGKSTLIAALSAARPKIADYPFTTLVPNLGVVRKPTGDG-
OBG_ACAM1       FRLHLELKLLAEVGIIGLPNAGKSTLISVLSAARPKIADYPFTTLIPNLGVVPRATGDG-
OBG_SYNJA       RRLRLELKLIAEVGIVGMPNAGKSTLISVVSSARPKIADYPFTTLQPNLGVVPHPAGDG-
OBG_GLOVI       RKLLLELKLLAEVGIIGLPNAGKSTLISVLSAARPRIADYPFTTLVPNLGVVRKVTGDG-
OBG_PAUCH       WPLQLELKLLAEVGIIGLPNAGKSTLIGNLSAAKPKIADYPFTTLIPNLGAVYRPNGDS-
OBG_PROMP       WEVQLELKLLAEVGIIGLPNAGKSTLISVLSSARPKIANYPFTTLIPNLGVVRKADGNG-
OBG_DEHM1       YELILELKLIADVAIIGYPNVGKSSLLSLLTAAKPRVANYPFTTLSPVMGVVERTE-GT-
OBG_SALRD       RDLTFELKLMADVGLVGFPNAGKSTLVSSVSAAEPEVADYPFTTLTPQLGMVYVSEYET-
OBG_PROA2       LKVDLELKLMADVGLVGFPNAGKSTLISVLSAARPKIADYPFTTLVPNLGIVQYGEYKS-
OBG_CHLT3       RNIDLELKLLADIGLVGFPNAGKSTLISTISAARPKIANYPFTTLEPNLGIVRYAEYQS-
OBG_COPPD       RRLRLELKLVAHVGLVGLPNAGKSSLISVISKAKPEIAPYPFTTRSPVLGIVKKAE-QS-
OBG_DESPS       KWLLIELKLMADVGLVGLPNAGKSTLLSKLSAANPKVADYPFTTLEPQLGMLHFPMRNS-
OBG_PHYAS       FKIKIQLKVLADVGLLGFPSVGKSSLISLISKAQPKIDSYPFTTLFPHLGVVLIDG----
OBG_PHYMT       FKIKTELKILADVGLIGYPSVGKSTLISIISDAKPKIADYPFTTLKPYLGMVYVDN----
OBG_ACHLI       FLAKVELQVLADVGLLGYPNVGKSTLITRISNAKAKIADYQFTTLSPQLGMVNVED----
OBG_MYCAP       YLAHIVLKVMSDVGIIGKPSAGKSTLLSAISNAKAKIAEYEFTTLVPQLGLVKYHD----
OBG_MYCS5       YEANIVLKILSDVGLVGLPSCGKSTLINALSNAKAKVAEYEFTTLVPQLGLVKYYD----
OBG_MYCMO       KRLRLQLQILADIGLVGLPSAGKSTLLSVLSNAKPKIGDYDFTTLSPQLGLVKSSD----
OBG_MYCPU       KKLTLVLKVLADVGFVGKPSAGKSTLLSVISNAKPTIADYDFTTLVPQLGLVKYFD----
OBG_MYCA5       FALRLVLKVLADVGLVGKPSAGKSSLLNALSNAKAKTADYDFTTLVPQLGMLKYYD----
OBG_MYCH2       FYLDLQLKVMADIGLVGKPNAGKSTLLSLISNSKPKIANYEFTTLVPQLGVVKIYE----
OBG_MESFL       YEVKAELKVLADVGFVGLPNAGKSTLLRAISNSKPEVADYAFTTLNPQLGVSRAKDG---
OBG_MYCPN       LHVSLEIKYLANVGIVGFPNTGKSTLISKLSNAKPKIANYRFTTLVPVLGVVKHND----
OBG_MYCGA       KTVRLELKYLANVGIVGYPNAGKSTLISKLSNAKPKIANYQFTTLVPILGIVENND----
OBG_MYCPE       IEAQFELKYIADVGLLGLPNAGKSTLVNSLSNTNLKTANYMFTTLSPSLGVVNFED----
OBG_UREU1       IEVVLELKTIADIGIIGLPNAGKSTLISSFTNAKPKTANYMFTTLNPVLGTIYRDQ----
OBG_ROSS1       REIELELKLLADVGLVGFPNAGKSTLLSVISAARPKIAPYPFTTLQPNLGVVEVGDY---
OBG_HERA2       RELQLELKVIADVGLVGFPNAGKSTLLSMVSAARPKIANYPFTTLSPNLGVAEFNDF---
OBG_THERP       RWLRLELKLLADVGLVGLPNAGKSTLLAAVSAARPKIADYPFTTLEPMLGVVSVPGREG-
OBG_BACSU       RYIVLELKVLADVGLVGFPSVGKSTLLSVVSSAKPKIADYHFTTLVPNLGMVETDDG---
OBG_STACT       IEVTLELKLLADVGLVGFPSVGKSTLLSVVSKAKPKIGAYHFTTIKPNLGVVSTPDG---
OBG_EXIS2       KYLKLELKMLADVGLVGFPSVGKSTMLSIVSAARPKIGAYHFTTITPNIGVVETEDS---
OBG_ENTFA       RKIELELKVLADVGLVGFPSVGKSTLLSVISSARPKIGAYHFTTLVPNLGMVTTSDG---
OBG_LACLA       KILLLELRVLADVGLVGFPSVGKSTLLSVVSNARPKIGAYHFTTITPNIGMVQVGYG---
OBG_BREBN       RYIVMELKLIADVGLVGYPSVGKSTLLSSVTAAKPKIAAYHFTTLTPNLGVVDLGE----
OBG_LACJO       RTLRLELKVLADVGLVGFPSVGKSTLLSVVTKAKPKIAAYEFTTLTPNLGMVVLPDG---
OBG_LACSS       RSIQLELKVLADVGLVGFPSVGKSTLLSVVTSAKPKIASYQFTTLVPNLGMVQLDDG---
OBG_LACF3       HYLELELKMLADVGLIGFPSVGKSTLLSVVTGAKPKIAAYEFTTLVPNLGMVMLPDG---
OBG_PEDPA       IELQLELKVLADVGLLGFPSVGKSTLLSVVTSAKPKIAEYHFTTLVPNLGMVQLDDG---
OBG_LEUMM       RNLKLELKVLADVGLVGFPSAGKSTLLSVVSNAKPKVAAYHFTTLSPNIGMVRLDDD---
OBG_OENOB       LKVKLELRVLADVGLVGFPSAGKSTFLSVVTAARPKIAAYHFTTIDPNLGMVQLPDG---
OBG_HELMI       HWLELELKLLADVGLVGFPNVGKSTLIASVSAARPKIANYHFTTLEPNLGVVRIAEG---
OBG_PELTS       RWLDLELKLLADVGLVGFPNAGKSTLISRVSAARPKIASYPFTTITPNLGVVRVDDG---
OBG_DESHY       RNLLLELKLLADVGLVGFPNVGKSTIISRISAAKPKIADYHFTTLVPNLGVVELEDG---
OBG_DESAP       LWLELELKLLADVGLVGFPNAGKSTIISKVSAARPKIADYPFTTLEPHLGVVRVGEG---
OBG_MOOTA       RWLVLELKLLADVGLIGLPNAGKSTLLARISAARPKIADYPFTTLTPNLGVVRLEDG---
OBG_CARHZ       RWLLLELKLLADVGLVGYPNAGKSTLISRVSAARPKIADYPFTTLTPNLGVVEVGEG---
OBG_DESRM       LWLELELKVIADVGLIGFPNAGKSTFISMVSAAKPKIADYPFTTLVPNLGVVSAGEE---
OBG_SYNWW       KWIRLELKLLADVGLVGFPNAGKSTLISRVSAARPKIADYPFTTLVPNLGVVMTKER---
OBG_SYMTH       RWLLLELKVVADVGLVGFPNAGKSTFLSAVSAARPKIANYPFTTLTPVLGVVDLGEG---
OBG_HALOH       RSIRLELKLVADVGLIGFPNVGKSTLISVVSEARPKIANYHFTTLKPNLGVVALSEY---
OBG_NATTJ       KWIVLELKVMAEVGLIGYPNVGKSTLLSQVTKASPKIDSYHFTTLNPNLGVVELEEG---
OBG_ALKOO       LTVVLELKLIADVGLVGFPNVGKSTLLSVVTSAKPKIANYHFTTLTPNLGVVRTKFG---
OBG_CLOD6       RWITLELKMIADVGLLGFPNVGKSTFLSVVTKAKPKIANYHFTTLTPNLGVVQTKFG---
OBG_RUMCH       YSLILEMKMIADVGLVGYPNVGKSTILSMVSAAKPKIANYHFTTLVPNLGVVQIEHG---
OBG_HUNT2       LWVILELKLLADVGLIGFPNVGKSTILSMVTAAQPKIANYHFTTINPNLGVVNIDAE---
OBG_LACP7       LNVTLELKVIADVGLVGFPNVGKSTLLSRVTNAKPKIANYHFTTLNPNLGVVDLDGA---
OBG_CLOPS       RWVALELKLLADVGLLGFPNVGKSTLLSVVTKAKPKIANYHFTTLKPNLGVVAVPGI---
OBG_CLOTE       REIILELKLLADVGLVGFPNVGKSTILSTVSNAKPKIANYHFTTLKPNLGVASIKGL---
OBG_CALS8       LWVILELKVLADVGLIGYPNVGKSTFLSVATNARPEIANYPFTTKYPNLGIVYISEG---
OBG_CALS4       MWVRLELKLLADVGLVGFPNAGKSTLLASCSRARPKIANYPFTTLTPNLGVVEHK-G---
OBG_FUSNN       IKVKLELKLLADVALVGYPSVGKSSFINKVSAANSKVGSYHFTTLEPKLGVVRLEEG---
OBG_FINM2       KTIKLELKLLADVGLIGLPNVGKSTLLSIMSNARPKIANYHFTTLEPNLGVCKVG-E---
OBG_ELUMP       ITLYLELKVLADLGLVGFPNAGKSTFLSRVSAARPKIADYPFTTLNPNLGIAMHKKV---
OBG_UNCTG       AEVNLELRLIADVGLLGLPNAGKSTLLSQISAAKPKIADYPFTTLAPNLGVVNYKGK---
OBG_FRASN       LDAVLELKSVADVALVGFPSAGKSSLVSVLSAARPKIADYPFTTLVPNLGVVQAGDHRP-
OBG_SACEN       HDLVLELKSVADAGLVGFPSAGKSSLISVLSAAKPKIADYPFTTLVPNLGVVTAGDTV--
OBG_STRGG       RDIVLELKTVADVALVGYPSAGKSSLISVLSAAKPKIADYPFTTLVPNLGVVTAGSTV--
OBG_KINRD       LDLHLEVKTLADVALVGFPSAGKSSLVAALSAARPKIADYPFTTLVPNLGVVEAGSTR--
OBG_NOCSJ       LEIVLELKVVADIGLVGFPSAGKSSLIAAISRARPKIADYPFTTLVPNLGVVSAGDTT--
OBG_SALTO       IDVVLELKSVADVGLVGYPSAGKSSLISVISAAKPKIADYPFTTLVPNLGVVRVDNHT--
OBG_ACIC1       RDVVVEVKSVADIALVGYPNAGKSSLIAAISAARPKIADYPFTTLAPNLGVVEAGEIR--
OBG_THEFY       VDIRLELKTIADVGLVGFPSAGKSSLIAAMSAARPKIADYPFTTLVPNLGVVEAGQTQ--
OBG_RENSM       SDIVLELKSIADIALVGFPSAGKSSLIAAMSAARPKIADYPFTTLIPNLGVVEAGEVR--
OBG_KOCRD       QEVELELKSIADIALVGFPSAGKSSLIAAMSAARPKIADYPFTTLVPNLGVVQAGDTR--
OBG_LEIXX       GDILLELKTVADIALVGYPSAGKSSLIAALSAAKPKIADYPFTTLHPNLGVVQVGDVR--
OBG_BIFA0       RDIILELKSIADVALVGFPSAGKSSLIAAMSAAKPKIADYPFTTLVPNLGVVQAGDMR--
OBG_CUTAK       RKILLELKVVADIGLVGFPSAGKSSLIAAISRAKPKIADYPFTTLVPNLGVVVAGETT--
OBG_CORDI       HDVILELKSMADIGLVGFPSAGKSSLISVMSAAKPKIGDYPFTTLQPNLGVVDMGNDA--
OBG_CORU7       KDVTLELKSMADVGLVGFPSAGKSSLISVLSAAKPKIADYPFTTLAPNLGVVSVDHDT--
OBG_TROWT       RKLRLEVKSIADVALVGFPSVGKSSIISAISSAKPKIADYPFTTLHPNLGVVQSGPYR--
OBG_DEIRA       RRVRLELRLIADVGLVGYPNAGKSSLLAALSRANPAIADYPFTTLSPILGVVQREDEQGV
OBG_THET8       RRLRLELMLIADVGLVGYPNAGKSSLLAAMTRAHPKIAPYPFTTLSPNLGVVEVSEE---
OBG_RUBXD       REIRLELRVLSDVGLVGLPNAGKSSLLRALSAARPRVGDYPFTTLTPQLGVVEERGY---
OBG_AKKM8       GVFFMELRRIADAGLVGYPNAGKSTLLGDISEAKPKVASYPFTTLQPIIGVVEF----D-
OBG_METI4       GQFLLELKTIADVGFVGLPNSGKSTLLRQVTDAKPKTAPYPFTTLKPHVGIVNF----D-
OBG_OPITP       GTYRLVLKSIADVGLVGFPNAGKSSLTCLITRARPRTAAYPFTTLHPQIGIIDYPPDRH-
OBG_CHLPN       RQVELELKLIADIGLVGFPNAGKSTLFNTLAHTEVKVGAYPFTTLAPSLGLVLC---KDR
OBG_PARUW       HHIELELKLIADVGLVGFPNAGKSTLISSLAGLRVKVAAYPFTTLQPNLGFIEL---DNY
OBG_RHOBA       RHVIMELKSIADVGLIGKPNAGKSTLLSRISSARPEIADYPFTTKYPNLGIVDV----DI
OBG_SULSY       RWIELELKLLADVGIIGFPNAGKSTLISILSKARPKIADYPFTTLTPVLGVLQLDV----
OBG_AQUAE       RWIILELKLIADVGLVGFPNAGKSTLLSRLTRAKPKIADYPFTTLSPNLGVMELDW----
OBG_THEYD       RWVILELKLLADVGLIGLPNAGKSTLISVISSAKPKIADYPFTTLIPVLGVVKYEN----
OBG_HYDS0       KELILILKTIADIAIVGLPNVGKSTLLLVLTNAHPKIADYPFTTLYPELGVIKTD-----
OBG_THEM4       RKLILELKLLADVGLVGYPNVGKSSFISKISNAKPKIANYPFTTLIPNLGVVQVD-----
OBG_FERNB       KHIQLELKLLADVGLIGYPNVGKSSIISKISNARPKIANYPFTTLVPNLGVVSINGT---
OBG_THENN       RWLELELKILADVGLVGYPNVGKSSLIARISNARPKIANYPFTTLVPNLGVVKYG-----
OBG_PSELT       RWLELELKLLADAGLIGFPNVGKSSLISAMSNARPKIADYPFTTLVPNLGVVKID-----
OBG_PETMO       KNLKLILKIVADVGLIGYPNVGKSTLISRISNAKVEIADYPFTTIVPNLGVVKVD-----
OBG_DICTD       RWLYLELKLLADVGLLGLPNAGKSTLLSRISNATPEIAPYPFTTKTPNLGVVERE-----
OBG_ACIC5       FTLRLELKVLADIGIVGYPNVGKSTLISRISAAKPKIADYPFTTLEPNLGVVTVGEMPHE
OBG_PELCD       RWLRLELKLLADVGLLGMPNAGKSTLISAVSAARPKIADYPFTTLVPNLGVVRCGG----
OBG_SYNAS       RWIRLELKLLADVGIIGLPNVGKSTFISRVSAARPKIADYPFTTLTPHLGVVRYGDD---
OBG_ANADF       RDLVLELKLLADVGIVGYPNAGKSTLISRISRARPKIADYPFTTLVPNLGVVSWRER---
OBG_MYXXD       LTLRLELKLLADVGLLGFPNAGKSTFISRVSRARPKVADYPFTTLVPNLGMVQYKDGL--
OBG_SORC5       RELRLELKVLADVGLLGFPNAGKSTFVAAVSAARPKIGDYPFTTLTPILGMVEIGGGVRA
OBG_SOLUE       KRLRLELKLLADVGLVGFPNAGKSTLISRISAAKPKIAAYPFTTLEPNLGVV---QMEGF
OBG_SYNFM       RELVLELKLMADVGLVGLPNAGKSTLISVVSAARPRIADYPFTTLIPCLGVVR--HGEA-
OBG_PELPD       AKLRLELKLMADVGLLGLPNAGKSSLITKISAARPKIADYPFTTIKPSLGVVPYKN----
OBG_DESAH       FHLKLELKLLADVGIVGLPNAGKSTLISKISSARPRIADYPFTTLTPSLGMVIPDFG---
OBG_DESOH       ATVRLELKLLADVGLIGLPNAGKSTLLSVISAARPAIGAYPFTTLSPNLGMVTLAGA---
OBG_DESAL       KTLKLELKLLADVGLVGLPNAGKSSLITALTAARPKIGAYPFTTLAPSLGVLQDPYG---
OBG_DESDA       FNLRLELKILADAGLIGLPNAGKSTFISQVSAARPKIAAYPFTTLTPNLGVMIDEVDPD-
OBG_LAWIP       KYLRLELKILADAGIIGLPNAGKSTLISKLSAAQPKIAAYPFTTLNPNLGVMIDNLDPD-
OBG_BDEBA       IEVRLELKLIADVGIVGFPNAGKSTLISRISAARPKIADYPFTTLTPNLGVV--KAGDY-
OBG_BUCAP       RDIQLELILIADVGTLGMPNAGKSTLVKSISGAKTKIANYPFTTLNPVLGSVNTE-GKK-
OBG_BUCBP       RILRLELILIAHVGTLGLPNSGKSTLVRNISNAKTKIANYPFTTLKPVLGTVKIN-HKEF
OBG_BUCCC       KNILLELILIADIGTLGLPNSGKSTLITSMSNAKTKIDIYPFTTLIPILGTVKAK-KKK-
OBG_WIGBR       FKIKLDFVFLADVGLFGYSNTGRSCFMRSISNVKPKISFYPFTTLFPYIGSLNFLNKD--
OBG_PHOPR       RHLRLELLLLADVGMLGLPNAGKSTFIRSVSAAKPKVADYPFTTLIPSLGVVRVDAER--
OBG_PSYIN       RNLLLELLLLADVGMLGLPNAGKSTFIRSVSAAKPKVADYPFTTLVPNLGVVSMGYGR--
OBG_PSEHT       RNLKLELLLLADVGLLGLPNAGKSTFIRSVSAAKPKVADYPFTTLIPNLGVVRPEANK--
OBG_COLP3       RSLKLELLLLADVGLLGLPNAGKSTLIRSVSAATPKVADYPFTTLVPNLGVVRLDTQR--
OBG_ECOLI       RELLLELMLLADVGMLGMPNAGKSTFIRAVSAAKPKVADYPFTTLVPSLGVVRMDNEK--
OBG_BAUCH       RRLQLELILLADVGLLGLPNVGKSTLIRAVSAAKPKVANYPFTTLVPNLGVVQVHKKQ--
OBG_BLOPB       QHLLLELLLIANVGIFGLPNSGKSSFIRIISSAKPKVADYPFTTLVPYLGVVQINNYD--
OBG_LEGPL       RNLRLELRVLADVGLLGLPNAGKSTLIRAVSSSKAKVADYPFTTLHPGLGVVRVSPYK--
OBG_DICNV       RVIRLELKLLADVGLLGMPNAGKSTLIAQVSSAKPKIADYPFTTLHPNLGVVRVGALQ--
OBG_ACIF5       RDLRLELRLLADVGLLGLPNAGKSTLIRAVSAARPKVADYPFTTLYPNLGVVRVAAHE--
OBG_METPP       KKLKLELRVLADVGLLGMPNAGKSTLISAISNARPKIADYPFTTLHPNLGVVRVGPEQ--
OBG_JANMA       RELRLELKVLADIGLLGMPNAGKSTFISAVSNARPKIADYPFTTLHPNLGVVRVSHEK--
OBG_METFK       FELYLELKVLADVGLLGMPNAGKSTFIRSVSAAKPKVADYPFTTLHPNLGVVRVDANR--
OBG_NITMU       ADLKLELKVLADVGLLGMPNAGKSTLIRAISAARPKVADYPFTTMHPALGVVRVDQNR--
OBG_DECAR       LELRLELRVLADVGLLGLPNAGKSTLIRAISSARPKVADYPFTTLHPNLGVVRVDDEK--
OBG_CHRVO       RTLKLELKVLADVGLLGMPNAGKSTFIRSVSAARPKVADYPFTTLHPNLGVVRMDDTR--
OBG_BORPD       RRLRLELKVLADVGLLGLPNAGKSTLISRISNARPKVADYPFTTLHPNLGVVRTSASR--
OBG_ACIAD       REIRLELKVLADVGLLGMPNAGKSTFIRAVSAAKPKVADYPFTTMVPNLGVVDADRHR--
OBG_PSYWF       KELKFELKVVADVGLIGLPNAGKSTFIRQVSSAKPKVADYPFTTLVPNLGVVDVGVHR--
OBG_ALCBS       RRLRLELKVLADVGLLGMPNAGKSTLIRAISAAKPKVADYPFTTLIPNLGVVKADRYR--
OBG_CHRSD       RNLRFEMKVMADVGLLGVPNAGKSTLIRAVSAAKPKVANYPFTTLVPNLGVVKLGTHE--
OBG_HAHCH       RNIRLELKVLADVGLLGLPNAGKSTLIRGISSAKPKVADYPFTTLVPNLGVVRVQAHR--
OBG_SACD2       RQIKLELKVLADVGMLGLPNAGKSTFIRSVSSAEPKVADYPFTTLVPSLGVVKVQTHR--
OBG_MARMS       RTLKLEMKVLADVGLLGLPNAGKSTFIRAVSSAKPKVADYPFTTLVPNLGVVKVKKHQ--
OBG_PSEU2       RDLKLELKVLADVGLLGLPNAGKSTFIRSVSAAKPKVADYPFTTLVPNLGVVSVDRWK--
OBG_COXB1       RELKLELKLLADVGLLGLPNAGKSTFIHAVSKATPKIADYPFTTLYPHLGVVRVEEYR--
OBG_HYDCU       RNLGLELSVLADVGLLGMPNAGKSSLITAVSAARPKVANYPFTTLYPNLGVVRVSPES--
OBG_NITOC       RTLRLELKLLADVGLLGLPNAGKSTFIRQVSAATPKVADYPFTTLHPHLGVVRIDSNR--
OBG_THISH       RVLRLELKLLADVGLLGLPNAGKSTLITQVSGARPKIADYPFTTLYPGLGVVRVGPLQ--
OBG_METCA       RTLHLELKLIADVGLLGMPNAGKSSLIRAVSAARPKVADYPFTTLHPNLGVVRVGDQR--
OBG_ALKEH       RNLHLELRLLADVGLLGMPNAGKSTLVRAISSARPRVADYPFTTLYPNLGVVSVGAAR--
OBG_HALHL       RELRLELQLLADVGLLGMPNVGKSTLIRTISAARPKVADYPFTTLYPQLGVVRYEAQR--
OBG_XYLFT       RTLKLELKLLADIGMLGFPNVGKSTFIRAVSAATPKVADYPFTTLYPNLGVVKIEAYS--
OBG_FRAP2       KEVRLELNLLADIALLGLPNAGKSTLIRSVSEATPKVADYPFTTMYPHLGVVKVGVD---
OBG_VESOH       REIGLELSVMADIGLLGIPNAGKSSLIRQISSARPKIADYPFTTLHPSLSVVSFCDK---
OBG_CAUVN       RWIWLRLKLIADVGLVGLPNAGKSTFLAAASAAKPKIADYPFTTLTPNLGVVDLSS----
OBG_HYPNA       RWIWLRLKLIADAGLVGLPNAGKSTFLSVATAANPKIADYPFTTLHPGLGVVDLGT----
OBG_METSB       RTVLLRLKLIADAGLVGLPNAGKSTFLATVSAARPKIADYPFTTLNPQLGVVGCD-----
OBG_OLICO       RWIWLRMKLIADAGLVGLPNAGKSTFLSVVSAAKPKIADYPFTTLHPQLGVVRSD-----
OBG_RHOCS       RWVWLRLKLIADAGLVGLPNAGKSTFLAAVSRARPKIADYPFTTLTPNLGVVQAG-----
OBG_RHORT       IWVWLRLKLIADAGLIGLPNAGKSTLLAAVTRARPKIADYPFTTLHPNLGVVHQD-----
OBG_GLUOX       RWVWLRLKLIADIGLVGLPNAGKSTLLSVASRARPKIADYPFTTLHPQLGVVRLNN----
OBG_RHOS5       RTIWLRLKLIADAGLLGLPNAGKSTFLSATSNARPKIADYPFTTLVPNLGVVGVD-----
OBG_SPHAL       MWVWLRLKLLADAGLVGLPNAGKSTFINAVTNAQAKVGAYAFTTLRPQLGVVSHK-----
OBG_ZYMMO       AWVWLRLKLLADVGLVGLPNAGKSTFLKATTNAHPKIGNYPFTTLHPQLGVVRRH-----
OBG_MAGMM       MWVRLEMKLLADVGLVGMPNAGKSTLISKVSAAKPKIADYPFTTLQPNLGVVRVEM----
OBG1_ANAMM      HCVLLKLKIVSDVGIIGMPNAGKSSLLSRCTASKTKVSDYPFTTLEPHLGVAYAN-----
OBG_ANAPZ       FPIFMQLKVLSDIGIIGMPNAGKSSLLSRCTMSKTKVADYPFTTLEPHLGVARIN-----
OBG_EHRRW       KWIILKLKIISDVGIIGLPNAGKSSFLASCTNSKTKIANYPFTTLEPELGVAFIN-----
OBG_WOLTR       KYVVLKLKVLSDVGIIGMPNAGKSKFLTRCSNADTKVGDYPFTTIKPHLGVAKVD-----
OBG_NEOSM       KTVILNLKILADIGLIGLPNAGKSTFLSRCSNAKPKIADYPFSTLEPIVGIAKIN-----
OBG_PELUB       YVIWLQLKTIADVGIVGLPNAGKSSLLASITNAMPKIANYKFTTLNPNLGVASYD-----
OBG_ORITI       MWVWLHLKLLSDVGLVGLPNAGKSTFLSAITSAKPKIADYPFTTLTPNLGVVYIN-----
OBG_RICBR       MWVQLSLKLLSDVGLVGLPNAGKSTFLSVVSAAKPKIADYPFTTLVPNLGVVYID-----
OBG_BACV8       LMVILELKLLADVGLVGFPNAGKSTLLSTVSAARPKIANYPFTTLEPNLGIVS-YREGK-
OBG_PORG3       RMVIMQLKMLADVGLVGFPNAGKSTLLSVLTAAKPKIANYPFTTLEPNLGIVA-YRDKR-
OBG_CYTH3       AWVILELKVLADVGLVGFPNAGKSTLLSKVSAAKPEIADYAFTTLAPNLGVVK-YRDYR-
OBG_GRAFK       IDVTLELKVLADVGLVGFPNAGKSTLLSVITAAKPKIANYEFTTLKPNLGIVE-YRDFK-
OBG_AZOPC       RQIVFQLKLLADVGLVGFPNTGKSTLLSIVSAAKPKIADYAFTTLEPNLGVVN-VHNSY-
OBG_AMOA5       GWIKLELKLLAEVGLVGFPNAGKSTLLASISAAKPKIANYPFTTLVPQLGVVA-YREGH-
OBG_SULMW       FIFVLELKILADVGLIGLPNSGKSTLISMITSSKPKIDNYPFTTLNTNIGVLN-YKNFK-
OBG_CAMFF       RNIRLELKLIADVGLVGFPNVGKSTLISSISNAKPQIANYEFTTLTPKLGLVE-VDEFS-
OBG_CAMHC       KDIRLELKLIADVGLVGFPNVGKSTLISTISNAKPEIANYEFTTLTPKLGMVE-VDEFS-
OBG_ARCB4       KNIRLELKLIADVGLVGYPNVGKSTLISVTSNATPEIANYEFTTLTPKLGVVE-VGNYN-
OBG_NITSB       VQIRLELKLIADVGLVGFPNVGKSTLISTISNAKPEVANYEFTTLTPKLGVVR-VSEFE-
OBG_NAUPA       LEIVLELKLIADVGLVGFPNAGKSTLISTLSNARPEIANYEFTTLTPKLGVVR-VDEYR-
OBG_SULNB       KQVRLEMKLIADVGLVGYPNVGKSTLIATLSNARPQVANYEFTTLTPKLGVVH-ISDYD-
OBG_WOLSU       RHVRLELKLIADVGLVGFPNVGKSTLISTLSNARPEVANYEFTTLIPALGVVD-VDEFS-
OBG_SULDN       RRIKLDLKLIADVGLVGFPNVGKSTLISTVSNARPEIANYEFTTLTPKLGQVN-IGDFE-
OBG_CAMLR       LSVRLELKLIADVGLVGFPNVGKSTLISVVSNARPEIANYEFTTLTPKLGMVE-VDDYN-
OBG_HELHP       KHILLELKLIADVGLVGFPNVGKSTLISTLSNAKPEVANYEFTTLIPHLGVVD-ADEFS-
OBG_HELAH       KCVRLELKLIADIGLVGFPNAGKSTLISTISNAKPKIAHYEFTTLVPNLGVVS-VDEKS-
OBG_BORBZ       LSVRLELFLVADIGLVGLPNAGKSSLLNRITSAKSRVANYPFTTKIPHLGMLR-RSYD--
OBG_BORT9       LDLRLELVLIADIGLVGLPNAGKSSLISTITASRSKVGNYPFTTKVPHLGVLK-SSYE--
OBG_TREPS       RVVHVELRIVADVGFVGLPNAGKSSLLNFFTHARSRVAPYPFTTRIPYLGVLR-TGDGR-
OBG_TREDE       REIIVELNIIADIGLVGFPNAGKSSLLDYFTNARPKIAPYPFTTKIPNLGVLR-VDEER-
OBG_LEPBP       FSLILELKLLADIGIVGLPNAGKSTLLAKITHAHPKIAGYAFTTLSPNLGVVHRHEDLF-
OBG_LEPIC       KFLRLSLKLLADVGIVGLPNAGKSTLISKITDAHPKIAGYAFTTLSPNLGVVKRRGDIF-
                      .  ::. . .* .. *:* :    :        * *:*  . :.          

OBG_SYNY3       --------TVFADIPGLIEGAAAGIGLGHEFLRHIERTRLLLHVLDV-------------
OBG_SYNP2       --------TVFADIPGLIEGAHQGVGLGHEFLRHIERTKVLVHLVDL-------------
OBG_TRIEI       --------TVFADIPGLIEGASAGLGLGHEFLRHIERTRLLLHLVDI-------------
OBG_ACAM1       --------TVFADIPGLIEGAHEGVGLGHDFLRHVERTRLLVHLVDA-------------
OBG_SYNJA       --------VVFADIPGLIEGAHRGVGLGHDFLRHVERTRVLIHLVDG-------------
OBG_GLOVI       --------VVFADIPGLIEGAHQGVGLGHEFLRHIERTRVLVQLIAL-------------
OBG_PAUCH       --------IIFADIPGLILGAANGAGLGYDFLRHIERTRLLVHLIDS-------------
OBG_PROMP       --------CLFADIPGLISGAAEGVGLGHDFLRHIQRTKILIHLIDS-------------
OBG_DEHM1       --------FVMAEVPGLIEDAHLGRGLGHDFLRHISRTRMVIHLLDG-------------
OBG_SALRD       --------FVMADIPGIIEDAHEGKGLGLQFLRHIERTSVLLFVIPI-------------
OBG_PROA2       --------FVMADIPGIIEGAAEGKGLGIQFLRHIERTKVLAVLVSG-------------
OBG_CHLT3       --------FVVADIPGIIEGASEGKGLGLKFLKHIERTKVLAILIPA-------------
OBG_COPPD       --------FVVSDVPGLIEGAHEGKGLGLTFLRHVERTKVLAIVIDAAAI----------
OBG_DESPS       --------CIIADIPGLVEGAHQGVGLGHKFLRHVERTKILVHVIDA-------------
OBG_PHYAS       ------FSFVIADLPGLIPNAHLGQGLGIQFLKHIERCRVLVHLISMQSL----------
OBG_PHYMT       ------ESFIVADLPGLIPNAHLGKGMGIKFLKHIERCRILIHMCDMSKS----------
OBG_ACHLI       ------DAFVVADLPGLIEFAHLGVGLGLQFLKHVERCRVLLHIVSMDSL----------
OBG_MYCAP       ------HSFTVADLPGLIKGASEGKGLGIQFLRHIERCRVVVQIIDFGSEE---------
OBG_MYCS5       ------YSYTIADLPGLIKGASLGKGLGIQFLRHIERCKVVIHIVDFGSLD---------
OBG_MYCMO       ------SSYTIADLPGLIKGASEGKGLGIQFLKHIERCRVIAHIIDFGSKD---------
OBG_MYCPU       ------NSFVVADLPGLIKGAHQGKGLGIRFLKHIERCKVIANVIDFGDEN---------
OBG_MYCA5       ------KSCTIADLPGLIAQASEGKGLGFQFLKHIERCKVIAHVIDFGSSL---------
OBG_MYCH2       ------NSFVTADLPGLIQGASSGKGMGIIFLKHIERCRAIVHVIDFGSDN---------
OBG_MESFL       ------STFVVADLPGLIEGASLGKGLGHQFLKHIERCRVICHVLDMSGNYG--------
OBG_MYCPN       ------QSLVFADIPGLIENASEGSGLGHYFLRHIERCEILIHLISLDPVD---------
OBG_MYCGA       ------KRLVFADIPGLIENASEGYGLGHDFLRHVERCEVLIHLISMNPLD---------
OBG_MYCPE       ------EHLVFADIPGIIEDASNGSGLGLDFLKHIERCHFLIHLISVANID---------
OBG_UREU1       ------NRIIFADIPGLIEGAHTGVGLGHDFLKHIERCFLLIHLISLDPND---------
OBG_ROSS1       -------SFVVADIPGLIEGAHRGVGLGFSFLRHIERTRLLIHIIDAAG-V---------
OBG_HERA2       -------TFVVADIPGLIEGASRGVGLGHDFLRHIERTRILVHVLDAAG-T---------
OBG_THERP       ------GTFVLADLPGLIAGASRGAGLGHEFLRHVERTRLLIHVLDGSGGL---------
OBG_BACSU       ------RSFVMADLPGLIEGAHQGVGLGHQFLRHIERTRVIVHVIDMSGLE---------
OBG_STACT       ------RSFVLADLPGLIEGASEGVGLGHQFLRHVERTKVIVHVIDMSGSE---------
OBG_EXIS2       ------RSFVMADLPGLIEGASEGVGLGHQFLRHVERTKVIVHVIDMSGME---------
OBG_ENTFA       ------RSFAAADLPGLIEGASQGVGLGTQFLRHIERTRVILHVIDMSGME---------
OBG_LACLA       ------DSFVMADMPGLIEGAHSGAGLGIQFLRHIERTRVLLHVLDMSELE---------
OBG_BREBN       ------RSFVMADLPGLIEGAHEGVGLGHQFLRHVERTRLIVHVIDMAAVD---------
OBG_LACJO       ------RDFSMADLPGLIEGASKGVGLGIQFLRHVERTKVILHLVSMDPNN---------
OBG_LACSS       ------RDFVLADLPGLIEGASDGVGLGIQFLRHVERTRVVLHLIEMDDQT---------
OBG_LACF3       ------RDFAMADMPGLINGASKGVGLGLQFLRHIERTRVLLHLVDLGNQD---------
OBG_PEDPA       ------RDFVIADIPGLIEGASQGVGLGFEFLRHVERTRVLLHLVDMSGMTE--------
OBG_LEUMM       ------RDFVMADLPGLIEGASQGIGLGFQFLRHVERTKVILHLVDMSGIE---------
OBG_OENOB       ------RDFTIADLPGLIKGASKGVGLGFEFLRHVERTRVLLHMIDMSEESG--------
OBG_HELMI       ------QSFVMADIPGLIEGAHTGAGLGHDFLRHTERTRYLIHVLDISGSE---------
OBG_PELTS       ------RSFVMADIPGLIEGAHKGAGLGHDFLRHVERTRLLVHVLDTAGSE---------
OBG_DESHY       ------ESFVVADIPGLIEGAHTGAGLGHEFLRHTERTRLIFHVLDIAGSE---------
OBG_DESAP       ------ESFVLADIPGLIEGAHRGAGLGHRFLRHVERTRVLIHVVDVSGRE---------
OBG_MOOTA       ------DSFVVADIPGLIAGAHQGAGLGLKFLRHIERTRVLVHVLDTS-QP---------
OBG_CARHZ       ------QSFVMADIPGLIEGAHAGVGLGHQFLRHVERTRVLLMVLDMSGFE---------
OBG_DESRM       ------GSFVLADIPGLVEGASQGVGLGHEFLRHTERTRLLIHVVDTAGTE---------
OBG_SYNWW       ------DTFVLADIPGLIEGAHQGLGLGHEFLRHIERTRVILFILDAAQTE---------
OBG_SYMTH       ------RSFVIADIPGLIEGAHQGVGLGHEFLRHVERTKVLIHVLDGAGTE---------
OBG_HALOH       ------KSFVMADIPGLIEGAHQGVGLGDEFLRHIERTRLLIHIIDISGIE---------
OBG_NATTJ       ------SRFVMADIPGLIEGAHQGRGLGDQFLRHIERTKMLIHVIDIASIE---------
OBG_ALKOO       ------DSFVLADIPGLIEGAHEGTGLGHEFLRHVERTKLLIHVLDVAGLE---------
OBG_CLOD6       ------DSFVLADIPGIIEGASEGIGLGHEFLRHVERTKVLIHIVDISGLE---------
OBG_RUMCH       ------KSFVIADIPGLIEGAHEGVGLGHQFLRHVERTKLLVHVVDVSGVE---------
OBG_HUNT2       ------NAFVMADIPGLIEGAHQGVGLGHEFLKHIERTKLLIHVVDISGSE---------
OBG_LACP7       ------DGFVIADIPGLIEGASEGIGLGHEFLKHIERTRVIIHLVDAASTE---------
OBG_CLOPS       ------EPFVMADVPGIIEGASEGVGLGLDFLRHIERTRLLIHVVDISGVE---------
OBG_CLOTE       ------EPFVIADIPGIIEGASEGVGLGLDFLRHIERTRVLIHVIDISGIE---------
OBG_CALS8       ------ESFVLADIPGLIEGASEGAGLGHQFLRHVERTKVLIHIVDVSGSE---------
OBG_CALS4       ------KSFVMADIPGLIEGAHRGEGLGHDFLRHIERTKMLIHVVDVSGSE---------
OBG_FUSNN       ------KSFVIADIPGLIEGAHEGVGLGDKFLKHIERCKMIYHIVDVAEIE---------
OBG_FINM2       ------KSFVLADIPGLIEGASEGLGLGHDFLKHIERTKILVHVLDISGSE---------
OBG_ELUMP       -------SFVIADIPGIIEGASEGKGLGHQFLKHIERTRVLLHLVDPMGFK---------
OBG_UNCTG       -------HFTAADIPGIIEGAYKGIGLGFEFLRHIRRTKVLIHVIDVNGFD---------
OBG_FRASN       --------FTVADVPGLIPGASQGRGLGLEFLRHIERCSLIVHVLDCATLE---------
OBG_SACEN       --------FTVADVPGLIPGASEGRGLGLDFLRHIERCAVLVHVVDCATQE---------
OBG_STRGG       --------YTIADVPGLIPGASQGKGLGLEFLRHVERCSVLVHVLDTATLE---------
OBG_KINRD       --------YTVADVPGLIPGASEGRGLGLDFLRHVERCVALVHVLDGANLE---------
OBG_NOCSJ       --------FTVADVPGLIEGASEGRGLGHDFLRHIERCAAIVHVVDTASIE---------
OBG_SALTO       --------FTVADVPGLIPGAATGKGLGLEFLRHIERCAVLLHVVDTAALE---------
OBG_ACIC1       --------FTVADVPGLVRGASQGRGLGLEFLRHIERCAAVVHVVDCAAAE---------
OBG_THEFY       --------YVVADVPGLIPGASEGKGLGLEFLRHVERCSTLLHVLDCATYE---------
OBG_RENSM       --------FTIADVPGLIEGASEGKGLGHHFLRHVERCTALVHVLDTATLE---------
OBG_KOCRD       --------FTVADVPGLIPGASEGKGLGLEFLRHVERCAALVHVIDCATLE---------
OBG_LEIXX       --------YTVADVPGLIEGASEGRGLGFEFLRHVERCSALLHVLDCATLE---------
OBG_BIFA0       --------YTIADVPGLIPGASQGKGLGLTFLRHIERTEIIAHVIDCVTID---------
OBG_CUTAK       --------YTVADVPGLIPGASVGKGLGFDFLRHIERCRAIVHVIDCATYE---------
OBG_CORDI       --------FTIADVPGLIPGASQGKGLGLDFLRHIERTAVLAHVVDAATLE---------
OBG_CORU7       --------FTIADVPGLIPGASEGRGLGLDFLRHIERTAVLAHVVDAAALE---------
OBG_TROWT       --------YTVADVPGLVEGASKGIGLGLNFLRHIERCSVVVHVIDCANTQ---------
OBG_DEIRA       SL---DERFTMADIPGIIEGASEGKGLGLEFLRHISRTRLLVYVLDVTR-----------
OBG_THET8       ------ERFTLADIPGIIEGASEGKGLGLEFLRHIARTRVLLYVLDAAD-----------
OBG_RUBXD       -----ARPFVVADIPGLISGASEGRGLGNRFLRHVARARLLVLVLDASE-----------
OBG_AKKM8       ----SFRRCVVADIPGIIEGAHNNRGLGHEFLRHITRCKVLVFVLDMAGSE---------
OBG_METI4       ----DGYRMSCADIPGLIEGAHQGKGLGFYFLRHIERSHLLVYVLDLADPF---------
OBG_OPITP       ----GRRRLRLADVPGLIEGASENRGLGHRFLRHIERCALLLVLIDMAGTD---------
OBG_CHLPN       L---YQKPWIIADIPGIIEGAHQNKGLGLDFLRHIERTLLLLFVIDVSKRE---------
OBG_PARUW       ------KRIYIADIPGIIEGASHNRGLGLEFLRHIERTKLLIFILDASGID---------
OBG_RHOBA       E-----RSFILADIPGLIEGASEGIGLGHEFLRHVERAGLLVHLIEPTPVD---------
OBG_SULSY       -----NDYIVLADIPGLIEGASEGLGLGHEFLRHIERTKFLIHLIDVSDFRE--------
OBG_AQUAE       -----ERRLVIADIPGLIEDAHKGAGLGHEFLRHIERTKFLAHVIDVSDFRE--------
OBG_THEYD       -----YQSFVVADIPGLIEGAHKGAGLGHQFLRHVERTSLLLHLVDVSDFSE--------
OBG_HYDS0       -----DKSFTIADIPGIIENAHKGAGLGLDFLKHIERSKYLVLAIDLSSEN---------
OBG_THEM4       -----DLQFVVADIPGLIKGASKGVGLGNVFLRHVERCSVIVHIVDISGFEG--------
OBG_FERNB       ----PETSFVVADIPGLIKGASEGKGLGNVFLKHVERCSVIVHVIDVSGSEG--------
OBG_THENN       -----DFSFVVADIPGLIEGASEGVGLGNVFLRHVERCFVIVHMLDVSGFER--------
OBG_PSELT       ----ENSEFVLADIPGLIERASEGAGLGNLFLRHIERCSVLVHVIDISGSEG--------
OBG_PETMO       ----TDYSFVVADIPGLIEGAHLGKGLGDQFLRHIERCSVLVHLIDISCFER--------
OBG_DICTD       -----DITFTVADIPGLIEGAHENKGMGDEFLRHIERTSVLVFVLDAADMVN--------
OBG_ACIC5       ------ETFVVADIPGLIEGAHEGAGLGDRFLRHVERTHLLVHLVDVSDAS---------
OBG_PELCD       -----FKTFVMADIPGLIEGASEGHGLGTRFLRHVERTDLFLHLVDLSDLQ---------
OBG_SYNAS       -----LNTFVLADIPGLIEGAHEGVGMGIQFLRHIERTALLLHIIDISRDE---------
OBG_ANADF       -------SFVVADIPGLIEGAHEGAGLGHQFLRHVERCRVLVHLVEGANPE---------
OBG_MYXXD       -------SFVMADIPGIIEGASEGVGLGHQFLRHVERCKVLIHLIDMGAEG---------
OBG_SORC5       ----GGSSFVIADIPGLVPGASEGVGLGIQFLRHVERTRALLHLVTLD-PG---------
OBG_SOLUE       ------RSFVVADIPGIIEGAHEGHGLGIQFLRHIERTRLLAHLVDVSEES---------
OBG_SYNFM       ------PPFVMADIPGLIEGAHDGAGLGIRFLRHIERTRILAHLVDISQLS---------
OBG_PELPD       -----ARSFVMADIPGIIEGAHEGAGLGHRFLKHLERSGILLHLVDISWMP---------
OBG_DESAH       ------EPFAVADIPGIIEGAHEGTGLGIQFLKHVERTGILIHLIDVSQIE---------
OBG_DESOH       ------EPFAVADIPGLIEGAHTGAGLGIRFLKHIERTRLLVHLIDASAID---------
OBG_DESAL       ------EPVVIADIPGLIEGAAQGAGLGHRFLRHIERNRLLIHLIDASQVT---------
OBG_DESDA       ------RRMVIADIPGLIEGAHEGQGLGLRFLKHVERTRFLVHILSIEDVG---------
OBG_LAWIP       ------KRLVLADIPGLIEGACKGQGLGHQFLKHIERTRFLIHVLSSEDID---------
OBG_BDEBA       ------SSFVVADIPGLVKGAHAGVGLGIQFLKHIERTRLFIHLVDASGMS---------
OBG_BUCAP       --------FIIADIPGIMQNASQGFGLGVRFLKHLERCKILLHIVDLCPTDH--------
OBG_BUCBP       --------FVIADIPGLIQGASHGIGLGYQFLKHLERCHLLLHIIDISQINF--------
OBG_BUCCC       --------FIIADIPGIIKNASLGIGLGIKFLKHLSRCKLLLHIIDIT-INK--------
OBG_WIGBR       --------IKFVDIPSFIEGKKKN-NLRNRFLKHLQNCRLLLHFINLDVKN---------
OBG_PHOPR       -------SFVIADIPGLIEGAADGAGLGIRFLKHLERCRVLLHMIDLLPAD---------
OBG_PSYIN       -------SFVIADIPGLIEGASDGAGLGARFLRHLERCRVLLHTIDLLPAD---------
OBG_PSEHT       -------SFVIADIPGLIEGASDGAGLGIQFLKHLERCRILLHIIDVMPVD---------
OBG_COLP3       -------SFVIADIPGIIEGAADGAGLGTQFLKHLERCRILLHVIDIMPVD---------
OBG_ECOLI       -------SFVVADIPGLIEGAAEGAGLGIRFLKHLERCRVLLHLIDIDPID---------
OBG_BAUCH       -------SFIIADIPGLIKGAADGAGLGIRFLKHLERCRILLHLIDLAPAD---------
OBG_BLOPB       -------RFIIADIPGIIKGASHGLGLGMRFLKHLEHCQILLHFIDIAPVD---------
OBG_LEGPL       -------SFVMADIPGLIEGAAQGAGLGHRFLKHLSRTCVLLHVIDIAPLDGS-------
OBG_DICNV       -------SFVMADIPGLIAGAADGMGLGHQFLRHLARNRILLHLLDCSPMSDSQ------
OBG_ACIF5       -------SFVLADIPGLIPGASEGAGLGTRFLKHLSRTRLLLHLVDMAPVDGS-------
OBG_METPP       -------SFVVADVPGLIEGAAEGAGLGHRFLRHLQRTRLLLHMIDMAPFD---------
OBG_JANMA       -------SFVIADIPGLIEGASDGAGLGIQFLRHLQRTRLLLHIVDLAPFD---------
OBG_METFK       -------SFVIADVPGLIEGAAEGAGLGHQFLRHLSRTRLLLHLVDLAPFDE--------
OBG_NITMU       -------SFVMADIPGLIEGAAEGAGLGHRFLKHLARTRLLLHVVDIAPLDE--------
OBG_DECAR       -------SFVMADVPGLIEGAADGAGLGIRFLKHLQRTRILLHLVDIAPIDP--------
OBG_CHRVO       -------SFVIADIPGLIEGAAEGAGLGHRFLKHLQRTGLLLHVVDIAPFDP--------
OBG_BORPD       -------SFVVADIPGLIEGASEGAGLGHLFLRHLARTRVLLHLVDISSPDPD-----TD
OBG_ACIAD       -------SFVMADIPGLIEGAAEGAGLGIRFLKHLARTRILLHIVDVQPI----------
OBG_PSYWF       -------SFVMADIPGLIEGASEGAGLGIRFLKHVARTRRLLHILDIKPI----------
OBG_ALCBS       -------SFVVADIPGLIEGAAEGAGLGIRFLKHLARTRLLLHVVDLAPM----------
OBG_CHRSD       -------HFVMADVPGLIEGASDGAGLGLRFLKHLTRTRLLLHVVDVAPF----------
OBG_HAHCH       -------SFVVADIPGLIEGAADGAGLGIRFLKHLVRTRLLLHVVDVSPL----------
OBG_SACD2       -------SFVVADIPGLIEGASDGAGLGIRFLKHLTRCRILIHLVDVNPI----------
OBG_MARMS       -------SFVIADIPGIIEGASEGAGLGIRFLKHLVRNRILLHIVDLAPW----------
OBG_PSEU2       -------SFVVADIPGLIEGASDGAGLGIRFLKHLARTRLLLHLVDMAPL----------
OBG_COXB1       -------SFVIADIPGLIEGASEGAGLGVQFLKHLERTQLLLHIVDIAPL----------
OBG_HYDCU       -------SFVIADIPGLIEGASEGAGLGVQFLKHLSRTGLLLHVVDIAPM----------
OBG_NITOC       -------SFVAADIPGLIEGAAQGAGLGVRFLKHLSRTRLLLHFVDVAPLEP--------
OBG_THISH       -------SFVMADIPGLIEGAAEGAGLGIQFLKHLSRTRLLLHLVDVAPADP--------
OBG_METCA       -------SFVMADIPGLIEGAAEGAGLGVQFLKHLTRTRLLLHVVDIDPYET--------
OBG_ALKEH       -------SFVVADIPGLIEGAAEGAGLGIQFLKHLGRTRLVLHVIDAVPLDP--------
OBG_HALHL       -------SFVVADIPGIIEGAAEGAGLGVRFLKHLSRTGLLLHLVDGVAEEER-------
OBG_XYLFT       -------SFVIADVPGLIEGAADGVGLGMQFLRHLQRTKLLLHMVDISATADAYGNEKVG
OBG_FRAP2       -------SFVMADIPGVIEGAAEGAGLGLRFLKHLTRARCVLHVVDICPFNE--------
OBG_VESOH       -------HIVMADIPGLIENASKGAGLGFKFLKHLSRAKVLLHVVDILPVD---------
OBG_CAUVN       -----SERFVLADIPGLIEGASEGAGLGTRFLGHVERSATLIHLIDATQD----------
OBG_HYPNA       -----STRFVLADIPGLIEGAAEGAGLGHRFLGHVERCKVLLHLIDCTQD----------
OBG_METSB       -----GREFVLADIPGLIEGAHEGIGLGDRFLGHVERCRVLLHLVGADTE----------
OBG_OLICO       -----GREFVLADIPGLIEGAHEGTGLGDRFLGHVERCRVLLHLVDATCE----------
OBG_RHOCS       -----EEEFVLADIPGLIEGAHEGRGIGTRFLGHVERTRVLLHLVDGTQE----------
OBG_RHORT       -----AREFIIADIPGLIEGAHEGAGLGTRFLGHVERCAVLLHMIDATQD----------
OBG_GLUOX       -----TEEFVIADIPGLIEGASEGAGLGDRFLGHVERCATLLHLIDGTES----------
OBG_RHOS5       -----GKEFVIADIPGLIEGASEGRGLGDQFLAHVERCSVLLHLVDGTSS----------
OBG_SPHAL       -----GHEFVIADIPGLIEGAAEGAGVGDRFLGHIERCRVLLHLVDANDA----------
OBG_ZYMMO       -----GQEFVLADIPGLIEGASEGIGIGDRFLGHIERCRILLHLIDASGE----------
OBG_MAGMM       -----DHSFVMADIPGLIKGAHEGHGLGMFFLKHIERCAVLLHLVEIDSLED--------
OBG1_ANAMM      -----GCELVLADIPGLIENASSGAGLGHKFLKHIERCVILLHLVDCSLP----------
OBG_ANAPZ       -----EYDLILADIPGLIENANEGAGLGHKFLKHIERCSLLLHLIDGSTE----------
OBG_EHRRW       -----NTELVLADIPGLISGAHLGYGIGDKFLKHIERCSILLHIIDCTLE----------
OBG_WOLTR       -----NSEVVIVDIPGIITDAHLGIGLGHKFLKHVERCKILLHLIDVTHD----------
OBG_NEOSM       -----NHEIVIADIPGIIEGAHKNLGLGVKFLKHIERCKALIYLIDGTEK----------
OBG_PELUB       -----DKEITLADIPGLVEGAHEGVGLGIQFLKHIERCKTLMHLIDITDE----------
OBG_ORITI       -----NNSFVVADIPGLIAGAHLGQGLGDKFLKHIERCRIIVHLLDITAE----------
OBG_RICBR       -----DEEFVIADIPGLIEGASQGHGLGDKFLKHIERCNVLIHLIDGSSE----------
OBG_BACV8       -------SFVMADIPGIIEGASEGKGLGLRFLRHIERNSLLLFMVPGD------------
OBG_PORG3       -------SFVMADIPGIIEGASSGKGLGLRFLRHIERNALLLFMIPAD------------
OBG_CYTH3       -------SFIMADIPGIIEGAAEGKGLGIRFLRHIERNSILLFLIAAD------------
OBG_GRAFK       -------TFVVADIPGIIEGAAEGKGLGHRFLRHIERNSTLLFLIPSD------------
OBG_AZOPC       -------TFVMADIPGIVEGANEGKGLGLRFLRHIERNSLLLFMIPSD------------
OBG_AMOA5       -------SFVLADMPGIIEGASMGKGLGTRFLKHIERNRVLVLMISADD-----------
OBG_SULMW       -------KIVIADIPGIIKGASKGKGLGFEFLKHIQRNKIIVFILSAE------------
OBG_CAMFF       -------GFIMADIPGIIEGASDGKGLGIQFLKHIERTKVLLYMIDLAN-----------
OBG_CAMHC       -------GFVMADIPGIIEGASEGRGLGIKFLKHIERTKILLFMIDMSN-----------
OBG_ARCB4       -------SFVMADIPGIIDGASDGKGLGLEFLKHIERTKTLLFVIDVAN-----------
OBG_NITSB       -------SFVMADIPGIIGGASEGKGLGLQFLKHIERTKSLLYMIDMSS-----------
OBG_NAUPA       -------SFVMADIPGIIEGAHEGKGLGIEFLKHIERTSTILYMIDLSS-----------
OBG_SULNB       -------SFMMADIPGIIEGASDGRGLGLEFLKHIERTKTLLLMIDAAN-----------
OBG_WOLSU       -------SFVMADIPGIIGGASEGKGLGLEFLRHIERTKTLLFVIDLSN-----------
OBG_SULDN       -------SFIMADIPGIIGGAHEGKGLGIEFLRHIERTQILLFMVDLAS-----------
OBG_CAMLR       -------SFVMADIPGIIEGASDGRGLGLEFLRHIERTSFLLFVLDPLR-----------
OBG_HELHP       -------SFVMADIPGIIEGASGGKGLGIAFLKHIERTGFLLFVLDIMR-----------
OBG_HELAH       -------GFLMADIPGIIEGASEGKGLGISFLKHIERTKVLAFVLDASRL----------
OBG_BORBZ       -------DLIIADIPGIIKGASFGVGLGTKFLKHIAKTKILALVIDISE-----------
OBG_BORT9       -------DLVIADVPGIIEGASRGMGLGFEFLRHISKTKILVFLIDVAS-----------
OBG_TREPS       -------DVILADVPGILERASQGVGLGLRFLKHLTRCAGLAFLIDLAD-----------
OBG_TREDE       -------DVIIADIPGILEGASEGIGLGIRFLKHIARSAGLAFLIDLSD-----------
OBG_LEPBP       -------RYTVADIPGIIEGASRGVGLGISFLKHIERVQGILFLFDGGN-----------
OBG_LEPIC       -------RFTIADIPGIIEGASMGIGLGLSFLRHIERVKGILYLFDASS-----------
                            ::*..:     . .:   ** *  .   .                   

OBG_SYNY3       TAGDPIANFRVIQQELDAYGRGITE------------KPQIIALNKID------------
OBG_SYNP2       NAEDPIKNYETIQGELEAYGRGLPE------------LPQIIALNKLD------------
OBG_TRIEI       TDVDPVENFETIQNELEVYGRSLED------------KRQVLALNKVD------------
OBG_ACAM1       TAEDPEQDYQTIQKELSAYGQGLQN------------RPQLLVLNKID------------
OBG_SYNJA       TAADPVRDYQIIQQELRAYGHGLSD------------KPQIVVLNKID------------
OBG_GLOVI       DSADPLADYRTVIDELGRYGRELLH------------KSRIVALNKAD------------
OBG_PAUCH       SAKDLVHDLIVVEGELIAYGHGLAD------------RPRIVVLSKIE------------
OBG_PROMP       IAENPIRDFEIIEKELKRYGSGLLN------------KERIVVLNKME------------
OBG_DEHM1       TSDNPIDDMIKVNSELYLYDASLSE------------RPQVVAVNKIDDELVQLRREELT
OBG_SALRD       TSQDLGEEYEALLHELESHEASLLD------------KPRVVALSKID------------
OBG_PROA2       DGEDPVGEYRLLLGEMERFDPALLQ------------KPRIIVVTKMD------------
OBG_CHLT3       DTEDVQAEYDTLIEELRKFDESLCL------------KPRIVVLSKMD------------
OBG_COPPD       DGYEPMQAYETIIGELRAYNPNLLE------------KPRVLVLNKID------------
OBG_DESPS       SADDPFSDYDIIGNELRSYKEELAD------------RAKILVLNKCD------------
OBG_PHYAS       ---DPYKDYVALNKELQQYNSTLVE------------KKQIIVANKMDLPDAEKKL----
OBG_PHYMT       ---NPLQDIENLNQELKIYNKNLLK------------KPQIIIANKMDIIGAKTKL----
OBG_ACHLI       ---DPLDDYNKINNELVLYDEKLKD------------RTQIVVANKMDVEGAQEKF----
OBG_MYCAP       --KNPIEDFEIINKELEEYSKKLAS------------KPKVVVANKSDLQGFKERV----
OBG_MYCS5       --KDPIQSYEAIQKELESYKLNLTQ------------KPQLVVANKSDLANFKNNI----
OBG_MYCMO       --KNPINAYEQILEELRLYDETLLE------------RTQLIIANKEDLEDFETNL----
OBG_MYCPU       --KNPLQDYQEIRNELKLYNLNLEE------------KDEVIVANKKDQECFEKKL----
OBG_MYCA5       --KDPILDYETIKKELKDYNLNLEA------------LPHVIIANKSDQEIFATNL----
OBG_MYCH2       --KNPIKDFIEIKSELEKFNKKLLD------------LNQIVIANKCDLPNFQFNL----
OBG_MESFL       -QEDVIKNYELIRSELVKYNYKLDE------------RPEIIVANKMDTDEAQLNMME--
OBG_MYCPN       -HDDPCQAYEQIMRELSKYSQLLVK------------KKMLVVANKTDVDLDGTRF----
OBG_MYCGA       -HDDVIDAYEKIMTELRKYSQLLVN------------KKMLVVANKMDVEGASENF----
OBG_MYCPE       -TENPFKDYLTIVEELKKYNKEILK------------RKIFIVLNKIDENDSKDNI----
OBG_UREU1       -NSDIISAYETIVNELKQYKQSLVN------------KPIVLVANKIDQIGALENL----
OBG_ROSS1       DGRDPVGDFHAINEELRLY-QPELA-----------QRPQIVALNKADL-PE--------
OBG_HERA2       EGRDPFEDFLTINAELKAY-SSELA-----------QRPQLVALNKTDI-PD--------
OBG_THERP       EGRDPLEDFHTINAELAAY-SASLA-----------GKPQIVAVNKMDL-PE--------
OBG_BACSU       -GRDPYDDYLTINQELSEYNLRLTE------------RPQIIVANKMDM-PE--------
OBG_STACT       -GRDPLEDYKTINKELESY-GQHLE-----------DRPQIVVANKMDL-LD--------
OBG_EXIS2       -GRDPIDDYNIINKELADY-NLRLT-----------ERPQVVVANKMDM-PD--------
OBG_ENTFA       -GRDPYEDYLAINKELASH-NLRLM-----------ERPQIIVANKMDM-PE--------
OBG_LACLA       -GRDPYEDYKTINDELESY-NLRLM-----------ERPQIIVANKMDM-PE--------
OBG_BREBN       -GRDPYEDYLQINRELTLY-NLKLE-----------DRPQIVVANKMEL-PE--------
OBG_LACJO       -GRDAYEDYETIRKELAGY-TKDLT-----------TKKEIIVATQMDI-PG--------
OBG_LACSS       -GRDPYEDYQQINHELESY-DPKIL-----------ERPQVIVATKMDL-PG--------
OBG_LACF3       -AELALEKFHDINKELASY-DPELL-----------KRPQIVVATKMDL-PE--------
OBG_PEDPA       --EDPFTNFRQINEELKKY-NPELL-----------ERRQIIVPTKMDL-PG--------
OBG_LEUMM       -GTDPYTQYRKILDELQQY-DETIL-----------NRPQIVVPTKMDM-PD--------
OBG_OENOB       LGIKPFEAYLQINQELKSY-DPRLL-----------DRPMIIVATKMDL-PS--------
OBG_HELMI       -GRDPLEDYDAINRELALY-KPELA-----------DKPMVIAANKMDL-PG--------
OBG_PELTS       -GRDPVQDFLVTNRELSLY-NPALG-----------RRPQVIAANKMDL-DG--------
OBG_DESHY       -ERDPLEDFQIIAEELRQY-SQELA-----------NRPILIVANKMDI-PG--------
OBG_DESAP       -GRDPVADFEAINRELAAY-DPRLA-----------ARPQLVAANKTDL-PG--------
OBG_MOOTA       -GEDVLAGWRTVNDELAHY-NPELA-----------RRPQVVAANKMDI-PG--------
OBG_CARHZ       -GRDPVDDFEVLLKELKLY-NEQLL-----------TKPLVIAANKMDT-AN--------
OBG_DESRM       -GRDPVEDIKIINRELELY-DPRLS-----------TRPQIIAANKMDIIPL--------
OBG_SYNWW       -GRDVVEDYRILYRELELH-NPDLL-----------KRPQLIVANKMDI-PD--------
OBG_SYMTH       -GRDPLSDFDVIHNELRAY-NPELA-----------ARPTLVAFNKMDL-PD--------
OBG_HALOH       -GRDPLEDFKTINRELEKF-NEKLS-----------SRPQIVALNKIDLPG---------
OBG_NATTJ       -GRDPVLDIETINEELKGY-NSRVM-----------DKPQVIAANKMDLGDQ--------
OBG_ALKOO       -GRDPLEDFEKINQELHLY-NEKLA-----------EKPQVVAANKTDIPG---------
OBG_CLOD6       -GRDPIEDFDKINDELKLY-NEKLS-----------KRPQVVVANKFDILE---------
OBG_RUMCH       -GRDAVEDFDTINSELQKY-NQVLS-----------TRPQIVAANKMDIPG---------
OBG_HUNT2       -GRDPVQDFEVINEELKKY-NPVLC-----------ERPQIIAANKMDVTG---------
OBG_LACP7       -GRDPVEDIEKINHELSSY-NEGLL-----------LKPQVIAANKTDVLYGEE------
OBG_CLOPS       -GRDAVEDFKRINEELKNY-SVKLW-----------DRPQIVVANKCDMLF---------
OBG_CLOTE       -GRDPYEDFLKINEELKNY-SVKLW-----------DRPQIVAANKSDLVA---------
OBG_CALS8       -GREPVEDFIKINEELKKY-SPELA-----------QKPQIVAANKMDLPD---------
OBG_CALS4       -GRDPVEDFEKINEELRLY-DERLV-----------TLPQIVAANKMDLPE---------
OBG_FUSNN       -GRDCIEDFEKINHELKKF-SEKLA-----------GKKQIVIANKMDLIW---------
OBG_FINM2       -GRNPIEDFELINSELSSY-NIKLN-----------DKKMLVVLNKTDLGA---------
OBG_ELUMP       -DIDAVESVKVIEKELKTFDRELAK------------KPRIIALNKADLPEA--------
OBG_UNCTG       -GRDPYENYKIINNELKKYSKHLAK------------KHVIIVLNKIDSAVS--------
OBG_FRASN       PGRDPLTDLDVIEAELAAYTT------------DLSDRPRLVVLNKVDVPD---------
OBG_SACEN       PGRDPLSDVDALEEELARYTPALKT---EHGAGDLESRPRLVVLNKMDVPE---------
OBG_STRGG       SDRDPVSDLDMIEEELRLYGG-------------LENRPRIVALNKVDIPD---------
OBG_KINRD       TDRDPVSDLEAIEKELAAYRVDDGA-------VPLQDRPRIIVINKADVPD---------
OBG_NOCSJ       PGRNPVDDLDVIENELTRYGG-------------LEDRPRLVALNKVDVPD---------
OBG_SALTO       TERDPVADIDAIEAELVAYGG-------------LVDRPRLVALNKVDVPD---------
OBG_ACIC1       PDRSPLADLAAIRAELAAYASLDLG---G---PPLHERPQLVVLNKIDIPE---------
OBG_THEFY       PGRDPISDLEAVERELAVYGERTG--------VDLSDRPRLVALNKIDVPE---------
OBG_RENSM       SDRDPLSDLAIIEAELEKYAVDMSYAGVDGEVIPLNERPKLVALNKIDTPD---------
OBG_KOCRD       PGRDPLTDLDALEEELAHYAQDIADE--DPSSIPLTQRPRLVVLNKVDVPE---------
OBG_LEIXX       PGRDPLSDLDVILAELAAYPVP-------EGQLPLLERPQLIALNKIDVPD---------
OBG_BIFA0       PDRDPLSDYYALEKELGEYADDLDL---PLGAIPIPERPRVIILNKIDVPD---------
OBG_CUTAK       PGRDPVSDLDVIEGELIAHGG-------------LEDRPRLVVLNKVDVPD---------
OBG_CORDI       PGRDPISDIEALEEELAAYQSALDE---DTSLGDLRERARIVILNKADIPD---------
OBG_CORU7       SERNPLDDIRALEHELDSYQSELSA---DAGLGDLRERPRVIILNKMDVPD---------
OBG_TROWT       --QDPISGFNLIEKELSEYKVAENA-------IPLNKRPKVIVLNKIDVLQ---------
OBG_DEIRA       ---NPVEELQQLQAELRAYDPSL------------LDNVALVALNKVELVE---------
OBG_THET8       ---EPLKTLETLRKEVGAYDPAL------------LRRPSLVALNKVDLLE---------
OBG_RUBXD       ---DPEGAERTLRAELGAAGLS--------------GRPSLVVLNKVDLLD---------
OBG_AKKM8       G-RDPIEDLQNLRTEIKLYSEDLAK------------QPWFVVANKMDLEG---------
OBG_METI4       --LDPVQVFYTLRNELEKYNKELLK------------KPFLIVGNKVDLVA---------
OBG_OPITP       G-RDPREDYKHLLRELELYDPALLK------------KPRLVAANKMDVEA---------
OBG_CHLPN       R-NSPEEDLETLIHELHSHQPDFEK------------KDMLVALNKIDDLL---------
OBG_PARUW       G-RTPSHDFRILREEIGAYNPELLE------------RPYLVVLNKID------------
OBG_RHOBA       G-SDPIQNYVAIREELQHYDESLAD------------RDELVVMTKCELDP---------
OBG_SULSY       --RDPIDAFNIINKELEKY-SPDLI-----------KKPQIVVANKIDALSD--------
OBG_AQUAE       --REPVQAFEAINRELELY-SPKLA-----------QKPQIVVANKIDALSD--------
OBG_THEYD       --SDPREDFEKIQKELELY-NPALT-----------KKPFAVVGTKIDIAYK--------
OBG_HYDS0       ----PVKDFEILITEIYLY-DKSLI-----------QKVKTIVGTKLDIAK---------
OBG_THEM4       --RDPVNDYFDIRRELEYF-SEDLA-----------KKEEIIVANKIDLLSK--------
OBG_FERNB       --RDPIQDYFDIRKELEFF-SKDLA-----------KKRELIVGNKSDLLTP--------
OBG_THENN       --EDPARDYFIIREEMKKY-SPFLL-----------EKPEIVVANKIDLLER--------
OBG_PSELT       --RDFIKDYDVIVQELCKY-NEQLS-----------RKPQIIVANKIDLLEK--------
OBG_PETMO       --DDPVEDYINIRKELESF-SHILL-----------KKKEIIVANKIDAVDK--------
OBG_DICTD       --P-PQRAYEILKKELYLY-SPKLL-----------EKPRIIAINKIDLPEA--------
OBG_ACIC5       GRPDPVADYKTIAAELANF-GGELE-----------DKPVIVVASKIDS-VN--------
OBG_PELCD       EG-DPMERFALINRELARH-NPELM-----------EKPQLVVLSKIDV-SE--------
OBG_SYNAS       TS-TGWHDFEVINSELASY-SPELI-----------LKPQIVAVNKTDL-PI--------
OBG_ANADF       EGRSPKADYEAINRELALY-SPTLA-----------EKPQILAVTKIDV-PE--------
OBG_MYXXD       EGRAPLHDFDVLNAELGKY-SPELA-----------SKPQVVAANKLDL-PD--------
OBG_SORC5       EGREPLADYRALRKELKKF-SPEIA-----------ERPEIVVLTKADL-TE--------
OBG_SOLUE       GR-DPVQDFEIIMQELARF-SDQLV-----------AKPMIVVATKMDV-AQ--------
OBG_SYNFM       -PEEPLRPYRLIESELASY-SARLG-----------EKKRVIVLNKVDL-VP--------
OBG_PELPD       ER-DPLAEYEAVTRELTMF-SPELA-----------AKEQVVVITKLDL-PQ--------
OBG_DESAH       -PDNPLDAFNLINTELSLY-SATLA-----------KKPQLVVLNKIDL-TG--------
OBG_DESOH       -PADPVAPFRIINAELAMF-SPALA-----------ERPQVVVLNKMDL-TG--------
OBG_DESAL       -AEDPLASYQAINKELSSY-DQALG-----------EKPQIVVLNKMDL-PE--------
OBG_DESDA       -DEDPWAGFSLVNEELRRFDAE------------LGERRQIEVVNKIDLVSP--------
OBG_LAWIP       -EDNPWLGFDIVNEELKEFDHT------------LMQRTQLLVVNKIDVLQP--------
OBG_BDEBA       -GRDPLEDYTDINNELKMYDENNQDKE---GFFPLSTRPQLVVLNKIDTLSE--------
OBG_BUCAP       --SNPVENIRIILNELKKYNTSLYN------------KPRWLILNKIDLIKSSE------
OBG_BUCBP       --KNTITNIHVILDELKTYNKILHN------------KPIWFVFNKIDLIDDID------
OBG_BUCCC       --KKINKIRYIILKELKNFNKKLFQ------------KTRWLIFNKIDLLKPKK------
OBG_WIGBR       -VKKTINKEKINIKILKSFRNLFLK-------------PIWLIINKTDININSN------
OBG_PHOPR       -GSDPVENAFTIINELDKYSDKLAN------------KPRWLIFNKVDLLSEED------
OBG_PSYIN       -GSDPAENALVIIAELKKHSPKLAS------------KPRWLVFNKTDLLLEDE------
OBG_PSEHT       -GSNPVDNAFAIVNELHQYSPKLAE------------KPRWLVFNKIDLLPADE------
OBG_COLP3       -GSDPLENAKVIISELEQHNEKLAG------------KPRWVVFNKLDLVLEEE------
OBG_ECOLI       -GTDPVENARIIISELEKYSQDLAT------------KPRWLVFNKIDLLDKVE------
OBG_BAUCH       -QSSPVENASIIINELKRYSEKLAT------------KPSWLVFNKLDLIDKRE------
OBG_BLOPB       -NSDPLENIITIQHELSNYNENLVR------------KPCWLIFNKIDLLEQQV------
OBG_LEGPL       ---DPVADAKAILNELTQYNPDLLN------------KPRWLVLNKIDMLPDA-------
OBG_DICNV       ---NPITDFEQVSAELIKYDADFAQ------------IPRWLVLNKMDTLPPE-------
OBG_ACIF5       ---DPAMNIRALEMELAAYSPTLAA------------RPRWLVVNKSDLLPGE-------
OBG_METPP       DT-DPVAQAKAIVAELKKYDPALYD------------KPRWLVLNKLDVVPA--------
OBG_JANMA       -NVDPVKEAKAIVKELKKYDEALFD------------KPRWLVLNKLDMVPE--------
OBG_METFK       -SVDPVREALAITEELRKYDEALYN------------KPRWLVLNKVDMLED--------
OBG_NITMU       -AIDPVYEAKAILEELRKYDEALYR------------KPRWLVLNKVDLLPE--------
OBG_DECAR       -DSDPVRDAKAIVGELIKHDPDLAN------------KPRWLVLNKLDLIPE--------
OBG_CHRVO       -DVDPVREARAIVEELKKFDEELHG------------KPRWLVLNKVDMLPE--------
OBG_BORPD       PIEQAVADARAIVEELRRYDPELAD------------KPRWLVLNKLDMVAD--------
OBG_ACIAD       DGSDPVHNAKAIVGELKKFSPTLAE------------LPVVLVLNKLDQIDE--------
OBG_PSYWF       DGSDPVENGRVILNELERFSPELAN------------LPQILILNKIDQVPDA-------
OBG_ALCBS       DGSSPANHIDAIADELDRFSPALAE------------QERWLVFNKIDLLAD--------
OBG_CHRSD       DESDPVDSARAIAHELEQFSATLAE------------RPRWLVLNKLDLLPE--------
OBG_HAHCH       DESDPVESAVKIVAELEKFSPALAA------------RDRWLVLNKTDLLAE--------
OBG_SACD2       DESSPVESARAIVDEINKFSPTLAQ------------RERWLVLNKCDTLSE--------
OBG_MARMS       DEITPAEAAVIAVNELHQFSPALAE------------RERWLVLNKTDMVPE--------
OBG_PSEU2       DESSAPDAAEVIVNELEKFSPSLAE------------RDRWLVLNKCDQILE--------
OBG_COXB1       DGSDPVQSIQAIISELEQFSQNLSQ------------KPRWLVFNKIDLLAP--------
OBG_HYDCU       DGVDPVESVHVIEKELEKYSDALAG------------KERWLVLNKTDLLLE--------
OBG_NITOC       -TLSPVDSVRAIHRELQQFSPELAA------------QEQWLVFNKTDLISS--------
OBG_THISH       -AEDPVAAVHTIEAELQQFSEDLAS------------RPRWLVLNKIDLIAP--------
OBG_METCA       -GINPVTAARKVIAELCKWGHGLEE------------KPRWLVLNKIDRLAP--------
OBG_ALKEH       -AQDPVDDARKIVAELGRYSESLAA------------RERWLVLNKLDLLPE--------
OBG_HALHL       -GGDPVADAQTLLAELEAFSPELAQ------------KPRWLVVNRLDALPE--------
OBG_XYLFT       VGLLPIEQVRKLEIELERHDPALLD------------KPRWLVLNKADLMPQ--------
OBG_FRAP2       --SDPVENYFAVEKELKKYSEELYD------------KPRFLVINKIDLLAD--------
OBG_VESOH       -GSDPVKNFLTIEKELKKYDQELAN------------KEKLLVINKIDLLPE--------
OBG_CAUVN       ---DVAGAYETIRGELEAYGDELAD------------KAEILALNKIDALDEET------
OBG_HYPNA       ---DPAGAYRTIRSELEAYDADFAD------------RPEIVALNKIDALTPEL------
OBG_METSB       ---HAGKAYKTVRRELEAYGGGLAD------------KPEIVALSKVDSVDPDT------
OBG_OLICO       ---HAGKAYKIVRNELAAYEHDLTD------------KVEIVALNKIDAVTPEQ------
OBG_RHOCS       ---DVQLAYRTIRRELRLYGGGLAE------------KPEIVALNKIDALTPEE------
OBG_RHORT       ---DVAGAWRTVRAELKGHGQGLDE------------KSEIVGLSKIDALPPED------
OBG_GLUOX       ---QIVKHWRLIRKELEAYDPELAA------------KPEIIVLNKCDSLTPTQ------
OBG_RHOS5       ---TIVKDYRTIIGELEAYGGDLAG------------KPRITAMNKIDAMDPRQ------
OBG_SPHAL       ---DVATSYRVVRDELEAYGADLID------------KPVIVALNKIDTLDDEL------
OBG_ZYMMO       ---DPIAAWHEVQNELALYGAGLAE------------KPQLLALNKIDSVDEET------
OBG_MAGMM       --DDPVSRFQTIEAELAGYSEQLAQ------------KPRILVLSKADLLGEED------
OBG1_ANAMM      ---DIVSAYELVRQELKLHSQELAG------------KQEVVILNKCDLLSEGE------
OBG_ANAPZ       ---DIVGAYKLVSRELAMYSKELSE------------KREVIVLNKCDMITEEE------
OBG_EHRRW       ---DIIDSYKCIRKELSLYSKALTE------------KTEFILLNKCDLLDKEE------
OBG_WOLTR       ---NVVSAYNCMRNELELYNSDLVK------------KEEIIVLNKCDLLRKVE------
OBG_NEOSM       ---DIYSVYTLLSNELSLYSKKLEI------------KEHFILITKSDLLGKDE------
OBG_PELUB       ---DLENTYKQVRNELGSYSKDLLE------------KKEIIVLNKTDLLEEEE------
OBG_ORITI       ---NLLQNYYTIRDELSSYSLSLKD------------KTEILCFTKTDTQSNEV------
OBG_RICBR       ---DVVADYNIVRTELESYSDYLKD------------KTQIICLNKIDVLTDEE------
OBG_BACV8       -TDDIRKEYEILLNELATFNPEMLD------------KQRVLAITKSDM-----------
OBG_PORG3       -TDNIAKEYEILSRELVAYNEELAQ------------KRKVLAITKCDL-----------
OBG_CYTH3       -SKDIRAEYEILLNELQKYNPELLH------------KDRILAISKSDM-----------
OBG_GRAFK       -ARDIKKQYDILLDELKRYNPELMD------------KDRLVAISKSDL-----------
OBG_AZOPC       -ANDIANEYKILLNELACYNSELLN------------KQRILAISKSDM-----------
OBG_AMOA5       -TANIVQTYTSLLKELKSYSEDLFK------------KPRILVISKLDL-----------
OBG_SULMW       -VIYYKKYYNIIINELNFFDKNILK------------KKRLLVISKSDL-----------
OBG_CAMFF       -YRSLKEQFETLKSEVLKFSPNLAK------------RDFAIALTRLDA--AVDADE---
OBG_CAMHC       -YRTLKEQFNALKEESTKFSKNLAN------------KLYAIALTKADT--VENTDK---
OBG_ARCB4       -YRTMIDQYQVLKEEVAKFSNELSK------------RNYAIALSKIDGYYGENLEE---
OBG_NITSB       -YRDPLTQYKTLQKELKNFSEELAK------------RSFAIALTKIDALQEDEAKE---
OBG_NAUPA       -YRDPVYQFKTLQKELKEYSEKLAS------------RDYAIALTKCDS----VEVE---
OBG_SULNB       -YREMKYQYETLLVELDRYSETLAG------------RKHAIAITKIDSLSQDEVNT---
OBG_WOLSU       -YREPLEQFEILQKELSQFSPELSL------------RPFGIALSKVDALSKEEANE---
OBG_SULDN       -YRDLKEQIETLKAEVGAFSDKLGS------------SKYAIALTRADAVAQDEIND---
OBG_CAMLR       -DMSLKEQFCILRKELEKFSSKLYT------------RNFGLMLSKSDS-----IN----
OBG_HELHP       -EQSLKEQWEILSLELEKFSPILSQ------------RAFGIVLSKSDM-----QH----
OBG_HELAH       -DLGIKEQYKRLRLELEKFSPALAN------------KPFGVLLNKCDV--AEDIDT---
OBG_BORBZ       --ANFLESYNILLNELKSYSHKLFN------------KKKIIIANKLDLDGS--------
OBG_BORT9       --NDFMSTYSILVNELSVYDVGLSS------------KKRIIVANKLDLEGA--------
OBG_TREPS       --ERALHTYDLLCKELYAFSPVFET------------KARVLVGTKLDLPNA--------
OBG_TREDE       --DNYLRAYDILCKELESYSKELAQ------------KKRIIIATKLDLPDT--------
OBG_LEPBP       --LQLEEELEMLRSELGNYNQTLLD------------KKFLLVINKMDIWDN--------
OBG_LEPIC       --LDIEEDLKMLRNELSTYNPELLN------------RPYLIVLNKIDIWN---------
                                                            .: :            

OBG_SYNY3       ------------------------------------------------------ALDGEM
OBG_SYNP2       ------------------------------------------------------AGDHEF
OBG_TRIEI       ------------------------------------------------------AVDVKG
OBG_ACAM1       ------------------------------------------------------AMDSEQ
OBG_SYNJA       ------------------------------------------------------ALEPQE
OBG_GLOVI       ------------------------------------------------------VCLPEE
OBG_PAUCH       ------------------------------------------------------LLSGEE
OBG_PROMP       ------------------------------------------------------LVDENY
OBG_DEHM1       ETFKEAGLEVFFISALTGEGVEVLLDKVAEKLAILKAADAPETETDQ----EIKVFRPAP
OBG_SALRD       ------------------------------------------------------ILAPDE
OBG_PROA2       ------------------------------------------------------VVD---
OBG_CHLT3       ------------------------------------------------------LVL---
OBG_COPPD       ------------------------------------------------------LLQPEH
OBG_DESPS       ------------------------------------------------------EFDFDK
OBG_PHYAS       -------------------------------------------------------KDLQK
OBG_PHYMT       -------------------------------------------------------IELQK
OBG_ACHLI       -------------------------------------------------------EAFKK
OBG_MYCAP       -------------------------------------------------------NIFKA
OBG_MYCS5       -------------------------------------------------------EKFKA
OBG_MYCMO       -------------------------------------------------------NLFRK
OBG_MYCPU       -------------------------------------------------------EEFSK
OBG_MYCA5       -------------------------------------------------------KKFKK
OBG_MYCH2       -------------------------------------------------------ANFKR
OBG_MESFL       -------------------------------------------------------EDIKK
OBG_MYCPN       -------------------------------------------------------QKLAQ
OBG_MYCGA       -------------------------------------------------------NKLRS
OBG_MYCPE       -------------------------------------------------------NLFLK
OBG_UREU1       -------------------------------------------------------QILKE
OBG_ROSS1       -----------------------------------------------------AQANLSR
OBG_HERA2       -----------------------------------------------------AEAFDEL
OBG_THERP       -----------------------------------------------------AQANWPR
OBG_BACSU       -----------------------------------------------------AAENLEA
OBG_STACT       -----------------------------------------------------AEDNLEL
OBG_EXIS2       -----------------------------------------------------AEANLEA
OBG_ENTFA       -----------------------------------------------------AEENLAK
OBG_LACLA       -----------------------------------------------------AAERLAE
OBG_BREBN       -----------------------------------------------------AEENLRI
OBG_LACJO       -----------------------------------------------------SEEKFAE
OBG_LACSS       -----------------------------------------------------SAELLAE
OBG_LACF3       -----------------------------------------------------AQEHLDE
OBG_PEDPA       -----------------------------------------------------SDEELKK
OBG_LEUMM       -----------------------------------------------------SEENLAK
OBG_OENOB       -----------------------------------------------------SKANLED
OBG_HELMI       -----------------------------------------------------AEENLAR
OBG_PELTS       -----------------------------------------------------AAENLAR
OBG_DESHY       -----------------------------------------------------AEENLQR
OBG_DESAP       -----------------------------------------------------ARDNARR
OBG_MOOTA       -----------------------------------------------------GEEKVAF
OBG_CARHZ       -----------------------------------------------------AQENLEK
OBG_DESRM       -----------------------------------------------------AEENLAR
OBG_SYNWW       -----------------------------------------------------ARDNARR
OBG_SYMTH       -----------------------------------------------------ARENLPR
OBG_HALOH       -----------------------------------------------------ARENVER
OBG_NATTJ       -----------------------------------------------------AEENLQR
OBG_ALKOO       -----------------------------------------------------AEDNLEK
OBG_CLOD6       -----------------------------------------------------DESKFEK
OBG_RUMCH       -----------------------------------------------------AEENYKA
OBG_HUNT2       -----------------------------------------------------AEENLEK
OBG_LACP7       -----------------------------------------------------EEEAINK
OBG_CLOPS       -----------------------------------------------------DEEIFEN
OBG_CLOTE       -----------------------------------------------------EDKRFEE
OBG_CALS8       -----------------------------------------------------AQAYFEL
OBG_CALS4       -----------------------------------------------------GKEKYPR
OBG_FUSNN       -----------------------------------------------------DMEKFEK
OBG_FINM2       ------------------------------------------------------EDNIKE
OBG_ELUMP       ------------------------------------------------------KEVYNK
OBG_UNCTG       ------------------------------------------------------LEQIKN
OBG_FRASN       ------------------------------------------------------AAELAE
OBG_SACEN       ------------------------------------------------------ARELAE
OBG_STRGG       ------------------------------------------------------GQDLAD
OBG_KINRD       ------------------------------------------------------ARDMAE
OBG_NOCSJ       ------------------------------------------------------GRDIAG
OBG_SALTO       ------------------------------------------------------GRDLAE
OBG_ACIC1       ------------------------------------------------------ARARAE
OBG_THEFY       ------------------------------------------------------ARELAE
OBG_RENSM       ------------------------------------------------------GKDMAE
OBG_KOCRD       ------------------------------------------------------ARELAD
OBG_LEIXX       ------------------------------------------------------ARELAD
OBG_BIFA0       ------------------------------------------------------AKELAD
OBG_CUTAK       ------------------------------------------------------AADLAD
OBG_CORDI       ------------------------------------------------------ALELAE
OBG_CORU7       ------------------------------------------------------AEDMAD
OBG_TROWT       ------------------------------------------------------TKEEQD
OBG_DEIRA       ------------------------------------------------------P-DLAQ
OBG_THET8       ------------------------------------------------------E-EAVK
OBG_RUBXD       ------------------------------------------------------A-ELRA
OBG_AKKM8       -----------------------------------------------------AEENLAN
OBG_METI4       -----------------------------------------------------AD-SLNH
OBG_OPITP       -----------------------------------------------------AAANLSK
OBG_CHLPN       -----------------------------------------------------PDEQEEC
OBG_PARUW       -----------------------------------------------------TEDSPSH
OBG_RHOBA       -----------------------------------------------------DGEVREQ
OBG_SULSY       ---------------------------------------------------KSLLDNLEK
OBG_AQUAE       ---------------------------------------------------RSLLSELEK
OBG_THEYD       ---------------------------------------------------GDRLGKLKK
OBG_HYDS0       ---------------------------------------------------KENLELLEK
OBG_THEM4       ---------------------------------------------------EELEERIQK
OBG_FERNB       ---------------------------------------------------EEINAVKDR
OBG_THENN       ---------------------------------------------------EKLPQRIKE
OBG_PSELT       ---------------------------------------------------DELEKRLET
OBG_PETMO       ---------------------------------------------------DTLEKRLTD
OBG_DICTD       --------------------------------------------------QERIPEIEEW
OBG_ACIC5       ------------------------------------------------------PDKLKK
OBG_PELCD       -----------------------------------------------------VRERLDA
OBG_SYNAS       -----------------------------------------------------TREKLKD
OBG_ANADF       -----------------------------------------------------ARAAGEK
OBG_MYXXD       -----------------------------------------------------AQARLEG
OBG_SORC5       -----------------------------------------------------VRDAYPK
OBG_SOLUE       -----------------------------------------------------DPARVEA
OBG_SYNFM       -----------------------------------------------------ERDRLEA
OBG_PELPD       -----------------------------------------------------TREKLAE
OBG_DESAH       -----------------------------------------------------SMEKVEQ
OBG_DESOH       -----------------------------------------------------AEALAQQ
OBG_DESAL       -----------------------------------------------------AEEGACL
OBG_DESDA       -------------------------------------------------------ERLEA
OBG_LAWIP       -------------------------------------------------------EKLSH
OBG_BDEBA       -------------------------------------------------------SQLTK
OBG_BUCAP       -----------------------------------------------------IKKIIDK
OBG_BUCBP       -----------------------------------------------------INTKLKS
OBG_BUCCC       -----------------------------------------------------ISQIKKY
OBG_WIGBR       ----------------------------------------------------IFFKQAQF
OBG_PHOPR       -----------------------------------------------------TQAKISE
OBG_PSYIN       -----------------------------------------------------AELVIER
OBG_PSEHT       -----------------------------------------------------AKALCEK
OBG_COLP3       -----------------------------------------------------AKEITDA
OBG_ECOLI       -----------------------------------------------------AEEKAKA
OBG_BAUCH       -----------------------------------------------------ALNIAQT
OBG_BLOPB       -----------------------------------------------------AEKRINH
OBG_LEGPL       ---------------------------------------------------KEREEKIQS
OBG_DICNV       ----------------------------------------------------LWQQKQEE
OBG_ACIF5       ----------------------------------------------------EAEARFQQ
OBG_METPP       ---------------------------------------------------EERAARVKD
OBG_JANMA       ---------------------------------------------------EERKKRVKD
OBG_METFK       ---------------------------------------------------SEQ--KVAE
OBG_NITMU       ---------------------------------------------------NEREKICKK
OBG_DECAR       ---------------------------------------------------EDREAAVKN
OBG_CHRVO       ---------------------------------------------------DERELTVSA
OBG_BORPD       ---------------------------------------------------PDAAR--QR
OBG_ACIAD       ---------------------------------------------------ANREEWCQH
OBG_PSYWF       ---------------------------------------------------DELNELCLH
OBG_ALCBS       ---------------------------------------------------DEAQAQVDA
OBG_CHRSD       ---------------------------------------------------EERPSTVDD
OBG_HAHCH       ---------------------------------------------------DEKEAICAD
OBG_SACD2       ---------------------------------------------------DEVAEVERQ
OBG_MARMS       ---------------------------------------------------DELEERCQS
OBG_PSEU2       ---------------------------------------------------EEQEARKQE
OBG_COXB1       ---------------------------------------------------DVAQARCQE
OBG_HYDCU       ---------------------------------------------------EEASELCDQ
OBG_NITOC       ---------------------------------------------------SERASRCQE
OBG_THISH       ---------------------------------------------------DERESFTKE
OBG_METCA       ---------------------------------------------------ELLESRCRE
OBG_ALKEH       ---------------------------------------------------EDRDAHVND
OBG_HALHL       ---------------------------------------------------EMRAERVAE
OBG_XYLFT       ---------------------------------------------------EEAQALAEA
OBG_FRAP2       ----------------------------------------------------EVEEKCQE
OBG_VESOH       ---------------------------------------------------KDRNTMVQS
OBG_CAUVN       -----------------------------------------------------LAEKVAE
OBG_HYPNA       -----------------------------------------------------VKEQLKQ
OBG_METSB       -----------------------------------------------------LKQQAMR
OBG_OLICO       -----------------------------------------------------LKEQKAR
OBG_RHOCS       -----------------------------------------------------LEFKRTK
OBG_RHORT       -----------------------------------------------------IAAKIAE
OBG_GLUOX       -----------------------------------------------------RSAKKRA
OBG_RHOS5       -----------------------------------------------------ISDRRRA
OBG_SPHAL       -----------------------------------------------------IAALSAE
OBG_ZYMMO       -----------------------------------------------------CAELSQA
OBG_MAGMM       -----------------------------------------------------RQVVLSW
OBG1_ANAMM      -----------------------------------------------------VREKQKL
OBG_ANAPZ       -----------------------------------------------------IVQKKHL
OBG_EHRRW       -----------------------------------------------------IAIKKRL
OBG_WOLTR       -----------------------------------------------------IFEKKNH
OBG_NEOSM       -----------------------------------------------------VQEKCQY
OBG_PELUB       -----------------------------------------------------VKEILKN
OBG_ORITI       -----------------------------------------------------IMSKLLE
OBG_RICBR       -----------------------------------------------------IAEKTTQ
OBG_BACV8       ----------------------------------------------------LDEELIAM
OBG_PORG3       ----------------------------------------------------IDEELCEM
OBG_CYTH3       ----------------------------------------------------LDDELKAE
OBG_GRAFK       ----------------------------------------------------LDEELKAE
OBG_AZOPC       ----------------------------------------------------LDTKLEDV
OBG_AMOA5       ----------------------------------------------------IGAEEKVT
OBG_SULMW       ----------------------------------------------------LDQELKYE
OBG_CAMFF       ----------------------------------------------------KIEEFLNE
OBG_CAMHC       ----------------------------------------------------MLTEFCDE
OBG_ARCB4       ----------------------------------------------------DIKNFIKE
OBG_NITSB       ----------------------------------------------------KIEKFIED
OBG_NAUPA       ----------------------------------------------------KIEEFFEK
OBG_SULNB       ----------------------------------------------------LTQTFLDD
OBG_WOLSU       ----------------------------------------------------KIELFLKG
OBG_SULDN       ----------------------------------------------------LVNSFMEI
OBG_CAMLR       ----------------------------------------------------LGEEFAQK
OBG_HELHP       ----------------------------------------------------LGEEFADK
OBG_HELAH       ----------------------------------------------------MTKDFCTF
OBG_BORBZ       -----------------------------------------------------EKNFDCL
OBG_BORT9       -----------------------------------------------------IENFNQL
OBG_TREPS       -----------------------------------------------------RECLQQL
OBG_TREDE       -----------------------------------------------------KERFTEL
OBG_LEPBP       -----------------------------------------------------DPSFTEE
OBG_LEPIC       -----------------------------------------------------DPEFTKD
                                                                            

OBG_SYNY3       IGE----------------------------------IETELKRFS--TAPCLHISAATR
OBG_SYNP2       ADF----------------------------------ITEELRRLT--DAKILTISAVSR
OBG_TRIEI       AEIQ--------------------------------ELVNRFREIS--GGKVFLISAVAG
OBG_ACAM1       LLE----------------------------------KQACLEQMS--GSPVYLISAVAQ
OBG_SYNJA       VSE----------------------------------RTQRLSMAA--GAPVSAISAVAR
OBG_GLOVI       AEH----------------------------------WRRILSTET--GEPVLVISAAAR
OBG_PAUCH       LHQ----------------------------------FSQALRMVS--GCKILVISSAIL
OBG_PROMP       LQT----------------------------------ITKKLENLS--KKKVLVISSSLR
OBG_DEHM1       KGKMGFHITRL-------------------------EDGWQVEAPE--IERIIEHSDIED
OBG_SALRD       R-------ALL-------------------------PDVVADEFPD--DVPLLPISAVAD
OBG_PROA2       -------------------------------------EAFSLPDFE-DDVPLIPVSSITR
OBG_CHLT3       ----------E-------------------------DASFEVPAFE--GEKVVQISSVTG
OBG_COPPD       I------------------------------------DQLKVQFAD-KESHVVLTSAATG
OBG_DESPS       DLL---------------------------------PDFIEARGLE--PKNVLFISAITG
OBG_PHYAS       KLSDVT---------------------------------------------IIPLSLINF
OBG_PHYMT       KILNKN---------------------------------------------IIPTSLLKN
OBG_ACHLI       ALKDVK---------------------------------------------VIPISALMN
OBG_MYCAP       KYPDVE---------------------------------------------IVEISAIER
OBG_MYCS5       KYPNIE---------------------------------------------IIEISALNY
OBG_MYCMO       KFPKLE---------------------------------------------IFQISALTT
OBG_MYCPU       HYPNKK---------------------------------------------IIAISALKQ
OBG_MYCA5       AYPTLP---------------------------------------------IVAISALYQ
OBG_MYCH2       KFPKIK---------------------------------------------IIKSSLISA
OBG_MESFL       YFKDKK---------------------------------------------VVFVSGLLK
OBG_MYCPN       YLENKG-------------------------------------------IPLFKISAL-K
OBG_MYCGA       YLAKKG-------------------------------------------IDISSISAI-N
OBG_MYCPE       EFKKISN------------------------------------------KKVYQISGFFK
OBG_UREU1       HLKDNQ--------------------------------------------YIKVISALTN
OBG_ROSS1       LRHAL---------------------------------PLPDH-------DVFVISAATR
OBG_HERA2       MRPQII------------------------------AWGIDPE-------NIFPISAATN
OBG_THERP       IARAL--------------------------------DELGY--------TAYPISAATG
OBG_BACSU       FK-----------------------------------EKLTDD------YPVFPISAVTR
OBG_STACT       FK-----------------------------------EEVGDD------VEIIPISAYTK
OBG_EXIS2       FK-----------------------------------EAFPD-------LEVFAISAATR
OBG_ENTFA       FKEQLAK--ER-------------------------TDEYADE------LPIFPISGVTR
OBG_LACLA       FKEKLA---AD-------------------------LGPDKEM------PEIFEVSGLTK
OBG_BREBN       FK-----------------------------------EKAPDV-------KVYEISAATS
OBG_LACJO       FK-----------------------------------KKLG-------DKTVYPISSVTH
OBG_LACSS       FK-----------------------------------QKLAAAG---DTHEIFEISSITH
OBG_LACF3       FK-----------------------------------KLLEADDTLPETPQVFSISAVTH
OBG_PEDPA       FE-----------------------------------KQVRADERY-ADFEIFPISSITH
OBG_LEUMM       FR-----------------------------------KEVATDSGLPIQPEIVPISSITR
OBG_OENOB       FK-----------------------------------QELANRQ---INMPIVEISSVTQ
OBG_HELMI       LREKLG---------------------------------EGA--------VIFPISAATR
OBG_PELTS       LKEAYG----------------------------------GKY-------EIFPVSAVTG
OBG_DESHY       LTEKLG----------------------------------EDY-------RIFPVSAATG
OBG_DESAP       LAEAAG----------------------------------GRY-------EVFEISALTG
OBG_MOOTA       LRERLG----------------------------------DSY-------RIFPISAATG
OBG_CARHZ       LKQHIA----------------------------------GKY-------EIYPISALTG
OBG_DESRM       LREEFG----------------------------------EQF-------EIYPISAATN
OBG_SYNWW       LESELG----------------------------------KT---------VHCISAVTG
OBG_SYMTH       VREALE----------------------------------KRGY------RVFPISGATR
OBG_HALOH       VQPVLE---------------------------------EKGY-------KVFPISAATK
OBG_NATTJ       LLDKVNSD-EI-------------------------LIPEQYK-------KIFPISAATG
OBG_ALKOO       LKAVLS---------------------------------ERG-------IEVFPISAATS
OBG_CLOD6       FKSELE---------------------------------GRG-------YTVFKMSAATR
OBG_RUMCH       FKEELE---------------------------------KRG-------YKVFGISAATN
OBG_HUNT2       FRKVIE---------------------------------PRG-------YKIFPVSAASN
OBG_LACP7       IKEAFE---------------------------------SKG-------IKVFPISAVSG
OBG_CLOPS       FKAEVN---------------------------------KMGF------DKVFKMSAATS
OBG_CLOTE       FKEKIQ---------------------------------KLGD------YKIFKISAATG
OBG_CALS8       FKEEIE---------------------------------KMG-------YEVYPISAATG
OBG_CALS4       FEEEIK---------------------------------KRG-------YEVYPISALTK
OBG_FUSNN       FKSYLA---------------------------------EKG-------IEIYPVSVLLN
OBG_FINM2       FREKYS---------------------------------DKV-------DEIVEISAATT
OBG_ELUMP       IVKKYK------------------------------------------KHKVFLISAATG
OBG_UNCTG       FKKHLK------------------------------------------VKKLFETSAATG
OBG_FRASN       LVT-------------------------------------PDLQ--ARGLAVHQISTASR
OBG_SACEN       LVR-------------------------------------PELA--QRGWPVFEVSTASH
OBG_STRGG       MIR-------------------------------------PDLE--ARGYRVFEVSAIAH
OBG_KINRD       IVR-------------------------------------ADLE--EQGAPVFVVSAVAH
OBG_NOCSJ       FVV-------------------------------------DELR--QRGLRVFEVSAASG
OBG_SALTO       IVR-------------------------------------PDLE--ARGFRVFEVSAATR
OBG_ACIC1       AAA-------------------------------------RQIA----DAPVFLVSAVTR
OBG_THEFY       LVE-------------------------------------PMLV--ERGYRVLQVSAATR
OBG_RENSM       FVR-------------------------------------AELE--GRGYRVFEVSASSH
OBG_KOCRD       FVR-------------------------------------VELE--QRGYPVFEISTASH
OBG_LEIXX       FLR-------------------------------------PDLE--ARGYRVFEISTVSH
OBG_BIFA0       FVR-------------------------------------PEFE--KLDLPVYEISTASH
OBG_CUTAK       IIF-------------------------------------DDVA--ERGWPVSRVSTKSG
OBG_CORDI       FLK-------------------------------------EDIEE-KFGWPVFIISAVAR
OBG_CORU7       LQE-------------------------------------EEL-K-KFGWPIFRISTVAR
OBG_TROWT       TLLY----------------------------------LQSVFK--KLVTDVYAISAVTR
OBG_DEIRA       MVE-------------------------------------DELA--EQGLPVLQVSAKEG
OBG_THET8       ALA-------------------------------------DALA--REGLAVLPVSALTG
OBG_RUBXD       YLG-------------------------------------EAFP------GAPQVSARTG
OBG_AKKM8       FRM------------------------------------RFPK------VDIIPISALNG
OBG_METI4       KSL------------------------------------DFNKRT---GLSFLPISALKA
OBG_OPITP       FKR------------------------------------RHRT------VDVLPLSCLTS
OBG_CHLPN       LQS---------------------------------FQKRFP------SYTFVLISGLTG
OBG_PARUW       IQE---------------------------------FEKNFSIS----SDMLFKISAVYG
OBG_RHOBA       LQA------------------------------------YFDEHPANHARDLRSISAATD
OBG_SULSY       YFSE------------------------------------RG-------YPFVAVSLITR
OBG_AQUAE       YFKE------------------------------------KG-------YEFYAVSALTG
OBG_THEYD       YCEE------------------------------------KG-------IDFFPISAVKK
OBG_HYDS0       LAKE------------------------------------KS-------LDFIPVSSTTG
OBG_THEM4       LKNA------------------------------------TG-------KETFPTSVLTG
OBG_FERNB       FLKE------------------------------------IG-------EGILLISAVTG
OBG_THENN       IESS------------------------------------IG-------KEVIPISAVTG
OBG_PSELT       LEKH------------------------------------AN-------QKIYPVSALLR
OBG_PETMO       FKNR------------------------------------TG-------KDIFPISAYTG
OBG_DICTD       LKN-------------------------------------EG-------VPYVFISAKEG
OBG_ACIC5       LAAMA---------------------------------KRRKL-------PFYEISAVTG
OBG_PELCD       VRAAFA--------------------------------AEG--------IRTLAISAVTG
OBG_SYNAS       TLRIFA--------------------------------EKG--------IVLYPFSAATG
OBG_ANADF       LRKAFAR-------------------------------RKQP-------VEVHLVSAVTG
OBG_MYXXD       FTEAL---------------------------------RERG-------IRVYPVSCATG
OBG_SORC5       LKARF---------------------------------AKAK-------VKLHLISAATG
OBG_SOLUE       LRDLA--------------------------------KSRDL--------PFFEISSATG
OBG_SYNFM       LV----------------------------------SRYEQLG------HPVFPVSARTK
OBG_PELPD       IRSWFE--------------------------------ERG--------IRVFPISSATG
OBG_DESAH       FK-----------------------------------KAYGTG-------ELLTLSAATG
OBG_DESOH       FI-----------------------------------NAAGIK-------KCFLISAATR
OBG_DESAL       FK-----------------------------------QSCGNL-------QVLQISAILG
OBG_DESDA       LKERARAD----------------------------------------GREVYFISARDD
OBG_LAWIP       IKQVAESS----------------------------------------GKIIYFISAETG
OBG_BDEBA       LKKQFKEAS---------------------------------------GSEPFAISAVTG
OBG_BUCAP       IKNFLKV-----------------------------------------EERFYLISSIKK
OBG_BUCBP       ILEKLGS-----------------------------------------IQQYFLISAIKK
OBG_BUCCC       IKKKIEK-----------------------------------------NKKYYFISAKKN
OBG_WIGBR       VSNSLGY-----------------------------------------EKKFFFISLNDF
OBG_PHOPR       VLEALAW-----------------------------------------EGDYYCISALTR
OBG_PSYIN       VKEALEW-----------------------------------------DGPVYKVAAISK
OBG_PSEHT       IAQELGE-----------------------------------------TENIYSISAINK
OBG_COLP3       IIAGLDW-----------------------------------------KGEVHSISAFNR
OBG_ECOLI       IAEALGW-----------------------------------------EDKYYLISAASG
OBG_BAUCH       ISDALNQ-----------------------------------------KHNYYLISAMNH
OBG_BLOPB       VISSLKW-----------------------------------------KGRYYSISSIHN
OBG_LEGPL       IIKGLEWKDKV-----------------------------------------FSISAIES
OBG_DICNV       IVRALNWQGKV-----------------------------------------FSISAAAG
OBG_ACIF5       ICTALQWESPA-----------------------------------------FLISAASG
OBG_METPP       FVKRFKWKGPV-----------------------------------------FEISALTR
OBG_JANMA       FIKRFGWKGPV-----------------------------------------FEISALTR
OBG_METFK       FVQRLGWQGRY-----------------------------------------FAISALAG
OBG_NITMU       FIRSLRWKDKN-----------------------------------------FAISAMTG
OBG_DECAR       FIKAYKKATKYDGP-------------------------------------VFPIAAING
OBG_CHRVO       FLNAYGWPQERPDDSLGFD---------------------------IKAPRVFTISALNH
OBG_BORPD       FVEQFSWQGPV-----------------------------------------FVISGLNG
OBG_ACIAD       ILTELEWTGPV-----------------------------------------FRTSGLLL
OBG_PSYWF       IVAELGWTGAV-----------------------------------------FRTSTLTG
OBG_ALCBS       IVDELGWQGPV-----------------------------------------FKVSAAAG
OBG_CHRSD       IVERLAWSGPV-----------------------------------------YKISAISG
OBG_HAHCH       ILKRLNWSGPS-----------------------------------------YEISALAG
OBG_SACD2       IREALNWVGPI-----------------------------------------YKIAAISN
OBG_MARMS       VIDALGWEGKA-----------------------------------------YRISAISG
OBG_PSEU2       IVDRLEWTGPV-----------------------------------------YVISAIAK
OBG_COXB1       IINRLNWKGPV-----------------------------------------YKISAIKR
OBG_HYDCU       IVERLNWTGPV-----------------------------------------FAISAVNR
OBG_NITOC       IIREICWQKPV-----------------------------------------YEISALTG
OBG_THISH       LVARLGWEGPV-----------------------------------------YAISAATG
OBG_METCA       IIDGLHWTDPV-----------------------------------------YRISAIQG
OBG_ALKEH       LLQRLQWGGPV-----------------------------------------YRISALSG
OBG_HALHL       IARGLGWDGPV-----------------------------------------YGISGLTG
OBG_XYLFT       LIAELRWTAPW-----------------------------------------YLVSAVSR
OBG_FRAP2       FVKQIGYEGNY-----------------------------------------YMISAAMK
OBG_VESOH       LLKDICYKGKV-----------------------------------------FNISALNG
OBG_CAUVN       LEA-------------------------------------------VSGIKPRLVSGVSG
OBG_HYPNA       LKK-------------------------------------------VYKGKPLLISGVTG
OBG_METSB       LKR-------------------------------------------AAKRAPLQLSAATN
OBG_OLICO       LKR-------------------------------------------AAKQTPMLVSGVTG
OBG_RHOCS       LRR-------------------------------------------SAKKPVMLLSGATG
OBG_RHORT       LSE-------------------------------------------ACGAPVMAFSAISG
OBG_GLUOX       LAK-------------------------------------------ASGAEVMMLSGATQ
OBG_RHOS5       LEK-------------------------------------------ATGGKVFTISGVAG
OBG_SPHAL       LEA-------------------------------------------ESGHPVMALSGASG
OBG_ZYMMO       LEE-------------------------------------------ASGQKVLLLSGATG
OBG_MAGMM       FKERLG----------------------------------------EAMPPVFILSSATG
OBG1_ANAMM      LES-------------------------------------------STKKEVITLSMGDE
OBG_ANAPZ       LED-------------------------------------------YSNKTVVTLSLDDP
OBG_EHRRW       LAE-------------------------------------------HTKKEIFTSSIKKS
OBG_WOLTR       LAN-------------------------------------------YLNKEVLCLSIGED
OBG_NEOSM       IRE-------------------------------------------KTGKLTLHTGIDQE
OBG_PELUB       FSK-------------------------------------------NKDSEVVTLSTLEK
OBG_ORITI       LQP-------------------------------------------VINRVIYPISSYTK
OBG_RICBR       LQK-------------------------------------------ITGKEIFPISTYTN
OBG_BACV8       LEPTLP-----------------------------------------DNVPHIFISSVTG
OBG_PORG3       LREELP-----------------------------------------TGLPVVFISAVAQ
OBG_CYTH3       LKKELP-----------------------------------------KGVETVFFSSYLN
OBG_GRAFK       MAKELDKEL--------------------------------------Q-LPYIFISSVAQ
OBG_AZOPC       IKKELP-----------------------------------------TDIPHIFISSFTQ
OBG_AMOA5       IKKLLP-----------------------------------------KQIDCVFISSVTG
OBG_SULMW       IIKELP-----------------------------------------KFEKYIFISSFSK
OBG_CAMFF       FKFD-------------------------------KKQDIYE----YDRQKPFFVLPISS
OBG_CAMHC       FGFG----------------------------SRQIPNEKGE----FDKTKPVFVMQISS
OBG_ARCB4       LDLEESNSN---------------EFKFETEYPYFVQDTIYSR---FDKSKPYFVLPISS
OBG_NITSB       LHLNRGGD-N--------------RYGLEERYPYFIQDIY---A--YDSSKPFFVVSISA
OBG_NAUPA       LGISKTEP----------------KFKADPNLP-------------CHFDDKTFVLPISS
OBG_SULNB       IGLKANDTLK--------------KYKADMNYLSYGFKTDFGVP--LPIKEPLFVLPISS
OBG_WOLSU       IGLSSCQS-N--------------QYALSEALQNYIAPL--------ESSIPAFVVPISS
OBG_SULDN       VGVKATSNSN---------------LNFDKNLPYFIQDSADETLG-YDREIPYFVMPISS
OBG_CAMLR       MEDDYNELKA---------------YLQSQNNPQSFFIKVSSLEK--TGLKELKFMLLEE
OBG_HELHP       FDKQTQELEQ---------------FLAQKGNPQSFILPISSIQK--SGLKELVFEILNS
OBG_HELAH       LNLKVQKLEA---------------FDLEPYLGFLHPKLMGNFEKDLNEKSALFILPLSA
OBG_BORBZ       IKALGKE----------------------KVVGISIYENRGID----ELIKEFFILAKTF
OBG_BORT9       KRALDGE----------------------KVLGISIYDNRGID----ELVNELFALSRI-
OBG_TREPS       RAQHPST----------------------EVCGVSVHNRWGLD----ELQEAFVRLSDAG
OBG_TREDE       KNAIPDQ----------------------EILGISLYNEWGLE----EVKKAFIRLADEM
OBG_LEPBP       IQKKYSHLG--------------------EIICISADKEFNLE-YLLERIDKVFFTEKVK
OBG_LEPIC       VIAKVSHLG--------------------KVVAISADQEVNLE-ELLENMDEVFFKNEIE
                                                                            

OBG_SYNY3       RG----LDDLMQLVWQWLDEMAAA-DAEAQRLLELELQAQAAMNNPFNSDV---------
OBG_SYNP2       TG----LEQLLQEIWDVLDYLKEISRNEAPETSVMDLESLHIADE---------------
OBG_TRIEI       IG----LEELMQEIWGLLEMEEEVKSSELTPTPPLVSREES-------------------
OBG_ACAM1       QG----LDTLLQQVWEELDRLPNDLQEAPIPVLDSPILRET-------------------
OBG_SYNJA       QG----LEPLLQRVWQCLGRDPDLHRPAAASKIQPVRGQENLRIGVPLPSQ---------
OBG_GLOVI       SN----LDALLARVWQVLEAPQGVTT----------------------------------
OBG_PAUCH       SS----IEFLKTQIWQQLGT----------------------------------------
OBG_PROMP       KG----LSPLLSEVWKRI------------------------------------------
OBG_DEHM1       LE----VRRQIMVLLKHRNVQQALIKAGAVIGQKIITGRLEWYL----------------
OBG_SALRD       VG----LDQLKYTLFDTVHSTQSADAIDA-------------------------------
OBG_PROA2       SG----LEELRNALWNTINPSIP-------------------------------------
OBG_CHLT3       TG----LQELKDVLWRIIQESNQQEESIT-------------------------------
OBG_COPPD       EG----TNQLVDVLFELISPTLSTEEPTAEFMTMELPPLPEDFSIRREDEY---------
OBG_DESPS       EG----VDKLVKLIGDIIDDMEYQELKQKREEERLQDLKKQKEEERRQELK---------
OBG_PHYAS       YN----IEKLKYAIKNLLQKTPF---------------VIP--KHDNFKVYDL-------
OBG_PHYMT       QN----LKILKYKMLEMIKKNVV---------------NLPLCENSSFKTYTL-------
OBG_ACHLI       DG----IQTLKYEIATTLKTIPK---------------FAP---KDTTKHYTL-------
OBG_MYCAP       QN----LEELKGKIWKIL-EEAK---------------LLPADEEEETEENV--------
OBG_MYCS5       HN----VENLKKIIWEFL-EKTS---------------HLQIKIEDDFETEVK-------
OBG_MYCMO       KN----VNGLKNKLGEIL-SKAK---------------SYRKKI-EKTETTI--------
OBG_MYCPU       EN----LDKLKEALWQSV-KNTK---------------DIVFELSEDEEVFI--------
OBG_MYCA5       KN----LDELKAAIFKML-EQAN---------------QQTKSNVVENEIAI--------
OBG_MYCH2       KQNE--INIIKEKMFGLLEEKQK---------------KLEIQEINTSKIEF--------
OBG_MESFL       DN----VDELLLKIAKELETAKYVP-----------LWEMEQDIYEG-IKVYR-------
OBG_MYCPN       QELGDLVAQVFALHQKTLAQF-GAN-----------KFHLPMEMEKHYVFEQ--------
OBG_MYCGA       GDVNNLVDRVFDLYQKTLSTTTETN-----------PFSIPMVAEKVYYYDG--------
OBG_MYCPE       ENTNELLKDIFKDYKKHKEQW---------------ERELEEKINSYSLVKV--------
OBG_UREU1       LHVDAMLDDVIKIYFDQKKIYEQRL-----------KEHLPVDQILKWASDTP-------
OBG_ROSS1       EG----VDALLQRVAGRLKEMPAPH-----------RVPRD---ETLTWP----------
OBG_HERA2       QG----LQPLQRRIVDILREMPE-R-----------ITRLPYSEEILTFR----------
OBG_THERP       QG----VGELIRATWERLQQLPRPE-----------RVAPPL-RSHRVYT----------
OBG_BACSU       EG----LRELLFEVANQLE--NTPE-----------FPLYDEEELTQNRV----------
OBG_STACT       EN----IDQLLYAIADKLDEYKDVD-----------FTKEDDEALGVNRV----------
OBG_EXIS2       QG----LRDLLFRIADLVDATPEFG-----------L-EELEEKTATPRV----------
OBG_ENTFA       KG----IEPLLNATADLLEVTPEFP-----------L-YEDEVVE-EETV----------
OBG_LACLA       TG----LQGLLARTSELLAQTPEFL-----------L-YDEDELA-DETA----------
OBG_BREBN       KG----VQELMYAIGDTLATIPDKP-----------A--VEEVAEVEERV----------
OBG_LACJO       KG----VSELMGKTADLVEEVAKEE-----------AEKP--AEIKVAEK----------
OBG_LACSS       QG----VQPLMNKTADLLAETAEFP-----------MGDV---EEAQTQK----------
OBG_LACF3       AG----VQELMQTTANLIEETPAFD-----------A-NA----HDEQEAV---------
OBG_PEDPA       NG----LEKLVARTADVLEEIPQHS-----------LIATS---DEETEK----------
OBG_LEUMM       DG----VKDLMRLTADMLATAPAPE-----------SYRPET-KNDTSEK----------
OBG_OENOB       TG----TKQLLLKVADLLDKTPRMI-----------ERKEE---QSTDDR----------
OBG_HELMI       QG----LEPLIYHVHKGLEELGPVV-----------FERVTADAHMDVRF----------
OBG_PELTS       QG----LEALVYRVSALLEEIPA---------------GAAVPEALERPV----------
OBG_DESHY       EG----LKELVYAAAKALPEIPAP-------------QIFVRDEEQHKLT----------
OBG_DESAP       EG----LDRLIYRTYRLLETIPV--------------EPAPAPIVPDERE----------
OBG_MOOTA       EG----VQELLYHVSGLLATLP---------------PPAPVTAPEEEKV----------
OBG_CARHZ       EG----LKPLIYRLWEIISTLPR----------------ESLEVKPQKVI----------
OBG_DESRM       QG----LDKVIHRVAELLAQLPK----------------IEPEQPEEDVM----------
OBG_SYNWW       QG----VEELMGKTYALLQAAPQ----------------EIPSG-EEPVV----------
OBG_SYMTH       EG----FRPLLEAAYDLIRQWVP----------------PEPAAPEAEMV----------
OBG_HALOH       EG----VKELIYYTGDLLKELPVER-----------KIAKEDRIVIKPD-----------
OBG_NATTJ       EG----LRELLDFVAEKVAQLPDTH-----------DTFDIDLELPESEENTDTEQ----
OBG_ALKOO       QG----LDELLSYVSKRLKELEEIE-----------ALKADTAPK---------------
OBG_CLOD6       QG----IDEVIAYVSKMLKEVEDVE-----------LVSEEEMYR---------------
OBG_RUMCH       KG----LKELLYAVSETLKTLPDTI-----------LLDETQNEE---------------
OBG_HUNT2       KG----LKELIYYAAQKLKELPDTV-----------LVNDQDNE----------------
OBG_LACP7       QG----VKELLYYVSDLLKTVDATP-----------IVFEKEYFP---------------
OBG_CLOPS       QG----VEEVIKEAARMLKDIPVTD-----------LEIPEDE-----------------
OBG_CLOTE       EG----IKELMAEVSKTLATIPVTQ-----------VEIKRED-----------------
OBG_CALS8       MG----IREVLKRAYELLKQQKAAE-----------NIEEDAKPR---------------
OBG_CALS4       EG----LDALLDKTIEIL-SSIPAE-----------KIEE--VPE---------------
OBG_FUSNN       EG----LKEILYKTYDMLSRIEREP-----------LEEETDITK---------------
OBG_FINM2       EN----VDKLMYLIADTLDSIEDDY-----------STLDEQY-----------------
OBG_ELUMP       EG----VDKVLNEIVKVISATPVPN-----------VA--ISKSTVA-------------
OBG_UNCTG       YG----IDALLKEMLRMLEKPVAFS-----------TEGEVEPLHVK-------------
OBG_FRASN       HG----VRGLALALAELVASLRAAV--------PSPA-ATRIVLRPRAVD----------
OBG_SACEN       EG----LRELRFALAEAVEEYRAEQ--------PEPE-PARTIVRPVGVD----------
OBG_STRGG       KG----LKELSFALAGIIAEARATK--------PKEE-ATRIVIRPRAVD----------
OBG_KINRD       TG----LRELSFAMAELVSAARAAE--------PEAV-PTRIVLSPRAVD----------
OBG_NOCSJ       EG----LRELTFAMAGIVEAARAAK--------PAVE-ATRIVLRPPSVD----------
OBG_SALTO       AG----LKELMYAMGELVTAARAAA--------PPAE-PTRIVIRPKAVD----------
OBG_ACIC1       EG----LRELVFAMAGLVETARANR--------PAPE-PPRIVLRPPAIA----------
OBG_THEFY       EG----LKELAYALGEQVAAARAAR--------PPEE-PTRLILRPREIG----------
OBG_RENSM       EG----LRQLSFAMAELVTAARARA-------TVVTAKITPPVLRPRAVN----------
OBG_KOCRD       EG----LRELSFAMAALVSEARAQEE------QREQQRQTVPVLQPEPVRRRRGRD----
OBG_LEIXX       EG----LRPLSFALAELVERARKEQ-------AVLDETRPRIIVRPKTVD----------
OBG_BIFA0       AG----LKELNFALAKLVKEMRAQIAE-----REESVDEERVVIKPLEEPG---------
OBG_CUTAK       EG----LNSLKFAMAELVEKARDNE--------PEPE-PERIVIRPEPKN----------
OBG_CORDI       KG----LDPLKYAMLDLVQQSRKKR--------PKQKVEERIVVRPQAVDA---------
OBG_CORU7       TG----LNELRFALMDIVREHRKKV--------ENTP-EPQQVIRPQSVGP---------
OBG_TROWT       SG----LRQFTLRLGEICQEYPSQV----------QPTSQTILIPAKNTP----------
OBG_DEIRA       TG----LNTLRETLFQLLPEFELWA----------QSNALEVEPDTVVDEALQI------
OBG_THET8       AG----LPALKEALHALV-----------------RSTPPPEMPKPVPRK----------
OBG_RUBXD       EG----VGELARLLERRL---------------RELERSAEAAPRPG-HR----------
OBG_AKKM8       DG----ISRLRN--RLDELVGYKFI-----------------------------------
OBG_METI4       QG----IELFLNSCRKSFESTKKLI-----------------------------------
OBG_OPITP       EG----IELLKKELLKRVTALRGRE-----------------------------------
OBG_CHLPN       EG----VDGLYRFFTQRLAV----------------------------------------
OBG_PARUW       EG----LQELIEKMTQRLSQKKEIE-----------------------------------
OBG_RHOBA       VG----LKELVGEIMTRVAKRREEM-----------------------------------
OBG_SULSY       EN----IDKLINLIRETRD---------------------KMKKEEVNESV---------
OBG_AQUAE       EG----IEELKEGLWKKYE---------------------EIRDKESAQVT---------
OBG_THEYD       EG----IDKLLHYLSEKVG-------------------------KKCGLL----------
OBG_HYDS0       QN----IEYLKEYITNLMN-------------------------H---------------
OBG_THEM4       KG----IREVIYKMAEMVK------------------ESKKLNVEG-EIVNER-------
OBG_FERNB       QG----INELKYAMWDIIK------------------ESKKMYVGTIDITKIE-------
OBG_THENN       EG----VDLLLDRVASIVR-------------------KERIEREERKEKKDHP------
OBG_PSELT       IN----IDILKQKIFEIVG-------------------KSRLLLQKQPVPV---------
OBG_PETMO       EN----IQELITMVWSHISKEKI--------------EQQKFFQKRLKSNVTE-------
OBG_DICTD       IN----IDKLLELMEKYVK-------------------EKKESIPVVEI-----------
OBG_ACIC5       QG----VQQLKYAMAERVRELRKQTQI---------------------------------
OBG_PELCD       EG----LKELVAEVARELEKLRASRLQ---------------------------------
OBG_SYNAS       EG----IPALLYKIGEALKNIRYR------------------------------------
OBG_ANADF       EG----MPELMDAVGRALY-----------------------------------------
OBG_MYXXD       EG----MQPLMDSVAEVLFTGRTEKLHVEIPAKAARAGKAKTKAAEKKALARNAGAAAAT
OBG_SORC5       EG----VPELVRELAALAR-----------------------------------------
OBG_SOLUE       QG----IDALKHAMADRVL-----------------------------------------
OBG_SYNFM       EG----LGELLSALVRILSESG--------------------------------------
OBG_PELPD       EG----VGELLDEIARRLWG----------------------------------------
OBG_DESAH       EG----TAKLIQILARQIAEHKPLERKSETDHGNK-------------------------
OBG_DESOH       SG----VEELKKHLFELLCSHDT-------------------------------------
OBG_DESAL       EG----LDELIEAIFAQLREPGRRPS----------------------------------
OBG_DESDA       LG----LEPLVQELWQVCESTARNEPIVRLEGL---------------------------
OBG_LAWIP       EG----IELLVDAIWKL-QSYRLNAPFIHLKP----------------------------
OBG_BDEBA       KN----IKEFVQELARQ-------------------------------------------
OBG_BUCAP       IG----VKKLCSDIAFYLQK----------------------------------------
OBG_BUCBP       TG----LKKIVKKIYDFLKNKNLL------------------------------------
OBG_BUCCC       IG----IKKLSKDIIKYLYKKNKEYI----------------------------------
OBG_WIGBR       IS----IKILINKILLFLEENKR-------------------------------------
OBG_PHOPR       DG----TKELTYNLMTTIESLPQNKY-DEIEEKVEKVEFKWDDYHAEQIKKAEE------
OBG_PSYIN       TG----TDTLCRDVVEYLEELPAEFT-PEEERQ--QVEFQWDDYHKTAI-----------
OBG_PSEHT       SN----TQPLIHDVMTLLESMPKEKF-VETTDE--EVEFKWDTYHQKAAKKS--------
OBG_COLP3       SG----TKELTQKVMTFIEELPPEEE-EVIDGK--TVEFKWDTYHEETIAAHS-------
OBG_ECOLI       LG----VKDLCWDVMTFIIENPVVQAEEAKQPE--KVEFMWDDYHRQQLEEIAE------
OBG_BAUCH       QG----IKTLCRDIMLFINKNK--------------------------------------
OBG_BLOPB       TN----VLSLCNSIMKFIMHHTHS------------------------------------
OBG_LEGPL       KG----TQELCYALMQLIDEMK-------------KSEA---------------------
OBG_DICNV       IG----TAELCTAIMQELTAMKANQTAEN-----DEPNAPELI-----------------
OBG_ACIF5       AG----CEALVYAIWQALPDLPPAADPTQTEDWGDESDAGERLENWEGDDLDADWEEEQV
OBG_METPP       EG----CETLVQAIYQHVASYQ--THYVD-PDV---RFAEPEADESDDEPRFAPQADDPR
OBG_JANMA       EG----CSDLVTEIYEYIAVQRQAEQRTEETPQ----MVEEARGIDSIDP------DDPR
OBG_METFK       IG----CRELTYAIMEHVE--------EASRVEH--EAAENTGAASMSGD----------
OBG_NITMU       DG----CKELTYAIMEFLER---------ESMDE--NQERATFAEPDTSD----------
OBG_DECAR       EG----TKPLIYAISEALEQ---MARPEIGDLDD--NDEDSDEIIRDTE-----------
OBG_CHRVO       EG----TRELTFAIMSYLDVVRAQARKEAEALQQ--QAAAAKQKVIMPEAPAVSEGDDA-
OBG_BORPD       DG----TQELIWALQDYLDAEQRKANLAQDQADGTYVAEDPRFDATRSDAAPPGAPRGGD
OBG_ACIAD       EG----TKEVVYYLMDQIEQQRELEAEDPEYARKVKAFREQLEAETREQTIAAKEAYRAM
OBG_PSYWF       AG----VDDVKYHLMNEIEREQEREEEDPMFAQAQKERFERLEAEVRLNTEEQKEAYRAA
OBG_ALCBS       VG----CEDLVYALMNAIEDRRLLEREDPAYAAAQQDLRARLEEEARERVQELKAEARQA
OBG_CHRSD       DG----TQALVQAAHRWLTEQRQLEAEDETAFEHEREMRRRMEDEAVARAEARMSRKRKP
OBG_HAHCH       EG----LQRLCQDIMTWIERRAEEERDDPEVAEADRLNREQMDQEVRERIQFLNEQRRLA
OBG_SACD2       TG----TAQLCEKLLGHLEVLWQKERDNEELAEQEHEVQLQMQQEARERIALLQQRHRAA
OBG_MARMS       EG----TEVLCLDLMTALDEKRELLLESPEAREKEKAVRALIDEEGRNRIMSLREKRRKA
OBG_PSEU2       EG----TEQLTRDIMRYLEERSQRIAEEPGYAEELAELDQRIEDEARAQLQALDDQRALR
OBG_COXB1       QG----TELLCYDLMSFLETNQRSI-----------------------------------
OBG_HYDCU       VG----TDDLVKEVAYGLEQNRLKAQEES------------VEE----------------
OBG_NITOC       EG----CQRLIHAVMQYLEEVSPYEKEDSQ------------------------------
OBG_THISH       EA----CESLMQAIMKYLEEAQSHDADTATAG----------------------------
OBG_METCA       EG----LDRLTRDVMRFLEQQERRSDAEQE------------------------------
OBG_ALKEH       DG----TRQLAQDVMNRLEVMDEEAREAGERARREQRQEEGPE-----------------
OBG_HALHL       EG----VDRLCGDIMNDLEARRRE--EDGETA----------------------------
OBG_XYLFT       EG----TWPIMKSAMTLFEHQREVAAEQRVSSR---------------------------
OBG_FRAP2       KG----TEELAKKLNEFLHKQE--------------------------------------
OBG_VESOH       LG----CKDLVAGLFKLVLRK---------------------------------------
OBG_CAUVN       QG----VTELLRAAYKQVRIRRGDLEEEIDDD-------------EDHVDETPGGWTP--
OBG_HYPNA       AG----VKDALYAIAQHLGFNNDDIPLPKPSN------------ADEEDPDTDQPWSPV-
OBG_METSB       LN----VQKALRAVLAEIDAA----AVA----------------DAAGTAADAVVWAP--
OBG_OLICO       EG----VPEVLRALTDVISEAPVSTKAK-------------GEPTENETPPPSTGWSPLS
OBG_RHOCS       QG----VQEMLFELLRHIREARGAEAEA------------------AEEIERRIRYAPIE
OBG_RHORT       KG----LADVLRVMATHVDEARALRHAR----------------GEAEGDASDEAMRDVT
OBG_GLUOX       EG----LPELLRLLQDRVTAAKRDRQG---------------------------------
OBG_RHOS5       TG----LMEVLRALWAEID---GARGDA-----------------VEEHV----PWQP--
OBG_SPHAL       AG----IEPVLDKLLEAIGQPEPGPD--------------------ADEEEKGGDWSPI-
OBG_ZYMMO       QG----LDPILDQLITMTGRAIEKAQ--------------------ESSAQTEKIWSPI-
OBG_MAGMM       EG----IEALVYHVGGMVKQWRLKQGKVGHALED----APTRAGSKALRDEHAPSWQDDD
OBG1_ANAMM      L------DSLIVFLHAQVKKAVVTEPSD-----------------TSFDPFLYVHYNKK-
OBG_ANAPZ       L------NPLLVMLYEMLQKDDIEEES------------------KKFDPFLHVGYNKKK
OBG_EHRRW       K------QHILSILIKHINKD------C-----------------SINKPFIYDPFNT--
OBG_WOLTR       L------QPILRLLNEKLKKG------------------------SSKKVDVYDPFKR--
OBG_NEOSM       L------ASSLKAAQKLVELHQ-----P-----------------GNKSRGKYNPLEV--
OBG_PELUB       -------GSISRIKAKLLSYVS--------------------------------------
OBG_ORITI       YG----IKKLLANILSELQKS---------------------------------------
OBG_RICBR       TG----ITKIIKLALQTIKD----------------------------------------
OBG_BACV8       LG----IQQLKDILWTELNKDSNKLEGVRTETIVHRAKDVAKLQEELKDMG---------
OBG_PORG3       QG----LEELKDTLWKELSKETLH----EPDSIVRQALDLTSLTWD----E---------
OBG_CYTH3       QG----LTELKDLLWTTMNKPKS---------------DFME------------------
OBG_GRAFK       SG----LTELKDKLWQMLNREPV-------------------------------------
OBG_AZOPC       KG----ITVLKDLLWEKLRFHDM--------------KEIS-------------------
OBG_AMOA5       EG----LQKFKDKIWKLLHPELK-------------------------------------
OBG_SULMW       EG----LYELIYYICNILS-----------------------------------------
OBG_CAMFF       VA----GDGLKELKFGLLEILKGEN-----------------------------------
OBG_CAMHC       AA----NKNIKELKFALLEILKAQN-----------------------------------
OBG_ARCB4       LT----KYNIKQLEFALYELLGQDK-----------------------------------
OBG_NITSB       VA----RINIDALKYALYDLVKKERSEANSD-----------------------------
OBG_NAUPA       VA----NINIEALKFALFDLVEKNKRKENEENSF--------------------------
OBG_SULNB       VA----HLNTEALRYALGDFVKNVKEETEAEEK---------------------------
OBG_WOLSU       AT----HENIKPLKYLLHESVRRRG-----------------------------------
OBG_SULDN       AT----NKNIDPLKHALFNLVQTNRIYSK-------------------------------
OBG_CAMLR       VK----KIRNQNNL----------------------------------------------
OBG_HELHP       LR----INPQSILQ----------------------------------------------
OBG_HELAH       VS----ALNTHALKFVLLEALP--------------------------------------
OBG_BORBZ       ------------------------------------------------------------
OBG_BORT9       ------------------------------------------------------------
OBG_TREPS       AG----AL---RSPVWRNQAPSFMYAQLEDPVCQV----------------------RDD
OBG_TREDE       QK----TKPQKESLDPYGQNKNFMTAELDDVSYEE----------------------KND
OBG_LEPBP       LV----YENT--------------------------------------------------
OBG_LEPIC       KI----LNPIKDTKPISLDESDIFES----------------------------------
                                                                            

OBG_SYNY3       -------------PIDGVTYSS--------------------------------------
OBG_SYNP2       ------------------------------------------------------------
OBG_TRIEI       ------------------------------------------------------------
OBG_ACAM1       ------------------------------------------------------------
OBG_SYNJA       -------------NSEMSGYVYLGGGSAPRFAPDQVGH----------------------
OBG_GLOVI       ------------------------------------------------------------
OBG_PAUCH       ------------------------------------------------------------
OBG_PROMP       ------------------------------------------------------------
OBG_DEHM1       ------------------------------------------------------------
OBG_SALRD       ------------------------------------------------------------
OBG_PROA2       ------------------------------------------------------------
OBG_CHLT3       ------------------------------------------------------------
OBG_COPPD       -------------WVVEGRWARYISRYDTTQPWDFQYVQREIRRKKLEEMLRQMGAKEGE
OBG_DESPS       -------------KQKEEEQAKDE------------------------------------
OBG_PHYAS       -------------------NSETQ---------TFTINK---------------------
OBG_PHYMT       -------------------EEEKP---------DFVIKK---------------------
OBG_ACHLI       -------------------NAEDAV--------DFIINK---------------------
OBG_MYCAP       -------------------EIKLED--------DYKISN---------------------
OBG_MYCS5       -------------------EINYEP--------DFVIQK---------------------
OBG_MYCMO       ---------------------VFEK--------DFEVVK---------------------
OBG_MYCPU       ---------------------NFEA--------DFNVVH---------------------
OBG_MYCA5       ---------------------NITL--------DRDALKIR-------------------
OBG_MYCH2       ---------------------NLKA--------PFLIKS---------------------
OBG_MESFL       -------------------LEEDEE--------DIQIIN---------------------
OBG_MYCPN       -------------------ASETDH--------DPLNIE---------------------
OBG_MYCGA       -------------------EKTIDD--------DPLDVI---------------------
OBG_MYCPE       -------------------EKE-QE--------DIVTYE---------------------
OBG_UREU1       -------------------KNKELD--------KTIKIV---------------------
OBG_ROSS1       -----------------VPDVDERQ---------YTIER---------------------
OBG_HERA2       -----------------FSNIDPND---------FWLET---------------------
OBG_THERP       -----------------LDRSQER----------WEAIR---------------------
OBG_BACSU       -----------------MYTMENEEV-------PFNITR---------------------
OBG_STACT       -----------------LYKHTPSQD-------TFTITR---------------------
OBG_EXIS2       -----------------VYGYEAPEA-------GFTVSK---------------------
OBG_ENTFA       -----------------RYGFQPEGP-------EFTIDR---------------------
OBG_LACLA       -----------------YYGFEEEEK-------PFKVSR---------------------
OBG_BREBN       -----------------VFRAEKEPD-------AFEITR---------------------
OBG_LACJO       -----------------EYVYKKPE------DEGFKVER---------------------
OBG_LACSS       -----------------LYQYQPEG-------PAFNVEQ---------------------
OBG_LACF3       -----------------TYKAPQ---E---AEPDFTISR---------------------
OBG_PEDPA       -----------------TYEFSSE--------KDFTIEN---------------------
OBG_LEUMM       -----------------SYTFKPET-------HDFTVEWIA-------------------
OBG_OENOB       -----------------LYEFKDDH-----QSTDFQIEH---------------------
OBG_HELMI       -----------------TGKTEE----------RFKIHR---------------------
OBG_PELTS       -----------------IHQAGP----------RFTVCR---------------------
OBG_DESHY       ------------------QASAPH---------RFELTR---------------------
OBG_DESAP       ------------------TDVTL-----------FLVAR---------------------
OBG_MOOTA       ------------------TALAPE---------ELTIER---------------------
OBG_CARHZ       -----------------KEQPEE----------GFVVEK---------------------
OBG_DESRM       ------------------FEPEER--------FNIKRD----------------------
OBG_SYNWW       ----------------RRFEEE----------LPFKID----------------------
OBG_SYMTH       ------------------YRPKEE---------GWRIY----------------------
OBG_HALOH       ------------------FADEEE---------NIVVEK---------------------
OBG_NATTJ       ---------------EALFTMSQD---------DKIEEKPKSDFGIR-------------
OBG_ALKOO       ---------------EEKVYKYEETED----KYHFTVTRE--------------------
OBG_CLOD6       ---------------PELDIGTEE---------ELSIDIE--------------------
OBG_RUMCH       ---------------VVYKVQEEK---------PFEIHIE--------------------
OBG_HUNT2       ---------------VVYTAVEEE---------PFNIRKE--------------------
OBG_LACP7       ---------------EENLVMSEP--------YTVEYNET--------------------
OBG_CLOPS       -----------------RFIPEDK-------KFTYTINPIEEDG----------------
OBG_CLOTE       -----------------LFIPEEK-------RFTYEI--LRED-----------------
OBG_CALS8       ---------------TFVYYKKKD-------VKPLTVRKE--------------------
OBG_CALS4       ---------------VIVYNPPEE-------EETLEVEVK--------------------
OBG_FUSNN       ---------------LLKELKIEK--------EDFEIIRDE-------------------
OBG_FINM2       -----------------VYFEEEK-------EPDFKVRRE--------------------
OBG_ELUMP       -----------------VHGVEPL----------FKIV----------------------
OBG_UNCTG       -----------------KYIYEPE----------FKI-----------------------
OBG_FRASN       ---------------------EP----------DFTVRAEGDG-----------------
OBG_SACEN       ---------------------DTG----------FTVEPDPDYEDA--------------
OBG_STRGG       ---------------------DA----------GFTVTLEDDG-----------------
OBG_KINRD       ---------------------DQ----------GFKVTREEYGDQENRQ-----------
OBG_NOCSJ       ---------------------GSD---------AFTVTATPDG-----------------
OBG_SALTO       ---------------------DA----------GFTVEAAPGG-----------------
OBG_ACIC1       ---------------------EP----------EFTVRRRGSA-----------------
OBG_THEFY       ---------------------EI----------PFQVIPLGNN-----------------
OBG_RENSM       ---------------------RKE----------FTIRPEERNLEP--------------
OBG_KOCRD       ---------------------RRE----------FVITREDRAEEP--------------
OBG_LEIXX       ---------------------DSG----------FVVKVEGGSEGP--------------
OBG_BIFA0       ------------------TQ-RRNGRN--AQVREFEIEREDDGHGN--------------
OBG_CUTAK       ---------------------ERQ---------AFSIKRQGDGEGG--------------
OBG_CORDI       --------------------RKKNK--------DFEILADPQVENG--------------
OBG_CORU7       --------------------KRKGRFA------DFEVHEDKQNPGA--------------
OBG_TROWT       ---------------------------------EFSLDRTDGV-----------------
OBG_DEIRA       ---------------------------------VFREDAPAKGEGAPE------------
OBG_THET8       -----------------------------------EVQAGVEVVPVAE------------
OBG_RUBXD       ---------------------------------VFRPSWRGLRVEREN------------
OBG_AKKM8       ------------------------------------------------------------
OBG_METI4       ------------------------------------------------------------
OBG_OPITP       ------------------------------------------------------------
OBG_CHLPN       ------------------------------------------------------------
OBG_PARUW       ------------------------------------------------------------
OBG_RHOBA       ------------------------------------------------------------
OBG_SULSY       ----------------ILGNA---------------------------------------
OBG_AQUAE       ------------------------------------------------------------
OBG_THEYD       ------------------------------------------------------------
OBG_HYDS0       ------------------------------------------------------------
OBG_THEM4       -------------------VKRPKPIWKE-LPEKFVIEIKR-------------------
OBG_FERNB       -------------------FEKPSPVRLV-LPDRVDIKILKN------------------
OBG_THENN       -------------------MEKPAPVWRK-LPERFEVEVVKE------------------
OBG_PSELT       -------------------FEKPKPIRTK-IEERFDFEIKKT------------------
OBG_PETMO       -------------------KIKIQPVNYE-PDPFIKINVVKL------------------
OBG_DICTD       -------------------EKEIEELKQ--ENKKQEIPEIIK------------------
OBG_ACIC5       ------------------------------------------------------------
OBG_PELCD       ------------------------------------------------------------
OBG_SYNAS       ------------------------------------------------------------
OBG_ANADF       ------------------------------------------------------------
OBG_MYXXD       KSATKKS------------------AAAKKAVTKKAPARKAGAVAKTSAARKAGTAAAKK
OBG_SORC5       ------------------------------------------------------------
OBG_SOLUE       ------------------------------------------------------------
OBG_SYNFM       ------------------------------------------------------------
OBG_PELPD       ------------------------------------------------------------
OBG_DESAH       ------------------------------------------------------------
OBG_DESOH       ------------------------------------------------------------
OBG_DESAL       ------------------------------------------------------------
OBG_DESDA       ------------------------------------------------------------
OBG_LAWIP       ------------------------------------------------------------
OBG_BDEBA       ------------------------------------------------------------
OBG_BUCAP       ------------------------------------------------------------
OBG_BUCBP       ------------------------------------------------------------
OBG_BUCCC       ------------------------------------------------------------
OBG_WIGBR       ------------------------------------------------------------
OBG_PHOPR       -----------------------------------------------DDD--DDDWDNWN
OBG_PSYIN       -----------------------------------------------EELDDDSDDDDWS
OBG_PSEHT       --------------------------------------------------DDDDDWDEWN
OBG_COLP3       -------------------------------------------------QDDDLDDDDWD
OBG_ECOLI       -------------------------------------------------EDDEDWDDDWD
OBG_BAUCH       ------------------------------------------------------------
OBG_BLOPB       ------------------------------------------------------------
OBG_LEGPL       ------------------------------------------------------------
OBG_DICNV       ------------------------------------------------------------
OBG_ACIF5       ------------------------------------------------------------
OBG_METPP       FR----------------------------------------------------------
OBG_JANMA       FKIID-------------------------------------------------------
OBG_METFK       ------------------------------------------------------------
OBG_NITMU       ------------------------------------------------------------
OBG_DECAR       ------------------------------------------------------------
OBG_CHRVO       ------------------------------------------------------------
OBG_BORPD       E-----------------------------------------------------------
OBG_ACIAD       RKAQR---EADQ--DDDFDD-----DDDE--VEVIYVR----------------------
OBG_PSYWF       RRAAR---EAA--FNNELD------DDDDDGVEVVYAP----------------------
OBG_ALCBS       -------------RQNDDD--------DDHDVEVVYEP----------------------
OBG_CHRSD       -------------AEDDDDDFDE----DDYDVEVEYAP----------------------
OBG_HAHCH       RKKAK---------ESDDDD-------DDEDVEVFYAP----------------------
OBG_SACD2       KAAAKG-----RALDNDDDDED-----DDHEMEIHYVP----------------------
OBG_MARMS       GLLL----------DDDDFDE------DDYDVEVEYVS----------------------
OBG_PSEU2       RSGVKSV--HDIGDDD-WDEEDVD---DEDGPEIIYVRD---------------------
OBG_COXB1       ------------------------------------------------------------
OBG_HYDCU       ------------------------------------------------------------
OBG_NITOC       ------------------------------------------------------------
OBG_THISH       ------------------------------------------------------------
OBG_METCA       ------------------------------------------------------------
OBG_ALKEH       ------------------------------------------------------------
OBG_HALHL       ------------------------------------------------------------
OBG_XYLFT       ------------------------------------------------------------
OBG_FRAP2       ------------------------------------------------------------
OBG_VESOH       ------------------------------------------------------------
OBG_CAUVN       ------------------------------------------------------------
OBG_HYPNA       ------------------------------------------------------------
OBG_METSB       ------------------------------------------------------------
OBG_OLICO       N-----------------------------------------------------------
OBG_RHOCS       E-----------------------------------------------------------
OBG_RHORT       GIDHGYNRPSAVVDWEDAPFDDDDDDDGDESGDKGQWTR---------------------
OBG_GLUOX       ------------------------------------------------------------
OBG_RHOS5       ------------------------------------------------------------
OBG_SPHAL       ------------------------------------------------------------
OBG_ZYMMO       ------------------------------------------------------------
OBG_MAGMM       DDDDDDDGVEVIWVRE--------------------------------------------
OBG1_ANAMM      ------------------------------------------------------------
OBG_ANAPZ       TPKI--------------------------------------------------------
OBG_EHRRW       ------------------------------------------------------------
OBG_WOLTR       ------------------------------------------------------------
OBG_NEOSM       ------------------------------------------------------------
OBG_PELUB       ------------------------------------------------------------
OBG_ORITI       ------------------------------------------------------------
OBG_RICBR       ------------------------------------------------------------
OBG_BACV8       -------------EDEDFEYEYEEDAD--------DDFDYEYEDENWDEEEEKK------
OBG_PORG3       -------------EDDLFPASIEDDEDEEG----LDDIDFDLEIEYDNEGDDAPDQL---
OBG_CYTH3       ------------------------------------------------------------
OBG_GRAFK       ------------------------------------------------------------
OBG_AZOPC       ------------------------------------------------------------
OBG_AMOA5       ------------------------------------------------------------
OBG_SULMW       ------------------------------------------------------------
OBG_CAMFF       ------------------------------------------------------------
OBG_CAMHC       ------------------------------------------------------------
OBG_ARCB4       ------------------------------------------------------------
OBG_NITSB       ------------------------------------------------------------
OBG_NAUPA       ------------------------------------------------------------
OBG_SULNB       ------------------------------------------------------------
OBG_WOLSU       ------------------------------------------------------------
OBG_SULDN       ------------------------------------------------------------
OBG_CAMLR       ------------------------------------------------------------
OBG_HELHP       ------------------------------------------------------------
OBG_HELAH       ------------------------------------------------------------
OBG_BORBZ       ------------------------------------------------------------
OBG_BORT9       ------------------------------------------------------------
OBG_TREPS       ---FGATVSLSRKRKVRG------------------------------------------
OBG_TREDE       DEHFGATVSLSRKRKPKK------------------------------------------
OBG_LEPBP       ------------------------------------------------------------
OBG_LEPIC       ------------------------------------------------------------
                                                                            

OBG_SYNY3       ------------------------------------------------------------
OBG_SYNP2       ------------------------------------------------------------
OBG_TRIEI       ------------------------------------------------------------
OBG_ACAM1       ------------------------------------------------------------
OBG_SYNJA       ------------------------------------------------------------
OBG_GLOVI       ------------------------------------------------------------
OBG_PAUCH       ------------------------------------------------------------
OBG_PROMP       ------------------------------------------------------------
OBG_DEHM1       ------------------------------------------------------------
OBG_SALRD       ------------------------------------------------------------
OBG_PROA2       ------------------------------------------------------------
OBG_CHLT3       ------------------------------------------------------------
OBG_COPPD       TV-VIHDKAFEIL-----------------------------------------------
OBG_DESPS       ------------------------------------------------------------
OBG_PHYAS       ------------------------------NKEGVFVVSGRQVEIFSHRTDFN-NEAAVK
OBG_PHYMT       ------------------------------DNQGFFVVKGEKIEKFFYKTDFN-NEEATK
OBG_ACHLI       ------------------------------GDDGVFELTGDKLFVLFNRTDFN-NESAVK
OBG_MYCAP       ------------------------------PYAGFFEITGPKIEQIYHKIPLV-SYDNLI
OBG_MYCS5       ------------------------------MNQNHFKVTGKKIEELVLKIPIN-TFDNLM
OBG_MYCMO       ------------------------------KSENSFEVVGKKITDLVQRIPFN-TYENLM
OBG_MYCPU       ------------------------------LGEGQYLVEGPKIHHFYQRIPLN-THDNLM
OBG_MYCA5       -----------------------------KLSENVYEIESKKVLNVVEKIPVS-SLDNLW
OBG_MYCH2       ------------------------------RNNGFFEITGELIQKIIQKIPLN-SQENIL
OBG_MESFL       ------------------------------KGNGRWEVAGDTIYKIYQKFPIT-TDDNLL
OBG_MYCPN       -----------------------------RDALGRWHVECKRLHYWFDKIPQT-TLDNIR
OBG_MYCGA       -----------------------------KDGENRWIVSSKKLTYWFKKIPQT-TLDNIT
OBG_MYCPE       -----------------------------KDENRIWVVSSKRIAYWFNRIPFN-TDENVT
OBG_UREU1       -----------------------------KVDDHFFEVFGEYLKYWVHRIPLK-TQDNLI
OBG_ROSS1       ------------------------------TSD-GWRVRGRKIERLISMTNFA-QPDAIM
OBG_HERA2       ------------------------------EEDGVLRVHGEKIERLVSMTNFA-QSESLE
OBG_THERP       ------------------------------LSPHHFALRGPKIERLTLMTDFS-NPEAAE
OBG_BACSU       ------------------------------DPDGVFVLSGDSLERLFKMTDFS-RDESVK
OBG_STACT       ------------------------------DDDAAYVVSGKAIERMFKMTDFN-SDPAVR
OBG_EXIS2       ------------------------------DEDDCFVIKGPRIEKLFTMTNFM-REESIK
OBG_ENTFA       ------------------------------EPDASWVLSGEKLEKLFEMTNFD-HDETVM
OBG_LACLA       ------------------------------DDDGGWRLSGDKIERLFIMTNFD-HDESVM
OBG_BREBN       ------------------------------DNE-VFVVSGEKIEKLVRMTNLN-SYDAAQ
OBG_LACJO       ------------------------------TGEHSFVVTGNKLERLVQRTNLD-HTDGIM
OBG_LACSS       ------------------------------DEDGTFYITGEKVERLFKMSNLD-HQDGVM
OBG_LACF3       ------------------------------DDDGTWVLSGAKLERLFVMTNLD-HEDSQL
OBG_PEDPA       ------------------------------IDD-VWVIEGEKIEKLFKMTDTT-HDESLL
OBG_LEUMM       ------------------------------DEE-RWLLSGAEIEKLFLMTNIQ-RDATIM
OBG_OENOB       ------------------------------EGD-DWIIVSERISKLAKMTNKT-TDESLR
OBG_HELMI       ------------------------------DEQGVFVVTGKEVERHVAMTDME-NEESVA
OBG_PELTS       ------------------------------EE-GVFLVGGKEIERHVVMTDLK-NEEAVE
OBG_DESHY       ------------------------------EG-DFFVVSGKEIEKHVQMTMFD-REDGLY
OBG_DESAP       ------------------------------EG-NTYVVEGEGIERRVAMTDLD-NPEAVQ
OBG_MOOTA       ------------------------------EG-QVFIVKNPDVERRVAMTYLD-NEEAVR
OBG_CARHZ       ------------------------------VD-GIFVVKGKKIERLVAMTNLD-NEEAVD
OBG_DESRM       -------------------------------IDGNWRVTGKEIERHVAMTYLE-EDQSLE
OBG_SYNWW       ------------------------------KVDGVFEVSGPRIEKLVVMTNFN-SDEGLQ
OBG_SYMTH       ------------------------------KYGGVWHVEGKEIERLVAMTMWE-NDEAVA
OBG_HALOH       ------------------------------KNG-IYEVSGRLVEKYVIKTDFN-NDAAVK
OBG_NATTJ       ------------------------------KEGDIFIVKHEKLEKILNEIDVH-TEKGRH
OBG_ALKOO       --------------------------------NDVYIVEGRFIERLINSTNFD-DIDSLS
OBG_CLOD6       --------------------------------DGVYVVTGKALRRIMYSVNFD-DMESLQ
OBG_RUMCH       --------------------------------DGVYVIEGKWLRKVLGSTNIT-NYESLQ
OBG_HUNT2       --------------------------------NGVFVVEGSWVQRLVRSVNFD-NYESLQ
OBG_LACP7       --------------------------------EEVYVVEGPRIERMLGYTNID-TEKGFE
OBG_CLOPS       --------------------------------LKVYVVEGSFVDRLLLAVNVN-DPDSLR
OBG_CLOTE       --------------------------------DGTFVVEGSFVDRLLGSVNVN-EPDGLR
OBG_CALS8       --------------------------------NGVYVVEGTVVEKVARNIVLN-DHDSFR
OBG_CALS4       --------------------------------GNTYYLKGSKIDKLLKRINLQ-DEHSLR
OBG_FUSNN       --------------------------------EDAIVVGGRIVDDVLAKYVIGMDDESLV
OBG_FINM2       --------------------------------NENYIVEGPLIENLIYRTNFE-VYESVN
OBG_ELUMP       -----------------------------PLEDGRVQVFGRKIEDMVNMTHFN-QLQGVE
OBG_UNCTG       -----------------------------SIENGIFVATGAKVETLTEVTKFN-EDESLR
OBG_FRASN       -----------------------------------FVVGGTKPLRWVRQTDFS-NEEAIG
OBG_SACEN       -----------------------------------FIVRGDKPERWVRQTHFD-NDEAVG
OBG_STRGG       ----------------------------------IYRVRGEKPERWVRQTDFN-NDEAVG
OBG_KINRD       ---------------------------------VRFRVRGEKPRRWVRQTDFT-NDEAVG
OBG_NOCSJ       -----------------------------------WRVRGEKPERWVRQTDFS-NDEAVG
OBG_SALTO       ----------------------------------TWVVRGTRPERWVRQTNFD-NEEAVG
OBG_ACIC1       -----------------------------------FIVDGEKPRRWVAQTDFS-NDEAVG
OBG_THEFY       ----------------------------------VFRVIGDKPTRWVRQTDFS-NDEAVG
OBG_RENSM       ----------------------------------LFRVLGAKPVRWVKQTDFT-NEEAIG
OBG_KOCRD       ----------------------------------LYHVRGEKPERWVLQTDFN-NDEAVG
OBG_LEIXX       ----------------------------------VYRVLGAKPERWVAQTDFQ-NDEAIG
OBG_BIFA0       ---------------------------------FWFTVTGVKPERWVRQTNFD-NDEAVG
OBG_CUTAK       ---------------------------------FLWRVTGDKPTRWVAQTDFN-NPEAVG
OBG_CORDI       -----------------------------------YLVVGEKPERWIIQTDFE-NDEAVG
OBG_CORU7       -----------------------------------FIVTGQKIDRWILQTDFE-NDEAIG
OBG_TROWT       -----------------------------------YRVTGKKPEKWILQTDFS-SDEAIS
OBG_DEIRA       ---------------------------------RVWEVHGGGFEERIVRFSRY-LEDAAE
OBG_THET8       ---------------------------------GVYEVRAPEVERYLARIKGD-LMEAAG
OBG_RUBXD       ---------------------------------GAYVVSGREVERLALKTDWD-NPEGVE
OBG_AKKM8       --------------------------------------------R---------------
OBG_METI4       ----------------------------------------PSSPKVLSPLT---------
OBG_OPITP       --------------------------------------------KVSPRARD--------
OBG_CHLPN       ------------------------------------------------------------
OBG_PARUW       ----------------------------------------Y-------------------
OBG_RHOBA       ---------------------IEAGITPTLIRQDDAPV-TPKKERRLPPHKAAATGGLSD
OBG_SULSY       ------------------------------------------------------------
OBG_AQUAE       ------------------------------------------------------------
OBG_THEYD       ------------------------------------------------------------
OBG_HYDS0       ------------------------------------------------------------
OBG_THEM4       -------------------------------DGDDFVVAGPYVEEWAKRLNLT-QRDGYN
OBG_FERNB       -------------------------------DKGEFIVESEYIKSYLEKYKME-AKFMLE
OBG_THENN       -------------------------------EDGQWVVEGEGLRVWMERFDLN-QRDARL
OBG_PSELT       -------------------------------QDG-FEICGEQIDKWLSRYSLE-QKDALE
OBG_PETMO       -------------------------------DNETFEVVGDGIEKLLSRYDIH-QKDSRL
OBG_DICTD       -------------------------------EGDLWILKDKKTESLANKLDLY-NPQAFS
OBG_ACIC5       -----------------------------------------EL-----------------
OBG_PELCD       ---------------------------ADQKAAEEDEPWQPDLS----------------
OBG_SYNAS       ---------------------------------------QTEHE----------------
OBG_ANADF       ------------------------------------AEA-PRRGGRGRRL-GKPRAEK--
OBG_MYXXD       APARKSGTAPVKKAAAKKA--PARKSGTAPAKKSAVKKASARKSGSSGKA-AAKKASAAT
OBG_SORC5       -----------------------------------KREEPAEQDG---------------
OBG_SOLUE       ------------------------------------APVPVPE-----------------
OBG_SYNFM       ------------------------------------VSLPVEDVEEHVGK----------
OBG_PELPD       ---------------------------------------RIEEEW---------------
OBG_DESAH       ------------------------------------------------------------
OBG_DESOH       ------------------------------------------------------------
OBG_DESAL       ------------------------------------------------------------
OBG_DESDA       -------------------------------------TDVEEEEFPEIEV-IYTRE----
OBG_LAWIP       -------------------------------------IEHKSDEEFAIEV-AYTKE----
OBG_BDEBA       -------------------------------------ILKEEEE----------------
OBG_BUCAP       ------------------------------------------------------------
OBG_BUCBP       ------------------------------------------------------------
OBG_BUCCC       ------------------------------------------------------------
OBG_WIGBR       ------------------------------------------------------------
OBG_PHOPR       ----EDDYD---------------VEIIYKP-----------------------------
OBG_PSYIN       ----EDDEM---------------MEVIYTKE----------------------------
OBG_PSEHT       ----EDDYD---------------VEVVYER-----------------------------
OBG_COLP3       ----EDDYD---------------VEVEYRQ-----------------------------
OBG_ECOLI       ----EDDEEG--------------VEFIYKR-----------------------------
OBG_BAUCH       ------------------------------------------------------------
OBG_BLOPB       ------------------------------------------------------------
OBG_LEGPL       ------------------------------------------------------------
OBG_DICNV       ------------------------------------------------------------
OBG_ACIF5       ------------------------------------------------------------
OBG_METPP       ------------------------------------------------------------
OBG_JANMA       ------------------------------------------------------------
OBG_METFK       ------------------------------------------------------------
OBG_NITMU       ------------------------------------------------------------
OBG_DECAR       ------------------------------------------------------------
OBG_CHRVO       ------------------------------------------------------------
OBG_BORPD       ------------------------------------------------------------
OBG_ACIAD       ------------------------------------------------------------
OBG_PSYWF       ------------------------------------------------------------
OBG_ALCBS       ------------------------------------------------------------
OBG_CHRSD       ------------------------------------------------------------
OBG_HAHCH       ------------------------------------------------------------
OBG_SACD2       ------------------------------------------------------------
OBG_MARMS       ------------------------------------------------------------
OBG_PSEU2       ------------------------------------------------------------
OBG_COXB1       ------------------------------------------------------------
OBG_HYDCU       ------------------------------------------------------------
OBG_NITOC       ------------------------------------------------------------
OBG_THISH       ------------------------------------------------------------
OBG_METCA       ------------------------------------------------------------
OBG_ALKEH       ------------------------------------------------------------
OBG_HALHL       ------------------------------------------------------------
OBG_XYLFT       ------------------------------------------------------------
OBG_FRAP2       ------------------------------------------------------------
OBG_VESOH       ------------------------------------------------------------
OBG_CAUVN       ------------------------------------------------------------
OBG_HYPNA       ------------------------------------------------------------
OBG_METSB       ------------------------------------------------------------
OBG_OLICO       ------------------------------------------------------------
OBG_RHOCS       ------------------------------------------------------------
OBG_RHORT       ------------------------------------------------------------
OBG_GLUOX       ------------------------------------------------------------
OBG_RHOS5       ------------------------------------------------------------
OBG_SPHAL       ------------------------------------------------------------
OBG_ZYMMO       ------------------------------------------------------------
OBG_MAGMM       ------------------------------------------------------------
OBG1_ANAMM      ------------------------------------------------------------
OBG_ANAPZ       ------------------------------------------------------------
OBG_EHRRW       ------------------------------------------------------------
OBG_WOLTR       ------------------------------------------------------------
OBG_NEOSM       ------------------------------------------------------------
OBG_PELUB       ------------------------------------------------------------
OBG_ORITI       ------------------------------------------------------------
OBG_RICBR       ------------------------------------------------------------
OBG_BACV8       ------------------------------------------------------------
OBG_PORG3       ------------------------------------------------------------
OBG_CYTH3       ------------------------------------------------------------
OBG_GRAFK       ------------------------------------------------------------
OBG_AZOPC       ------------------------------------------------------------
OBG_AMOA5       ------------------------------------------------------------
OBG_SULMW       ------------------------------------------------------------
OBG_CAMFF       ------------------------------------------------------------
OBG_CAMHC       ------------------------------------------------------------
OBG_ARCB4       ------------------------------------------------------------
OBG_NITSB       ------------------------------------------------------------
OBG_NAUPA       ------------------------------------------------------------
OBG_SULNB       ------------------------------------------------------------
OBG_WOLSU       ------------------------------------------------------------
OBG_SULDN       ------------------------------------------------------------
OBG_CAMLR       ------------------------------------------------------------
OBG_HELHP       ------------------------------------------------------------
OBG_HELAH       ------------------------------------------------------------
OBG_BORBZ       ------------------------------------------------------------
OBG_BORT9       ------------------------------------------------------------
OBG_TREPS       ------------------------------------------------------------
OBG_TREDE       ------------------------------------------------------------
OBG_LEPBP       ------------------------------------------------------------
OBG_LEPIC       ------------------------------------------------------------
                                                                            

OBG_SYNY3       ------------------------------------------------------------
OBG_SYNP2       ------------------------------------------------------------
OBG_TRIEI       ------------------------------------------------------------
OBG_ACAM1       ------------------------------------------------------------
OBG_SYNJA       ------------------------------------------------------------
OBG_GLOVI       ------------------------------------------------------------
OBG_PAUCH       ------------------------------------------------------------
OBG_PROMP       ------------------------------------------------------------
OBG_DEHM1       ------------------------------------------------------------
OBG_SALRD       ------------------------------------------------------------
OBG_PROA2       ------------------------------------------------------------
OBG_CHLT3       ------------------------------------------------------------
OBG_COPPD       ------------------------------------------------------------
OBG_DESPS       ------------------------------------------------------------
OBG_PHYAS       RFNYLLKKIGIEEALKQKGAKLG-DQVKICNYL------FDFVI----------------
OBG_PHYMT       KFAIFLKKIGVEEELIKKGVYFSKNKIKICDRV------FEFIT----------------
OBG_ACHLI       RFARQLRGLGIEDALREHGVVHG-DIVRIFSYE------FEYLE----------------
OBG_MYCAP       RFNTMLKKIGVWDDLLKYDIKPG-DTVRILDYE------FEWDGEF--------------
OBG_MYCS5       RFNNILKKIGVWEALIKRDIQKG-DLVEIYQHK------FEWEEEL--------------
OBG_MYCMO       RLNNKLKNLGVWEELIKYNVKNG-DYVKIGEFE------LEWNNEISTYK----------
OBG_MYCPU       RFNLILKKMGVWDELIKQGIQIG-DSVKIYDYE------FVWGNE---------------
OBG_MYCA5       RINNKLKKLGVFELIKKHNVPEG-ATIKIGNFE------FDWSDEE--------------
OBG_MYCH2       RFNAKVKKIGLWDELIKKGIKPG-DLVRIYEFE------FHWN-----------------
OBG_MESFL       LFNEKLKKSGVYDMLRERGVGAG-DIVKVFEYE------LEWMD----------------
OBG_MYCPN       RLGNKIKEVGIEDQLKVAGAKKG-DVIVFAGQE------FVIND----------------
OBG_MYCGA       RLGQKIKSLGVEDQLKKMGAKPN-DVIVICDYE------YLIDE----------------
OBG_MYCPE       RFMQKIKMDEIEQTLKDKGAKIG-DSFRIQDVM------FEIN-----------------
OBG_UREU1       RFNQKLQSINFNQQLLQAGAIAG-DSIKIYDIT------LEFEE----------------
OBG_ROSS1       RIQRVLEASGISAALQEAGIQNG-DTVYIEKAA------FEWEDGEITYLMPGVR-----
OBG_HERA2       RLQRVLEAMGVSAALFAAGVRHG-DPVRIEKAE------LLWQDESIG------------
OBG_THERP       RYQRLLARWGISRRLLALGIQPG-DIVHVAGRE------LVWEPELAEAEQTRPRRRLTK
OBG_BACSU       RFARQMRGMGVDEALRERGAKDG-DIIRL--LE------FEFEFID--------------
OBG_STACT       RFARQMRSMGIDDALRERGAKNG-DIVRI--LG------GEFEFVE--------------
OBG_EXIS2       RFARTLRQMGVDEELRKMGAIDG-DVVRI--RD------FEFEFIESSF-----------
OBG_ENTFA       RFARQLRGMGVDEALRARGAKDG-DIVRI--GN------FEFEFVE--------------
OBG_LACLA       KFARQMRAMGVDETLRSMGAKDG-DYVRI--QK------FEFEFVD--------------
OBG_BREBN       RFARQMRSMGVDDALRKLGAKDG-DTVRI--GK------LEFDFVE--------------
OBG_LACJO       LLARKLKRLGVDEALRENGAVTG-DDVSI--AD------FTFEFVD--------------
OBG_LACSS       RFARQLRSMGLDEALREKGAHDG-DLVAI--DN------FTFEFVE--------------
OBG_LACF3       RFARQLRHMGVDDALREAGIQDG-DLVRI--ED------FVFEFVQ--------------
OBG_PEDPA       RFARQMRGMGIDDELRRLGARNG-DSVQI--LD------FVFEFVE--------------
OBG_LEUMM       RFARQLRHMGVDDKLREAGAKDG-DDVRINNSD------FVFEFSE--------------
OBG_OENOB       RFARQLRSFGVDDKLREAGAKDG-DMVYIDGAD------FAFEFEE--------------
OBG_HELMI       RLQRIFDVMGVDQALRDAGCQHG-DPVRI--GD------LDFDFIEYAAQYAERDDDGEN
OBG_PELTS       RLQRIIRRMGIEEALKEAGIKDG-DTVRI--GD------YEFEYVE--------------
OBG_DESHY       RFQNILKAMGIERALLDEGIKVG-DKVRI--AG------IEFEWEE--------------
OBG_DESAP       HLQELLVRIGVEDALRAEGIRPG-DNVRI--GR------FEFEYSENPTG----------
OBG_MOOTA       RLQVYLKQKGVDDALRRAGAATG-AIIRI--GK------FEFEYVEEP------------
OBG_CARHZ       RLQRTFTRMGLEEQLKRAGVKPG-DLVRI--GK------FEFYFVDETEGLEEE------
OBG_DESRM       RLQRIMKMMGLENGLVEAGVKVG-DIVRI--GD------WEFEWSE--------------
OBG_SYNWW       RFQRTVIKMGLEEALKEHGIKEG-DSVRI--KD------FEFEFTE--------------
OBG_SYMTH       RFLRILRLKGVEQALREAGAEDG-DTVRV--CD------IEFELMADPV-----------
OBG_HALOH       RLLRVLQHHDLNELLRDKGVKNG-DTVKI--GP------MEFEYME--------------
OBG_NATTJ       YFQAKVDEFGLEEALVDKGIKPG-DTVKI--GN------VEFEYQ---------------
OBG_ALKOO       YFQKVLRNRGVIDRLKEAGISEG-DLVKM--YS------VEFEYFN--------------
OBG_CLOD6       YFQKAMESQGVFDRLREMGIEDG-DVVKI--YE------LEFEFYN--------------
OBG_RUMCH       YFQRALKKKGVITALEEMGIQEG-DTVRI--YD------TEFDYTR--------------
OBG_HUNT2       YFQRAIRRKGIVDALESMGINEG-DTVRM--YD------LEFEYFR--------------
OBG_LACP7       FFQKFLKENGILDQLEELGIGEG-DTVRM--YG------LEFDYYK--------------
OBG_CLOPS       YFHKVLNNKGIFHELREMGIEDG-DMVRL--ND------FEFEYLL--------------
OBG_CLOTE       YFYVVLKNKGVIDDLIKKGIKDG-DMVRL--ND------FEFEFVI--------------
OBG_CALS8       YFQNFLNKLGVFDKLREMGIQDG-DIVRI--LD------VEFEYYE--------------
OBG_CALS4       YFEILLRKSGVIDALKEKGFKSG-DVINV--RD------FEFEYYE--------------
OBG_FUSNN       TFLHMMRSLGMEEALQEFGVQDG-DTVKI--AD------VEFEYFE--------------
OBG_FINM2       HLQKVLEDKGVIQQLKDLGIQDG-DNVVI--GD------VEFDFYE--------------
OBG_ELUMP       RLRNIFKKIGLEKALIKKGVMPG-DIIVVGQKE------FEWSGTELDSERAEQPDFEGY
OBG_UNCTG       RYRNILKKMGLEIELKKMGARPG-DTVRIGDFE------FTFEK----------------
OBG_FRASN       YLADRLARLGVEKELAKRGAFPG-VAVTIGAVT------FDWEPTLSGREALLAAGGGDG
OBG_SACEN       FLADRLAKLGVEEALAKNGAKPG-SQVTIGSVT------FDWEPSTPAGVA---------
OBG_STRGG       YLADRLNRLGVEDSLMKAGARAG-DGVAIGPEE--NAVVFDWEPTVTAG-----------
OBG_KINRD       YLADRLARLGVEDELFKAGATPG-AEVVIGDDA--NAVVFDWEPTMHAG-----------
OBG_NOCSJ       FLADRLNRLGVETRLAEMGAEEG-DAVLIGDPE--NAVVFDFKPGVDAA-----------
OBG_SALTO       YLADRLARLGVEEKLGKAGAQAG-DLVRIGERE------FDWQPTLYT------------
OBG_ACIC1       YLADRLARLGVEDELARLGARPG-DEVIIGGVS------FDYEPGIRAG-----------
OBG_THEFY       YLADRLNRLGIEEALAEAGATAG-AEVHIGDED--NPVVFDWDPTVDSE-----------
OBG_RENSM       YLAERLNKLGVEDGLFKKGAKPG-DTVVIGEDGEN-AVVFDWEPTMMAGAE---------
OBG_KOCRD       YLADRFAKLGIEDELFRIGAKPG-NAVLIGPE-EN-GVVFDWEPTMVGGAE---------
OBG_LEIXX       YLAARLAKLGVEDQLVRVGAVAG-STVVIGRE--N-GVVFDWEPTLTSAAE---------
OBG_BIFA0       YLADRLAKLGVEDSLRKHGAHAG-DEVRIGRGE--RAVAFDWDPTIAAGAEMLD------
OBG_CUTAK       YLSDRLNRLGVEEELLAMGAIAG-DAVAVGGED---AVIFDFAPQIESGAE---------
OBG_CORDI       YLADRLARMGVEDALWKKGARAG-CTVTIGEVS------FEWEPTTAAGVE---------
OBG_CORU7       FLADRLAKAGVEEALWQAGAVDG-SEVTIGGIT------FEWDPQTVAGVD---------
OBG_TROWT       YLAERLDRLGIEDALVRAGATCG-DEVEIGGVI------FTWDPSVAN------------
OBG_DEIRA       YLGNLFKRQGLYNALRRAGAREG-DTVEIGTFR------FEYFDDEE-------------
OBG_THET8       YLQEVFRRQGVEAALRAKGVRAG-DLVRIGGLE------FEYIPEV--------------
OBG_RUBXD       HFQRELERRGVMGALRRAGAGEG-DEVRIGDVS------FEFR-----------------
OBG_AKKM8       ------------------------------------------------------------
OBG_METI4       ------------------------------------------------------------
OBG_OPITP       ------------------------------------------------------------
OBG_CHLPN       ------------------------------------------------------------
OBG_PARUW       ------------------------------------------------------------
OBG_RHOBA       EVQAQDIQ-GAATLSDTGKVVPGERRDRSS------------------------------
OBG_SULSY       ------------------------------------------------------------
OBG_AQUAE       ------------------------------------------------------------
OBG_THEYD       ------------------------------------------------------------
OBG_HYDS0       ------------------------------------------------------------
OBG_THEM4       KFMELLEKNGLDNKLREAGAKDG-DTVWIAGRA------FEFKE----------------
OBG_FERNB       DVLDILQKNGLDEKLKKAGAKDG-DTVWVEGVD------FIFKE----------------
OBG_THENN       LILQILEKNGLEEKLKEAGVKEG-DVVRIGNFE------FEYRE----------------
OBG_PSELT       RFLDTLERNGLSEKLKQMGAHDG-DTVWIGQYS------FEYKE----------------
OBG_PETMO       LILNTLEKNGLNKILRNAGVKEG-DTVYIGNFS------FEYIP----------------
OBG_DICTD       YFLNYAKRRGIIKLINRAKIKDD-EEIKIGNYV------FKYNSKNNSLELIE-------
OBG_ACIC5       ------------------------------------------------------------
OBG_PELCD       ------------------------------------------------------------
OBG_SYNAS       ------------------------------------------------------------
OBG_ANADF       ------------------------------------------------------------
OBG_MYXXD       KRAPARKSGGGRS-----------------------------------------------
OBG_SORC5       ------------------------------------------------------------
OBG_SOLUE       ------------------------------------------------------------
OBG_SYNFM       ------------------------------------------------------------
OBG_PELPD       ------------------------------------------------------------
OBG_DESAH       ------------------------------------------------------------
OBG_DESOH       ------------------------------------------------------------
OBG_DESAL       ------------------------------------------------------------
OBG_DESDA       ------------------------------------------------------------
OBG_LAWIP       ------------------------------------------------------------
OBG_BDEBA       ------------------------------------------------------------
OBG_BUCAP       ------------------------------------------------------------
OBG_BUCBP       ------------------------------------------------------------
OBG_BUCCC       ------------------------------------------------------------
OBG_WIGBR       ------------------------------------------------------------
OBG_PHOPR       ------------------------------------------------------------
OBG_PSYIN       ------------------------------------------------------------
OBG_PSEHT       ------------------------------------------------------------
OBG_COLP3       ------------------------------------------------------------
OBG_ECOLI       ------------------------------------------------------------
OBG_BAUCH       ------------------------------------------------------------
OBG_BLOPB       ------------------------------------------------------------
OBG_LEGPL       ------------------------------------------------------------
OBG_DICNV       ------------------------------------------------------------
OBG_ACIF5       ------------------------------------------------------------
OBG_METPP       ------------------------------------------------------------
OBG_JANMA       ------------------------------------------------------------
OBG_METFK       ------------------------------------------------------------
OBG_NITMU       ------------------------------------------------------------
OBG_DECAR       ------------------------------------------------------------
OBG_CHRVO       ------------------------------------------------------------
OBG_BORPD       ------------------------------------------------------------
OBG_ACIAD       ------------------------------------------------------------
OBG_PSYWF       ------------------------------------------------------------
OBG_ALCBS       ------------------------------------------------------------
OBG_CHRSD       ------------------------------------------------------------
OBG_HAHCH       ------------------------------------------------------------
OBG_SACD2       ------------------------------------------------------------
OBG_MARMS       ------------------------------------------------------------
OBG_PSEU2       ------------------------------------------------------------
OBG_COXB1       ------------------------------------------------------------
OBG_HYDCU       ------------------------------------------------------------
OBG_NITOC       ------------------------------------------------------------
OBG_THISH       ------------------------------------------------------------
OBG_METCA       ------------------------------------------------------------
OBG_ALKEH       ------------------------------------------------------------
OBG_HALHL       ------------------------------------------------------------
OBG_XYLFT       ------------------------------------------------------------
OBG_FRAP2       ------------------------------------------------------------
OBG_VESOH       ------------------------------------------------------------
OBG_CAUVN       ------------------------------------------------------------
OBG_HYPNA       ------------------------------------------------------------
OBG_METSB       ------------------------------------------------------------
OBG_OLICO       ------------------------------------------------------------
OBG_RHOCS       ------------------------------------------------------------
OBG_RHORT       ------------------------------------------------------------
OBG_GLUOX       ------------------------------------------------------------
OBG_RHOS5       ------------------------------------------------------------
OBG_SPHAL       ------------------------------------------------------------
OBG_ZYMMO       ------------------------------------------------------------
OBG_MAGMM       ------------------------------------------------------------
OBG1_ANAMM      ------------------------------------------------------------
OBG_ANAPZ       ------------------------------------------------------------
OBG_EHRRW       ------------------------------------------------------------
OBG_WOLTR       ------------------------------------------------------------
OBG_NEOSM       ------------------------------------------------------------
OBG_PELUB       ------------------------------------------------------------
OBG_ORITI       ------------------------------------------------------------
OBG_RICBR       ------------------------------------------------------------
OBG_BACV8       ------------------------------------------------------------
OBG_PORG3       ------------------------------------------------------------
OBG_CYTH3       ------------------------------------------------------------
OBG_GRAFK       ------------------------------------------------------------
OBG_AZOPC       ------------------------------------------------------------
OBG_AMOA5       ------------------------------------------------------------
OBG_SULMW       ------------------------------------------------------------
OBG_CAMFF       ------------------------------------------------------------
OBG_CAMHC       ------------------------------------------------------------
OBG_ARCB4       ------------------------------------------------------------
OBG_NITSB       ------------------------------------------------------------
OBG_NAUPA       ------------------------------------------------------------
OBG_SULNB       ------------------------------------------------------------
OBG_WOLSU       ------------------------------------------------------------
OBG_SULDN       ------------------------------------------------------------
OBG_CAMLR       ------------------------------------------------------------
OBG_HELHP       ------------------------------------------------------------
OBG_HELAH       ------------------------------------------------------------
OBG_BORBZ       ------------------------------------------------------------
OBG_BORT9       ------------------------------------------------------------
OBG_TREPS       ------------------------------------------------------------
OBG_TREDE       ------------------------------------------------------------
OBG_LEPBP       ------------------------------------------------------------
OBG_LEPIC       ------------------------------------------------------------
                                                                            

OBG_SYNY3       ------------------------------------------------------------
OBG_SYNP2       ------------------------------------------------------------
OBG_TRIEI       ------------------------------------------------------------
OBG_ACAM1       ------------------------------------------------------------
OBG_SYNJA       ------------------------------------------------------------
OBG_GLOVI       ------------------------------------------------------------
OBG_PAUCH       ------------------------------------------------------------
OBG_PROMP       ------------------------------------------------------------
OBG_DEHM1       ------------------------------------------------------------
OBG_SALRD       ------------------------------------------------------------
OBG_PROA2       ------------------------------------------------------------
OBG_CHLT3       ------------------------------------------------------------
OBG_COPPD       ------------------------------------------------------------
OBG_DESPS       ------------------------------------------------------------
OBG_PHYAS       ------------------------------------------------------------
OBG_PHYMT       ------------------------------------------------------------
OBG_ACHLI       ------------------------------------------------------------
OBG_MYCAP       ------------------------------------------------------------
OBG_MYCS5       ------------------------------------------------------------
OBG_MYCMO       ------------------------------------------------------------
OBG_MYCPU       ------------------------------------------------------------
OBG_MYCA5       ------------------------------------------------------------
OBG_MYCH2       ------------------------------------------------------------
OBG_MESFL       ------------------------------------------------------------
OBG_MYCPN       ------------------------------------------------------------
OBG_MYCGA       ------------------------------------------------------------
OBG_MYCPE       ------------------------------------------------------------
OBG_UREU1       ------------------------------------------------------------
OBG_ROSS1       ------------------------------------------------------------
OBG_HERA2       ------------------------------------------------------------
OBG_THERP       RERLLKRAGLLEEPEEEIGEQ---------------------------------------
OBG_BACSU       ------------------------------------------------------------
OBG_STACT       ------------------------------------------------------------
OBG_EXIS2       ------------------------------------------------------------
OBG_ENTFA       ------------------------------------------------------------
OBG_LACLA       ------------------------------------------------------------
OBG_BREBN       ------------------------------------------------------------
OBG_LACJO       ------------------------------------------------------------
OBG_LACSS       ------------------------------------------------------------
OBG_LACF3       ------------------------------------------------------------
OBG_PEDPA       ------------------------------------------------------------
OBG_LEUMM       ------------------------------------------------------------
OBG_OENOB       ------------------------------------------------------------
OBG_HELMI       G-----------------------------------------------------------
OBG_PELTS       ------------------------------------------------------------
OBG_DESHY       ------------------------------------------------------------
OBG_DESAP       ------------------------------------------------------------
OBG_MOOTA       ------------------------------------------------------------
OBG_CARHZ       ------------------------------------------------------------
OBG_DESRM       ------------------------------------------------------------
OBG_SYNWW       ------------------------------------------------------------
OBG_SYMTH       ------------------------------------------------------------
OBG_HALOH       ------------------------------------------------------------
OBG_NATTJ       ------------------------------------------------------------
OBG_ALKOO       ------------------------------------------------------------
OBG_CLOD6       ------------------------------------------------------------
OBG_RUMCH       ------------------------------------------------------------
OBG_HUNT2       ------------------------------------------------------------
OBG_LACP7       ------------------------------------------------------------
OBG_CLOPS       ------------------------------------------------------------
OBG_CLOTE       ------------------------------------------------------------
OBG_CALS8       ------------------------------------------------------------
OBG_CALS4       ------------------------------------------------------------
OBG_FUSNN       ------------------------------------------------------------
OBG_FINM2       ------------------------------------------------------------
OBG_ELUMP       KRRTTQAERLEKRRQRRLKKEEK-------------------------------------
OBG_UNCTG       ------------------------------------------------------------
OBG_FRASN       D-----GYGEAGYGAVDTAVTIATVGGSGGTRAGARGGAVVSDLPLG-PRGTDLRLRTS-
OBG_SACEN       -------------------------------------------GVLG-GRGTDLRLDQD-
OBG_STRGG       ------------------------------------------AEMLG-RRGEDHRLEE--
OBG_KINRD       ------------------------------------------AEVLG-QRGSDLRLEDH-
OBG_NOCSJ       ------------------------------------------AEILS-RRGEDQRFDE--
OBG_SALTO       ------------------------------------------EFVPG-VRGGDQRLAEKS
OBG_ACIC1       -----------------------------------------VGHPFG-PRGTDPRLHAAA
OBG_THEFY       ------------------------------------------QTVLG-PRGTDPRLS---
OBG_RENSM       --------------------------------------------LLSGPRGTDPRFTDLG
OBG_KOCRD       --------------------------------------------LLGGPRGSDLRLEET-
OBG_LEIXX       --------------------------------------------LISSPRGTDARIGVN-
OBG_BIFA0       ------------------------------------------GTQLG-SRGKDLRLEEED
OBG_CUTAK       --------------------------------------------LLS-RRGEDQRLKSER
OBG_CORDI       -------------------------------------------VQMS-GRGTDMRLERNT
OBG_CORU7       -------------------------------------------QTPAYGRGKDRRLEQTD
OBG_TROWT       ---------------------------------------------------TSFSLSV--
OBG_DEIRA       ------------------------------------------------------------
OBG_THET8       ------------------------------------------------------------
OBG_RUBXD       ------------------------------------------------------------
OBG_AKKM8       ------------------------------------------------------------
OBG_METI4       ------------------------------------------------------------
OBG_OPITP       ------------------------------------------------------------
OBG_CHLPN       ------------------------------------------------------------
OBG_PARUW       ------------------------------------------------------------
OBG_RHOBA       ------------------------------------------------------------
OBG_SULSY       ------------------------------------------------------------
OBG_AQUAE       ------------------------------------------------------------
OBG_THEYD       ------------------------------------------------------------
OBG_HYDS0       ------------------------------------------------------------
OBG_THEM4       ------------------------------------------------------------
OBG_FERNB       ------------------------------------------------------------
OBG_THENN       ------------------------------------------------------------
OBG_PSELT       ------------------------------------------------------------
OBG_PETMO       ------------------------------------------------------------
OBG_DICTD       ------------------------------------------------------------
OBG_ACIC5       ------------------------------------------------------------
OBG_PELCD       ------------------------------------------------------------
OBG_SYNAS       ------------------------------------------------------------
OBG_ANADF       ------------------------------------------------------------
OBG_MYXXD       ------------------------------------------------------------
OBG_SORC5       ------------------------------------------------------------
OBG_SOLUE       ------------------------------------------------------------
OBG_SYNFM       ------------------------------------------------------------
OBG_PELPD       ------------------------------------------------------------
OBG_DESAH       ------------------------------------------------------------
OBG_DESOH       ------------------------------------------------------------
OBG_DESAL       ------------------------------------------------------------
OBG_DESDA       ------------------------------------------------------------
OBG_LAWIP       ------------------------------------------------------------
OBG_BDEBA       ------------------------------------------------------------
OBG_BUCAP       ------------------------------------------------------------
OBG_BUCBP       ------------------------------------------------------------
OBG_BUCCC       ------------------------------------------------------------
OBG_WIGBR       ------------------------------------------------------------
OBG_PHOPR       ------------------------------------------------------------
OBG_PSYIN       ------------------------------------------------------------
OBG_PSEHT       ------------------------------------------------------------
OBG_COLP3       ------------------------------------------------------------
OBG_ECOLI       ------------------------------------------------------------
OBG_BAUCH       ------------------------------------------------------------
OBG_BLOPB       ------------------------------------------------------------
OBG_LEGPL       ------------------------------------------------------------
OBG_DICNV       ------------------------------------------------------------
OBG_ACIF5       ------------------------------------------------------------
OBG_METPP       ------------------------------------------------------------
OBG_JANMA       ------------------------------------------------------------
OBG_METFK       ------------------------------------------------------------
OBG_NITMU       ------------------------------------------------------------
OBG_DECAR       ------------------------------------------------------------
OBG_CHRVO       ------------------------------------------------------------
OBG_BORPD       ------------------------------------------------------------
OBG_ACIAD       ------------------------------------------------------------
OBG_PSYWF       ------------------------------------------------------------
OBG_ALCBS       ------------------------------------------------------------
OBG_CHRSD       ------------------------------------------------------------
OBG_HAHCH       ------------------------------------------------------------
OBG_SACD2       ------------------------------------------------------------
OBG_MARMS       ------------------------------------------------------------
OBG_PSEU2       ------------------------------------------------------------
OBG_COXB1       ------------------------------------------------------------
OBG_HYDCU       ------------------------------------------------------------
OBG_NITOC       ------------------------------------------------------------
OBG_THISH       ------------------------------------------------------------
OBG_METCA       ------------------------------------------------------------
OBG_ALKEH       ------------------------------------------------------------
OBG_HALHL       ------------------------------------------------------------
OBG_XYLFT       ------------------------------------------------------------
OBG_FRAP2       ------------------------------------------------------------
OBG_VESOH       ------------------------------------------------------------
OBG_CAUVN       ------------------------------------------------------------
OBG_HYPNA       ------------------------------------------------------------
OBG_METSB       ------------------------------------------------------------
OBG_OLICO       ------------------------------------------------------------
OBG_RHOCS       ------------------------------------------------------------
OBG_RHORT       ------------------------------------------------------------
OBG_GLUOX       ------------------------------------------------------------
OBG_RHOS5       ------------------------------------------------------------
OBG_SPHAL       ------------------------------------------------------------
OBG_ZYMMO       ------------------------------------------------------------
OBG_MAGMM       ------------------------------------------------------------
OBG1_ANAMM      ------------------------------------------------------------
OBG_ANAPZ       ------------------------------------------------------------
OBG_EHRRW       ------------------------------------------------------------
OBG_WOLTR       ------------------------------------------------------------
OBG_NEOSM       ------------------------------------------------------------
OBG_PELUB       ------------------------------------------------------------
OBG_ORITI       ------------------------------------------------------------
OBG_RICBR       ------------------------------------------------------------
OBG_BACV8       ------------------------------------------------------------
OBG_PORG3       ------------------------------------------------------------
OBG_CYTH3       ------------------------------------------------------------
OBG_GRAFK       ------------------------------------------------------------
OBG_AZOPC       ------------------------------------------------------------
OBG_AMOA5       ------------------------------------------------------------
OBG_SULMW       ------------------------------------------------------------
OBG_CAMFF       ------------------------------------------------------------
OBG_CAMHC       ------------------------------------------------------------
OBG_ARCB4       ------------------------------------------------------------
OBG_NITSB       ------------------------------------------------------------
OBG_NAUPA       ------------------------------------------------------------
OBG_SULNB       ------------------------------------------------------------
OBG_WOLSU       ------------------------------------------------------------
OBG_SULDN       ------------------------------------------------------------
OBG_CAMLR       ------------------------------------------------------------
OBG_HELHP       ------------------------------------------------------------
OBG_HELAH       ------------------------------------------------------------
OBG_BORBZ       ------------------------------------------------------------
OBG_BORT9       ------------------------------------------------------------
OBG_TREPS       ------------------------------------------------------------
OBG_TREDE       ------------------------------------------------------------
OBG_LEPBP       ------------------------------------------------------------
OBG_LEPIC       ------------------------------------------------------------
                                                                            

OBG_SYNY3       ------------------------------------------------------------
OBG_SYNP2       ------------------------------------------------------------
OBG_TRIEI       ------------------------------------------------------------
OBG_ACAM1       ------------------------------------------------------------
OBG_SYNJA       ------------------------------------------------------------
OBG_GLOVI       ------------------------------------------------------------
OBG_PAUCH       ------------------------------------------------------------
OBG_PROMP       ------------------------------------------------------------
OBG_DEHM1       ------------------------------------------------------------
OBG_SALRD       ------------------------------------------------------------
OBG_PROA2       ------------------------------------------------------------
OBG_CHLT3       ------------------------------------------------------------
OBG_COPPD       ------------------------------------------------------------
OBG_DESPS       ------------------------------------------------------------
OBG_PHYAS       ------------------------------------------------------------
OBG_PHYMT       ------------------------------------------------------------
OBG_ACHLI       ------------------------------------------------------------
OBG_MYCAP       ------------------------------------------------------------
OBG_MYCS5       ------------------------------------------------------------
OBG_MYCMO       ------------------------------------------------------------
OBG_MYCPU       ------------------------------------------------------------
OBG_MYCA5       ------------------------------------------------------------
OBG_MYCH2       ------------------------------------------------------------
OBG_MESFL       ------------------------------------------------------------
OBG_MYCPN       ------------------------------------------------------------
OBG_MYCGA       ------------------------------------------------------------
OBG_MYCPE       ------------------------------------------------------------
OBG_UREU1       ------------------------------------------------------------
OBG_ROSS1       ------------------------------------------------------------
OBG_HERA2       ------------------------------------------------------------
OBG_THERP       ------------------------------------------------------------
OBG_BACSU       ------------------------------------------------------------
OBG_STACT       ------------------------------------------------------------
OBG_EXIS2       ------------------------------------------------------------
OBG_ENTFA       ------------------------------------------------------------
OBG_LACLA       ------------------------------------------------------------
OBG_BREBN       ------------------------------------------------------------
OBG_LACJO       ------------------------------------------------------------
OBG_LACSS       ------------------------------------------------------------
OBG_LACF3       ------------------------------------------------------------
OBG_PEDPA       ------------------------------------------------------------
OBG_LEUMM       ------------------------------------------------------------
OBG_OENOB       ------------------------------------------------------------
OBG_HELMI       ------------------------------------------------------------
OBG_PELTS       ------------------------------------------------------------
OBG_DESHY       ------------------------------------------------------------
OBG_DESAP       ------------------------------------------------------------
OBG_MOOTA       ------------------------------------------------------------
OBG_CARHZ       ------------------------------------------------------------
OBG_DESRM       ------------------------------------------------------------
OBG_SYNWW       ------------------------------------------------------------
OBG_SYMTH       ------------------------------------------------------------
OBG_HALOH       ------------------------------------------------------------
OBG_NATTJ       ------------------------------------------------------------
OBG_ALKOO       ------------------------------------------------------------
OBG_CLOD6       ------------------------------------------------------------
OBG_RUMCH       ------------------------------------------------------------
OBG_HUNT2       ------------------------------------------------------------
OBG_LACP7       ------------------------------------------------------------
OBG_CLOPS       ------------------------------------------------------------
OBG_CLOTE       ------------------------------------------------------------
OBG_CALS8       ------------------------------------------------------------
OBG_CALS4       ------------------------------------------------------------
OBG_FUSNN       ------------------------------------------------------------
OBG_FINM2       ------------------------------------------------------------
OBG_ELUMP       ------------------------------------------------------------
OBG_UNCTG       ------------------------------------------------------------
OBG_FRASN       KRLTRA------------QRTAL------------SDSADDFDDGAGFSDSAAFGDSGGS
OBG_SACEN       ERVSAH-----------ERKAAK------------KARRTSLDEEGGYVGE---------
OBG_STRGG       PRPAA----QRR----RERDAER------------DDAEKEYDEFDPF------------
OBG_KINRD       SRPTR---DEKRLQE-RERRAAK------------VTARDELEAERRAGHWTAADEADEE
OBG_NOCSJ       SRPAA----RRRR-AIEEAMADR------------AEGETRADVARRLDRPAREDGGAYG
OBG_SALTO       ERPSA----TERL---AARKARR------------QRPEDEAEADEPVGDGEE-------
OBG_ACIC1       PPATA-------------HWAGD-----------GDDDSAARDEEDG-------------
OBG_THEFY       ------------------------------------------------------------
OBG_RENSM       DRPTR----SQKREEYQERRDAK------------SAARAELESERKAGIWTESVSARRD
OBG_KOCRD       SRPTR----REKREQFYDRMDAK------------SEARAELEQERRAGVWTESVDARDR
OBG_LEIXX       ARPTR----AQRREDYFDRMDAK------------AEARAELLREREAGLWKDDDAAVQG
OBG_BIFA0       GRKRRRT-NSERRREYHEMMDAR------------AAVRAAMQAERAAGHWADPSIDDDR
OBG_CUTAK       PSATRRR---EMDREYHRAREEY------------GQVGRDLRGESWRARVAEEEWFEGR
OBG_CORDI       RVSAQ------------ERKRAS-------------QVRRGLIDEYDFGDDQKVTRESAN
OBG_CORU7       RVTAE------------QRKRAS-------------QARRGLIDEYDYGDGE-----VAH
OBG_TROWT       ------------------------------------------------------------
OBG_DEIRA       ------------------------------------------------------------
OBG_THET8       ------------------------------------------------------------
OBG_RUBXD       ------------------------------------------------------------
OBG_AKKM8       ------------------------------------------------------------
OBG_METI4       ------------------------------------------------------------
OBG_OPITP       ------------------------------------------------------------
OBG_CHLPN       ------------------------------------------------------------
OBG_PARUW       ------------------------------------------------------------
OBG_RHOBA       ------------------------------------------------------------
OBG_SULSY       ------------------------------------------------------------
OBG_AQUAE       ------------------------------------------------------------
OBG_THEYD       ------------------------------------------------------------
OBG_HYDS0       ------------------------------------------------------------
OBG_THEM4       ------------------------------------------------------------
OBG_FERNB       ------------------------------------------------------------
OBG_THENN       ------------------------------------------------------------
OBG_PSELT       ------------------------------------------------------------
OBG_PETMO       ------------------------------------------------------------
OBG_DICTD       ------------------------------------------------------------
OBG_ACIC5       ------------------------------------------------------------
OBG_PELCD       ------------------------------------------------------------
OBG_SYNAS       ------------------------------------------------------------
OBG_ANADF       ------------------------------------------------------------
OBG_MYXXD       ------------------------------------------------------------
OBG_SORC5       ------------------------------------------------------------
OBG_SOLUE       ------------------------------------------------------------
OBG_SYNFM       ------------------------------------------------------------
OBG_PELPD       ------------------------------------------------------------
OBG_DESAH       ------------------------------------------------------------
OBG_DESOH       ------------------------------------------------------------
OBG_DESAL       ------------------------------------------------------------
OBG_DESDA       ------------------------------------------------------------
OBG_LAWIP       ------------------------------------------------------------
OBG_BDEBA       ------------------------------------------------------------
OBG_BUCAP       ------------------------------------------------------------
OBG_BUCBP       ------------------------------------------------------------
OBG_BUCCC       ------------------------------------------------------------
OBG_WIGBR       ------------------------------------------------------------
OBG_PHOPR       ------------------------------------------------------------
OBG_PSYIN       ------------------------------------------------------------
OBG_PSEHT       ------------------------------------------------------------
OBG_COLP3       ------------------------------------------------------------
OBG_ECOLI       ------------------------------------------------------------
OBG_BAUCH       ------------------------------------------------------------
OBG_BLOPB       ------------------------------------------------------------
OBG_LEGPL       ------------------------------------------------------------
OBG_DICNV       ------------------------------------------------------------
OBG_ACIF5       ------------------------------------------------------------
OBG_METPP       ------------------------------------------------------------
OBG_JANMA       ------------------------------------------------------------
OBG_METFK       ------------------------------------------------------------
OBG_NITMU       ------------------------------------------------------------
OBG_DECAR       ------------------------------------------------------------
OBG_CHRVO       ------------------------------------------------------------
OBG_BORPD       ------------------------------------------------------------
OBG_ACIAD       ------------------------------------------------------------
OBG_PSYWF       ------------------------------------------------------------
OBG_ALCBS       ------------------------------------------------------------
OBG_CHRSD       ------------------------------------------------------------
OBG_HAHCH       ------------------------------------------------------------
OBG_SACD2       ------------------------------------------------------------
OBG_MARMS       ------------------------------------------------------------
OBG_PSEU2       ------------------------------------------------------------
OBG_COXB1       ------------------------------------------------------------
OBG_HYDCU       ------------------------------------------------------------
OBG_NITOC       ------------------------------------------------------------
OBG_THISH       ------------------------------------------------------------
OBG_METCA       ------------------------------------------------------------
OBG_ALKEH       ------------------------------------------------------------
OBG_HALHL       ------------------------------------------------------------
OBG_XYLFT       ------------------------------------------------------------
OBG_FRAP2       ------------------------------------------------------------
OBG_VESOH       ------------------------------------------------------------
OBG_CAUVN       ------------------------------------------------------------
OBG_HYPNA       ------------------------------------------------------------
OBG_METSB       ------------------------------------------------------------
OBG_OLICO       ------------------------------------------------------------
OBG_RHOCS       ------------------------------------------------------------
OBG_RHORT       ------------------------------------------------------------
OBG_GLUOX       ------------------------------------------------------------
OBG_RHOS5       ------------------------------------------------------------
OBG_SPHAL       ------------------------------------------------------------
OBG_ZYMMO       ------------------------------------------------------------
OBG_MAGMM       ------------------------------------------------------------
OBG1_ANAMM      ------------------------------------------------------------
OBG_ANAPZ       ------------------------------------------------------------
OBG_EHRRW       ------------------------------------------------------------
OBG_WOLTR       ------------------------------------------------------------
OBG_NEOSM       ------------------------------------------------------------
OBG_PELUB       ------------------------------------------------------------
OBG_ORITI       ------------------------------------------------------------
OBG_RICBR       ------------------------------------------------------------
OBG_BACV8       ------------------------------------------------------------
OBG_PORG3       ------------------------------------------------------------
OBG_CYTH3       ------------------------------------------------------------
OBG_GRAFK       ------------------------------------------------------------
OBG_AZOPC       ------------------------------------------------------------
OBG_AMOA5       ------------------------------------------------------------
OBG_SULMW       ------------------------------------------------------------
OBG_CAMFF       ------------------------------------------------------------
OBG_CAMHC       ------------------------------------------------------------
OBG_ARCB4       ------------------------------------------------------------
OBG_NITSB       ------------------------------------------------------------
OBG_NAUPA       ------------------------------------------------------------
OBG_SULNB       ------------------------------------------------------------
OBG_WOLSU       ------------------------------------------------------------
OBG_SULDN       ------------------------------------------------------------
OBG_CAMLR       ------------------------------------------------------------
OBG_HELHP       ------------------------------------------------------------
OBG_HELAH       ------------------------------------------------------------
OBG_BORBZ       ------------------------------------------------------------
OBG_BORT9       ------------------------------------------------------------
OBG_TREPS       ------------------------------------------------------------
OBG_TREDE       ------------------------------------------------------------
OBG_LEPBP       ------------------------------------------------------------
OBG_LEPIC       ------------------------------------------------------------
                                                                            

OBG_SYNY3       ------------------------------------------------------------
OBG_SYNP2       ------------------------------------------------------------
OBG_TRIEI       ------------------------------------------------------------
OBG_ACAM1       ------------------------------------------------------------
OBG_SYNJA       ------------------------------------------------------------
OBG_GLOVI       ------------------------------------------------------------
OBG_PAUCH       ------------------------------------------------------------
OBG_PROMP       ------------------------------------------------------------
OBG_DEHM1       ------------------------------------------------------------
OBG_SALRD       ------------------------------------------------------------
OBG_PROA2       ------------------------------------------------------------
OBG_CHLT3       ------------------------------------------------------------
OBG_COPPD       ------------------------------------------------------------
OBG_DESPS       ------------------------------------------------------------
OBG_PHYAS       ------------------------------------------------------------
OBG_PHYMT       ------------------------------------------------------------
OBG_ACHLI       ------------------------------------------------------------
OBG_MYCAP       ------------------------------------------------------------
OBG_MYCS5       ------------------------------------------------------------
OBG_MYCMO       ------------------------------------------------------------
OBG_MYCPU       ------------------------------------------------------------
OBG_MYCA5       ------------------------------------------------------------
OBG_MYCH2       ------------------------------------------------------------
OBG_MESFL       ------------------------------------------------------------
OBG_MYCPN       ------------------------------------------------------------
OBG_MYCGA       ------------------------------------------------------------
OBG_MYCPE       ------------------------------------------------------------
OBG_UREU1       ------------------------------------------------------------
OBG_ROSS1       ------------------------------------------------------------
OBG_HERA2       ------------------------------------------------------------
OBG_THERP       ------------------------------------------------------------
OBG_BACSU       ------------------------------------------------------------
OBG_STACT       ------------------------------------------------------------
OBG_EXIS2       ------------------------------------------------------------
OBG_ENTFA       ------------------------------------------------------------
OBG_LACLA       ------------------------------------------------------------
OBG_BREBN       ------------------------------------------------------------
OBG_LACJO       ------------------------------------------------------------
OBG_LACSS       ------------------------------------------------------------
OBG_LACF3       ------------------------------------------------------------
OBG_PEDPA       ------------------------------------------------------------
OBG_LEUMM       ------------------------------------------------------------
OBG_OENOB       ------------------------------------------------------------
OBG_HELMI       ------------------------------------------------------------
OBG_PELTS       ------------------------------------------------------------
OBG_DESHY       ------------------------------------------------------------
OBG_DESAP       ------------------------------------------------------------
OBG_MOOTA       ------------------------------------------------------------
OBG_CARHZ       ------------------------------------------------------------
OBG_DESRM       ------------------------------------------------------------
OBG_SYNWW       ------------------------------------------------------------
OBG_SYMTH       ------------------------------------------------------------
OBG_HALOH       ------------------------------------------------------------
OBG_NATTJ       ------------------------------------------------------------
OBG_ALKOO       ------------------------------------------------------------
OBG_CLOD6       ------------------------------------------------------------
OBG_RUMCH       ------------------------------------------------------------
OBG_HUNT2       ------------------------------------------------------------
OBG_LACP7       ------------------------------------------------------------
OBG_CLOPS       ------------------------------------------------------------
OBG_CLOTE       ------------------------------------------------------------
OBG_CALS8       ------------------------------------------------------------
OBG_CALS4       ------------------------------------------------------------
OBG_FUSNN       ------------------------------------------------------------
OBG_FINM2       ------------------------------------------------------------
OBG_ELUMP       ------------------------------------------------------------
OBG_UNCTG       ------------------------------------------------------------
OBG_FRASN       GGDADGGRG---------------------------------------------------
OBG_SACEN       ------------------------------------------------------------
OBG_STRGG       ------------------------------------------------------------
OBG_KINRD       LSQR--------------------------------------------------------
OBG_NOCSJ       PQSYEIGGRDDPDWAEEDLGE---------------------------------------
OBG_SALTO       ------------------------------------------------------------
OBG_ACIC1       ------------------------------------------------------------
OBG_THEFY       ------------------------------------------------------------
OBG_RENSM       REAH------ESREAASTDDGDAL------------------------------------
OBG_KOCRD       RRTS------ETKETNEK------------------------------------------
OBG_LEIXX       GSEE------TGRE----------------------------------------------
OBG_BIFA0       HDEQSLFGRGEVEEYEDEPGADGSRQLD--------------------------------
OBG_CUTAK       D-----------------------------------------------------------
OBG_CORDI       RDRWQG------------------------------------------------------
OBG_CORU7       TERWQG------------------------------------------------------
OBG_TROWT       ------------------------------------------------------------
OBG_DEIRA       ------------------------------------------------------------
OBG_THET8       ------------------------------------------------------------
OBG_RUBXD       ------------------------------------------------------------
OBG_AKKM8       ------------------------------------------------------------
OBG_METI4       ------------------------------------------------------------
OBG_OPITP       ------------------------------------------------------------
OBG_CHLPN       ------------------------------------------------------------
OBG_PARUW       ------------------------------------------------------------
OBG_RHOBA       ------------------------------------------------------------
OBG_SULSY       ------------------------------------------------------------
OBG_AQUAE       ------------------------------------------------------------
OBG_THEYD       ------------------------------------------------------------
OBG_HYDS0       ------------------------------------------------------------
OBG_THEM4       ------------------------------------------------------------
OBG_FERNB       ------------------------------------------------------------
OBG_THENN       ------------------------------------------------------------
OBG_PSELT       ------------------------------------------------------------
OBG_PETMO       ------------------------------------------------------------
OBG_DICTD       ------------------------------------------------------------
OBG_ACIC5       ------------------------------------------------------------
OBG_PELCD       ------------------------------------------------------------
OBG_SYNAS       ------------------------------------------------------------
OBG_ANADF       ------------------------------------------------------------
OBG_MYXXD       ------------------------------------------------------------
OBG_SORC5       ------------------------------------------------------------
OBG_SOLUE       ------------------------------------------------------------
OBG_SYNFM       ------------------------------------------------------------
OBG_PELPD       ------------------------------------------------------------
OBG_DESAH       ------------------------------------------------------------
OBG_DESOH       ------------------------------------------------------------
OBG_DESAL       ------------------------------------------------------------
OBG_DESDA       ------------------------------------------------------------
OBG_LAWIP       ------------------------------------------------------------
OBG_BDEBA       ------------------------------------------------------------
OBG_BUCAP       ------------------------------------------------------------
OBG_BUCBP       ------------------------------------------------------------
OBG_BUCCC       ------------------------------------------------------------
OBG_WIGBR       ------------------------------------------------------------
OBG_PHOPR       ------------------------------------------------------------
OBG_PSYIN       ------------------------------------------------------------
OBG_PSEHT       ------------------------------------------------------------
OBG_COLP3       ------------------------------------------------------------
OBG_ECOLI       ------------------------------------------------------------
OBG_BAUCH       ------------------------------------------------------------
OBG_BLOPB       ------------------------------------------------------------
OBG_LEGPL       ------------------------------------------------------------
OBG_DICNV       ------------------------------------------------------------
OBG_ACIF5       ------------------------------------------------------------
OBG_METPP       ------------------------------------------------------------
OBG_JANMA       ------------------------------------------------------------
OBG_METFK       ------------------------------------------------------------
OBG_NITMU       ------------------------------------------------------------
OBG_DECAR       ------------------------------------------------------------
OBG_CHRVO       ------------------------------------------------------------
OBG_BORPD       ------------------------------------------------------------
OBG_ACIAD       ------------------------------------------------------------
OBG_PSYWF       ------------------------------------------------------------
OBG_ALCBS       ------------------------------------------------------------
OBG_CHRSD       ------------------------------------------------------------
OBG_HAHCH       ------------------------------------------------------------
OBG_SACD2       ------------------------------------------------------------
OBG_MARMS       ------------------------------------------------------------
OBG_PSEU2       ------------------------------------------------------------
OBG_COXB1       ------------------------------------------------------------
OBG_HYDCU       ------------------------------------------------------------
OBG_NITOC       ------------------------------------------------------------
OBG_THISH       ------------------------------------------------------------
OBG_METCA       ------------------------------------------------------------
OBG_ALKEH       ------------------------------------------------------------
OBG_HALHL       ------------------------------------------------------------
OBG_XYLFT       ------------------------------------------------------------
OBG_FRAP2       ------------------------------------------------------------
OBG_VESOH       ------------------------------------------------------------
OBG_CAUVN       ------------------------------------------------------------
OBG_HYPNA       ------------------------------------------------------------
OBG_METSB       ------------------------------------------------------------
OBG_OLICO       ------------------------------------------------------------
OBG_RHOCS       ------------------------------------------------------------
OBG_RHORT       ------------------------------------------------------------
OBG_GLUOX       ------------------------------------------------------------
OBG_RHOS5       ------------------------------------------------------------
OBG_SPHAL       ------------------------------------------------------------
OBG_ZYMMO       ------------------------------------------------------------
OBG_MAGMM       ------------------------------------------------------------
OBG1_ANAMM      ------------------------------------------------------------
OBG_ANAPZ       ------------------------------------------------------------
OBG_EHRRW       ------------------------------------------------------------
OBG_WOLTR       ------------------------------------------------------------
OBG_NEOSM       ------------------------------------------------------------
OBG_PELUB       ------------------------------------------------------------
OBG_ORITI       ------------------------------------------------------------
OBG_RICBR       ------------------------------------------------------------
OBG_BACV8       ------------------------------------------------------------
OBG_PORG3       ------------------------------------------------------------
OBG_CYTH3       ------------------------------------------------------------
OBG_GRAFK       ------------------------------------------------------------
OBG_AZOPC       ------------------------------------------------------------
OBG_AMOA5       ------------------------------------------------------------
OBG_SULMW       ------------------------------------------------------------
OBG_CAMFF       ------------------------------------------------------------
OBG_CAMHC       ------------------------------------------------------------
OBG_ARCB4       ------------------------------------------------------------
OBG_NITSB       ------------------------------------------------------------
OBG_NAUPA       ------------------------------------------------------------
OBG_SULNB       ------------------------------------------------------------
OBG_WOLSU       ------------------------------------------------------------
OBG_SULDN       ------------------------------------------------------------
OBG_CAMLR       ------------------------------------------------------------
OBG_HELHP       ------------------------------------------------------------
OBG_HELAH       ------------------------------------------------------------
OBG_BORBZ       ------------------------------------------------------------
OBG_BORT9       ------------------------------------------------------------
OBG_TREPS       ------------------------------------------------------------
OBG_TREDE       ------------------------------------------------------------
OBG_LEPBP       ------------------------------------------------------------
OBG_LEPIC       ------------------------------------------------------------
                                                                            

OBG_SYNY3       ------------------------------------------------------------
OBG_SYNP2       ------------------------------------------------------------
OBG_TRIEI       ------------------------------------------------------------
OBG_ACAM1       ------------------------------------------------------------
OBG_SYNJA       ------------------------------------------------------------
OBG_GLOVI       ------------------------------------------------------------
OBG_PAUCH       ------------------------------------------------------------
OBG_PROMP       ------------------------------------------------------------
OBG_DEHM1       ------------------------------------------------------------
OBG_SALRD       ------------------------------------------------------------
OBG_PROA2       ------------------------------------------------------------
OBG_CHLT3       ------------------------------------------------------------
OBG_COPPD       ------------------------------------------------------------
OBG_DESPS       ------------------------------------------------------------
OBG_PHYAS       ------------------------------------------------------------
OBG_PHYMT       ------------------------------------------------------------
OBG_ACHLI       ------------------------------------------------------------
OBG_MYCAP       ------------------------------------------------------------
OBG_MYCS5       ------------------------------------------------------------
OBG_MYCMO       ------------------------------------------------------------
OBG_MYCPU       ------------------------------------------------------------
OBG_MYCA5       ------------------------------------------------------------
OBG_MYCH2       ------------------------------------------------------------
OBG_MESFL       ------------------------------------------------------------
OBG_MYCPN       ------------------------------------------------------------
OBG_MYCGA       ------------------------------------------------------------
OBG_MYCPE       ------------------------------------------------------------
OBG_UREU1       ------------------------------------------------------------
OBG_ROSS1       ------------------------------------------------------------
OBG_HERA2       ------------------------------------------------------------
OBG_THERP       ------------------------------------------------------------
OBG_BACSU       ------------------------------------------------------------
OBG_STACT       ------------------------------------------------------------
OBG_EXIS2       ------------------------------------------------------------
OBG_ENTFA       ------------------------------------------------------------
OBG_LACLA       ------------------------------------------------------------
OBG_BREBN       ------------------------------------------------------------
OBG_LACJO       ------------------------------------------------------------
OBG_LACSS       ------------------------------------------------------------
OBG_LACF3       ------------------------------------------------------------
OBG_PEDPA       ------------------------------------------------------------
OBG_LEUMM       ------------------------------------------------------------
OBG_OENOB       ------------------------------------------------------------
OBG_HELMI       ------------------------------------------------------------
OBG_PELTS       ------------------------------------------------------------
OBG_DESHY       ------------------------------------------------------------
OBG_DESAP       ------------------------------------------------------------
OBG_MOOTA       ------------------------------------------------------------
OBG_CARHZ       ------------------------------------------------------------
OBG_DESRM       ------------------------------------------------------------
OBG_SYNWW       ------------------------------------------------------------
OBG_SYMTH       ------------------------------------------------------------
OBG_HALOH       ------------------------------------------------------------
OBG_NATTJ       ------------------------------------------------------------
OBG_ALKOO       ------------------------------------------------------------
OBG_CLOD6       ------------------------------------------------------------
OBG_RUMCH       ------------------------------------------------------------
OBG_HUNT2       ------------------------------------------------------------
OBG_LACP7       ------------------------------------------------------------
OBG_CLOPS       ------------------------------------------------------------
OBG_CLOTE       ------------------------------------------------------------
OBG_CALS8       ------------------------------------------------------------
OBG_CALS4       ------------------------------------------------------------
OBG_FUSNN       ------------------------------------------------------------
OBG_FINM2       ------------------------------------------------------------
OBG_ELUMP       ------------------------------------------------------------
OBG_UNCTG       ------------------------------------------------------------
OBG_FRASN       ------------------------------------------------------------
OBG_SACEN       ------------------------------------------------------------
OBG_STRGG       ------------------------------------------------------------
OBG_KINRD       ------------------------------------------------------------
OBG_NOCSJ       ------------------------------------------------------------
OBG_SALTO       ------------------------------------------------------------
OBG_ACIC1       ------------------------------------------------------------
OBG_THEFY       ------------------------------------------------------------
OBG_RENSM       ------------------------------------------------------------
OBG_KOCRD       ------------------------------------------------------------
OBG_LEIXX       ------------------------------------------------------------
OBG_BIFA0       ------------------------------------------------------------
OBG_CUTAK       ------------------------------------------------------------
OBG_CORDI       ------------------------------------------------------------
OBG_CORU7       ------------------------------------------------------------
OBG_TROWT       ------------------------------------------------------------
OBG_DEIRA       ------------------------------------------------------------
OBG_THET8       ------------------------------------------------------------
OBG_RUBXD       ------------------------------------------------------------
OBG_AKKM8       ------------------------------------------------------------
OBG_METI4       ------------------------------------------------------------
OBG_OPITP       ------------------------------------------------------------
OBG_CHLPN       ------------------------------------------------------------
OBG_PARUW       ------------------------------------------------------------
OBG_RHOBA       ------------------------------------------------------------
OBG_SULSY       ------------------------------------------------------------
OBG_AQUAE       ------------------------------------------------------------
OBG_THEYD       ------------------------------------------------------------
OBG_HYDS0       ------------------------------------------------------------
OBG_THEM4       ------------------------------------------------------------
OBG_FERNB       ------------------------------------------------------------
OBG_THENN       ------------------------------------------------------------
OBG_PSELT       ------------------------------------------------------------
OBG_PETMO       ------------------------------------------------------------
OBG_DICTD       ------------------------------------------------------------
OBG_ACIC5       ------------------------------------------------------------
OBG_PELCD       ------------------------------------------------------------
OBG_SYNAS       ------------------------------------------------------------
OBG_ANADF       ------------------------------------------------------------
OBG_MYXXD       ------------------------------------------------------------
OBG_SORC5       ------------------------------------------------------------
OBG_SOLUE       ------------------------------------------------------------
OBG_SYNFM       ------------------------------------------------------------
OBG_PELPD       ------------------------------------------------------------
OBG_DESAH       ------------------------------------------------------------
OBG_DESOH       ------------------------------------------------------------
OBG_DESAL       ------------------------------------------------------------
OBG_DESDA       ------------------------------------------------------------
OBG_LAWIP       ------------------------------------------------------------
OBG_BDEBA       ------------------------------------------------------------
OBG_BUCAP       ------------------------------------------------------------
OBG_BUCBP       ------------------------------------------------------------
OBG_BUCCC       ------------------------------------------------------------
OBG_WIGBR       ------------------------------------------------------------
OBG_PHOPR       ------------------------------------------------------------
OBG_PSYIN       ------------------------------------------------------------
OBG_PSEHT       ------------------------------------------------------------
OBG_COLP3       ------------------------------------------------------------
OBG_ECOLI       ------------------------------------------------------------
OBG_BAUCH       ------------------------------------------------------------
OBG_BLOPB       ------------------------------------------------------------
OBG_LEGPL       ------------------------------------------------------------
OBG_DICNV       ------------------------------------------------------------
OBG_ACIF5       ------------------------------------------------------------
OBG_METPP       ------------------------------------------------------------
OBG_JANMA       ------------------------------------------------------------
OBG_METFK       ------------------------------------------------------------
OBG_NITMU       ------------------------------------------------------------
OBG_DECAR       ------------------------------------------------------------
OBG_CHRVO       ------------------------------------------------------------
OBG_BORPD       ------------------------------------------------------------
OBG_ACIAD       ------------------------------------------------------------
OBG_PSYWF       ------------------------------------------------------------
OBG_ALCBS       ------------------------------------------------------------
OBG_CHRSD       ------------------------------------------------------------
OBG_HAHCH       ------------------------------------------------------------
OBG_SACD2       ------------------------------------------------------------
OBG_MARMS       ------------------------------------------------------------
OBG_PSEU2       ------------------------------------------------------------
OBG_COXB1       ------------------------------------------------------------
OBG_HYDCU       ------------------------------------------------------------
OBG_NITOC       ------------------------------------------------------------
OBG_THISH       ------------------------------------------------------------
OBG_METCA       ------------------------------------------------------------
OBG_ALKEH       ------------------------------------------------------------
OBG_HALHL       ------------------------------------------------------------
OBG_XYLFT       ------------------------------------------------------------
OBG_FRAP2       ------------------------------------------------------------
OBG_VESOH       ------------------------------------------------------------
OBG_CAUVN       ------------------------------------------------------------
OBG_HYPNA       ------------------------------------------------------------
OBG_METSB       ------------------------------------------------------------
OBG_OLICO       ------------------------------------------------------------
OBG_RHOCS       ------------------------------------------------------------
OBG_RHORT       ------------------------------------------------------------
OBG_GLUOX       ------------------------------------------------------------
OBG_RHOS5       ------------------------------------------------------------
OBG_SPHAL       ------------------------------------------------------------
OBG_ZYMMO       ------------------------------------------------------------
OBG_MAGMM       ------------------------------------------------------------
OBG1_ANAMM      ------------------------------------------------------------
OBG_ANAPZ       ------------------------------------------------------------
OBG_EHRRW       ------------------------------------------------------------
OBG_WOLTR       ------------------------------------------------------------
OBG_NEOSM       ------------------------------------------------------------
OBG_PELUB       ------------------------------------------------------------
OBG_ORITI       ------------------------------------------------------------
OBG_RICBR       ------------------------------------------------------------
OBG_BACV8       ------------------------------------------------------------
OBG_PORG3       ------------------------------------------------------------
OBG_CYTH3       ------------------------------------------------------------
OBG_GRAFK       ------------------------------------------------------------
OBG_AZOPC       ------------------------------------------------------------
OBG_AMOA5       ------------------------------------------------------------
OBG_SULMW       ------------------------------------------------------------
OBG_CAMFF       ------------------------------------------------------------
OBG_CAMHC       ------------------------------------------------------------
OBG_ARCB4       ------------------------------------------------------------
OBG_NITSB       ------------------------------------------------------------
OBG_NAUPA       ------------------------------------------------------------
OBG_SULNB       ------------------------------------------------------------
OBG_WOLSU       ------------------------------------------------------------
OBG_SULDN       ------------------------------------------------------------
OBG_CAMLR       ------------------------------------------------------------
OBG_HELHP       ------------------------------------------------------------
OBG_HELAH       ------------------------------------------------------------
OBG_BORBZ       ------------------------------------------------------------
OBG_BORT9       ------------------------------------------------------------
OBG_TREPS       ------------------------------------------------------------
OBG_TREDE       ------------------------------------------------------------
OBG_LEPBP       ------------------------------------------------------------
OBG_LEPIC       ------------------------------------------------------------
                                                                            

OBG_SYNY3       ---------------------------------
OBG_SYNP2       ---------------------------------
OBG_TRIEI       ---------------------------------
OBG_ACAM1       ---------------------------------
OBG_SYNJA       ---------------------------------
OBG_GLOVI       ---------------------------------
OBG_PAUCH       ---------------------------------
OBG_PROMP       ---------------------------------
OBG_DEHM1       ---------------------------------
OBG_SALRD       ---------------------------------
OBG_PROA2       ---------------------------------
OBG_CHLT3       ---------------------------------
OBG_COPPD       ---------------------------------
OBG_DESPS       ---------------------------------
OBG_PHYAS       ---------------------------------
OBG_PHYMT       ---------------------------------
OBG_ACHLI       ---------------------------------
OBG_MYCAP       ---------------------------------
OBG_MYCS5       ---------------------------------
OBG_MYCMO       ---------------------------------
OBG_MYCPU       ---------------------------------
OBG_MYCA5       ---------------------------------
OBG_MYCH2       ---------------------------------
OBG_MESFL       ---------------------------------
OBG_MYCPN       ---------------------------------
OBG_MYCGA       ---------------------------------
OBG_MYCPE       ---------------------------------
OBG_UREU1       ---------------------------------
OBG_ROSS1       ---------------------------------
OBG_HERA2       ---------------------------------
OBG_THERP       ---------------------------------
OBG_BACSU       ---------------------------------
OBG_STACT       ---------------------------------
OBG_EXIS2       ---------------------------------
OBG_ENTFA       ---------------------------------
OBG_LACLA       ---------------------------------
OBG_BREBN       ---------------------------------
OBG_LACJO       ---------------------------------
OBG_LACSS       ---------------------------------
OBG_LACF3       ---------------------------------
OBG_PEDPA       ---------------------------------
OBG_LEUMM       ---------------------------------
OBG_OENOB       ---------------------------------
OBG_HELMI       ---------------------------------
OBG_PELTS       ---------------------------------
OBG_DESHY       ---------------------------------
OBG_DESAP       ---------------------------------
OBG_MOOTA       ---------------------------------
OBG_CARHZ       ---------------------------------
OBG_DESRM       ---------------------------------
OBG_SYNWW       ---------------------------------
OBG_SYMTH       ---------------------------------
OBG_HALOH       ---------------------------------
OBG_NATTJ       ---------------------------------
OBG_ALKOO       ---------------------------------
OBG_CLOD6       ---------------------------------
OBG_RUMCH       ---------------------------------
OBG_HUNT2       ---------------------------------
OBG_LACP7       ---------------------------------
OBG_CLOPS       ---------------------------------
OBG_CLOTE       ---------------------------------
OBG_CALS8       ---------------------------------
OBG_CALS4       ---------------------------------
OBG_FUSNN       ---------------------------------
OBG_FINM2       ---------------------------------
OBG_ELUMP       ---------------------------------
OBG_UNCTG       ---------------------------------
OBG_FRASN       ---------------------------------
OBG_SACEN       ---------------------------------
OBG_STRGG       ---------------------------------
OBG_KINRD       ---------------------------------
OBG_NOCSJ       ---------------------------------
OBG_SALTO       ---------------------------------
OBG_ACIC1       ---------------------------------
OBG_THEFY       ---------------------------------
OBG_RENSM       ---------------------------------
OBG_KOCRD       ---------------------------------
OBG_LEIXX       ---------------------------------
OBG_BIFA0       ---------------------------------
OBG_CUTAK       ---------------------------------
OBG_CORDI       ---------------------------------
OBG_CORU7       ---------------------------------
OBG_TROWT       ---------------------------------
OBG_DEIRA       ---------------------------------
OBG_THET8       ---------------------------------
OBG_RUBXD       ---------------------------------
OBG_AKKM8       ---------------------------------
OBG_METI4       ---------------------------------
OBG_OPITP       ---------------------------------
OBG_CHLPN       ---------------------------------
OBG_PARUW       ---------------------------------
OBG_RHOBA       ---------------------------------
OBG_SULSY       ---------------------------------
OBG_AQUAE       ---------------------------------
OBG_THEYD       ---------------------------------
OBG_HYDS0       ---------------------------------
OBG_THEM4       ---------------------------------
OBG_FERNB       ---------------------------------
OBG_THENN       ---------------------------------
OBG_PSELT       ---------------------------------
OBG_PETMO       ---------------------------------
OBG_DICTD       ---------------------------------
OBG_ACIC5       ---------------------------------
OBG_PELCD       ---------------------------------
OBG_SYNAS       ---------------------------------
OBG_ANADF       ---------------------------------
OBG_MYXXD       ---------------------------------
OBG_SORC5       ---------------------------------
OBG_SOLUE       ---------------------------------
OBG_SYNFM       ---------------------------------
OBG_PELPD       ---------------------------------
OBG_DESAH       ---------------------------------
OBG_DESOH       ---------------------------------
OBG_DESAL       ---------------------------------
OBG_DESDA       ---------------------------------
OBG_LAWIP       ---------------------------------
OBG_BDEBA       ---------------------------------
OBG_BUCAP       ---------------------------------
OBG_BUCBP       ---------------------------------
OBG_BUCCC       ---------------------------------
OBG_WIGBR       ---------------------------------
OBG_PHOPR       ---------------------------------
OBG_PSYIN       ---------------------------------
OBG_PSEHT       ---------------------------------
OBG_COLP3       ---------------------------------
OBG_ECOLI       ---------------------------------
OBG_BAUCH       ---------------------------------
OBG_BLOPB       ---------------------------------
OBG_LEGPL       ---------------------------------
OBG_DICNV       ---------------------------------
OBG_ACIF5       ---------------------------------
OBG_METPP       ---------------------------------
OBG_JANMA       ---------------------------------
OBG_METFK       ---------------------------------
OBG_NITMU       ---------------------------------
OBG_DECAR       ---------------------------------
OBG_CHRVO       ---------------------------------
OBG_BORPD       ---------------------------------
OBG_ACIAD       ---------------------------------
OBG_PSYWF       ---------------------------------
OBG_ALCBS       ---------------------------------
OBG_CHRSD       ---------------------------------
OBG_HAHCH       ---------------------------------
OBG_SACD2       ---------------------------------
OBG_MARMS       ---------------------------------
OBG_PSEU2       ---------------------------------
OBG_COXB1       ---------------------------------
OBG_HYDCU       ---------------------------------
OBG_NITOC       ---------------------------------
OBG_THISH       ---------------------------------
OBG_METCA       ---------------------------------
OBG_ALKEH       ---------------------------------
OBG_HALHL       ---------------------------------
OBG_XYLFT       ---------------------------------
OBG_FRAP2       ---------------------------------
OBG_VESOH       ---------------------------------
OBG_CAUVN       ---------------------------------
OBG_HYPNA       ---------------------------------
OBG_METSB       ---------------------------------
OBG_OLICO       ---------------------------------
OBG_RHOCS       ---------------------------------
OBG_RHORT       ---------------------------------
OBG_GLUOX       ---------------------------------
OBG_RHOS5       ---------------------------------
OBG_SPHAL       ---------------------------------
OBG_ZYMMO       ---------------------------------
OBG_MAGMM       ---------------------------------
OBG1_ANAMM      ---------------------------------
OBG_ANAPZ       ---------------------------------
OBG_EHRRW       ---------------------------------
OBG_WOLTR       ---------------------------------
OBG_NEOSM       ---------------------------------
OBG_PELUB       ---------------------------------
OBG_ORITI       ---------------------------------
OBG_RICBR       ---------------------------------
OBG_BACV8       ---------------------------------
OBG_PORG3       ---------------------------------
OBG_CYTH3       ---------------------------------
OBG_GRAFK       ---------------------------------
OBG_AZOPC       ---------------------------------
OBG_AMOA5       ---------------------------------
OBG_SULMW       ---------------------------------
OBG_CAMFF       ---------------------------------
OBG_CAMHC       ---------------------------------
OBG_ARCB4       ---------------------------------
OBG_NITSB       ---------------------------------
OBG_NAUPA       ---------------------------------
OBG_SULNB       ---------------------------------
OBG_WOLSU       ---------------------------------
OBG_SULDN       ---------------------------------
OBG_CAMLR       ---------------------------------
OBG_HELHP       ---------------------------------
OBG_HELAH       ---------------------------------
OBG_BORBZ       ---------------------------------
OBG_BORT9       ---------------------------------
OBG_TREPS       ---------------------------------
OBG_TREDE       ---------------------------------
OBG_LEPBP       ---------------------------------
OBG_LEPIC       ---------------------------------