CLUSTAL format seed alignment for MF_01458

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

FTSH_MYCGE       ------------------------------------------------------------
FTSH_MYCPN       ------------------------------------------------------------
FTSH_MYCGH       ------------------------------------------------------------
FTSH_MYCPE       -------------------------------------------------MEFNKLELLII
FTSH_UREP2       ------------------------------------------------------------
FTSH_MESFL       ------------------------------------------------------------
FTSH_MYCPU       ------------------------------------------------------------
FTSH_MYCS5       ------------------------------------------------------------
FTSH_MYCMO       ------------------------------------------------------------
FTSH_MYCA5       ------------------------------------------------------------
FTSH_MYCCR       ------------------------------------------------------------
FTSH_AYWBP       ------------------------------------------------------------
FTSH2_PHYMT      ------------------------------------------------------------
FTSH3_PHYMT      ------------------------------------------------------------
FTSH1_PHYMT      ------------------------------------------------------------
FTSH_ACHLI       ------------------------------------------------------------
FTSH2_THEPX      ------------------------------------------------------------
FTSH_AQUAE       ------------------------------------------------------------
FTSH_HYDS0       ------------------------------------------------------------
FTSH_ECOLI       ------------------------------------------------------------
FTSH_SHIFL       ------------------------------------------------------------
FTSH_ECO57       ------------------------------------------------------------
FTSH_SALTI       ------------------------------------------------------------
FTSH_SALTY       ------------------------------------------------------------
FTSH_BUCAI       ------------------------------------------------------------
FTSH_BUCAP       ------------------------------------------------------------
FTSH_BUCBP       ------------------------------------------------------------
FTSH_PHOPR       ------------------------------------------------------------
FTSH_HAEIN       ------------------------------------------------------------
FTSH_MAGMM       ------------------------------------------------------------
FTSH_CUPMC       ------------------------------------------------------------
FTSH_RICCN       ------------------------------------------------------------
FTSH_RICFE       ------------------------------------------------------------
FTSH_RICPR       ------------------------------------------------------------
FTSH_RICTY       ------------------------------------------------------------
FTSH_RICBR       ------------------------------------------------------------
FTSH_NEORI       ------------------------------------------------------------
FTSH_BARBK       ------------------------------------------------------------
FTSH_CAUVN       ------------------------------------------------------------
FTSH_ZYMMN       ------------------------------------------------------------
FTSH_HALO1       ------------------------------------------------------------
FTSH_MYXXD       ------------------------------------------------------------
FTSH4_SORC5      ------------------------------------------------------------
FTSH1_BDEBA      ------------------------------------------------------------
FTSH_ACIC5       ------------------------------------------------------------
FTSH_AKKM8       -----------------------------------MPPSPPRPPKFPGSGRPESPNWGVW
FTSH2_METI4      ------------------------------------------------------------
FTSH_LEPBJ       ------------------------------------------------------------
FTSH_BORBZ       ------------------------------------------------------------
FTSH_PELPB       ------------------------------------------------------------
FTSH_UNCTG       ------------------------------------------------------------
FTSH_SYNAS       ------------------------------------------------------------
FTSH_THET1       ------------------------------------------------------------
FTSH3_CONWI      ------------------------------------------------------------
FTSH_MARHV       ------------------------------------------------------------
FTSH_NITOC       ------------------------------------------------------------
FTSH_HAHCH       ------------------------------------------------------------
FTSH4_SPHTD      ------------------------------------------------------------
FTSH2_THERP      ------------------------------------------------------------
FTSH_PELCD       ------------------------------------------------------------
FTSH_PELPD       ------------------------------------------------------------
FTSH1_RHOBA      ------------------------------------------------------------
FTSH2_SALRM      ------------------------------------------------------------
FTSH_BACPE       ------------------------------------------------------------
FTSH_BACSU       ------------------------------------------------------------
FTSH_STAHJ       ------------------------------------------------------------
FTSH_STRPN       ------------------------------------------------------------
FTSH_STRR6       ------------------------------------------------------------
FTSH_LACPL       ------------------------------------------------------------
FTSH_LACPJ       ------------------------------------------------------------
FTSH_LEUMM       ------------------------------------------------------------
FTSH_OENOE       ------------------------------------------------------------
FTSH_LACLA       ------------------------------------------------------------
FTSH2_ALKMQ      ------------------------------------------------------------
FTSH1_THEPX      ------------------------------------------------------------
FTSH_CALBD       ------------------------------------------------------------
FTSH_RUMCH       ------------------------------------------------------------
FTSH_CLONN       ------------------------------------------------------------
FTSH_VEIPT       ------------------------------------------------------------
FTSH_HALOH       ------------------------------------------------------------
FTSH_NATTJ       ------------------------------------------------------------
FTSH3_SYMTH      ------------------------------------------------------------
FTSH_MYCTU       ------------------------------------------------------------
FTSH_MYCTA       ------------------------------------------------------------
FTSH_MYCBO       ------------------------------------------------------------
FTSH_MYCLE       ------------------------------------------------------------
FTSH_RHOE4       ------------------------------------------------------------
FTSH_CORGL       ------------------------------------------------------------
FTSH_ROTMD       ------------------------------------------------------------
FTSH_TROWT       ------------------------------------------------------------
FTSH_BRAFD       ------------------------------------------------------------
FTSH_CUTAS       ------------------------------------------------------------
FTSH1_CONWI      ------------------------------------------------------------
FTSH_RUBXD       ------------------------------------------------------------
FTSH_SLAHD       MSETPNTNEQNNPNNQQDGTGQNPMPPMPTGKPQMPERPERHNQADGAPKRPGDDDRKSE
FTSH_PORPU       ------------------------------------------------------------
FTSH_PYRYE       ------------------------------------------------------------
FTSH_GUITH       ------------------------------------------------------------
FTSH2_SYNY3      ------------------------------------------------------------
FTSH_NOSS1       ------------------------------------------------------------
FTSH1_SYNY3      ------------------------------------------------------------
FTSH_TRIEI       ------------------------------------------------------------
FTSH_CYACA       ------------------------------------------------------------
FTSH_CYAM1       ------------------------------------------------------------
FTSH_TRICV       ------------------------------------------------------------
FTSH_VAULI       ------------------------------------------------------------
FTSH_HETA2       ------------------------------------------------------------
FTSH_ECTSI       ------------------------------------------------------------
FTSH3_SYNY3      ------------------------------------------------------------
FTSH_SYNJB       ------------------------------------------------------------
FTSH1_SPHTD      ------------------------------------------------------------
FTSH1_THERP      ------------------------------------------------------------
FTSH_CHLAD       ------------------------------------------------------------
FTSH_PSELT       ------------------------------------------------------------
FTSH_THEMA       ------------------------------------------------------------
FTSH_KOSOT       ------------------------------------------------------------
FTSH2_PETMO      ------------------------------------------------------------
FTSH3_PETMO      ------------------------------------------------------------
FTSH1_PETMO      ------------------------------------------------------------
FTSH_HELPY       ------------------------------------------------------------
FTSH_HELPJ       ------------------------------------------------------------
FTSH_HELFC       ------------------------------------------------------------
FTSH_SULNB       ------------------------------------------------------------
FTSH_ATOPD       ------------------------------------------------------------
FTSH_CLOP1       ------------------------------------------------------------
FTSH_TREPA       ------------------------------------------------------------
FTSH_PARD8       ------------------------------------------------------------
FTSH_SULMD       ------------------------------------------------------------
FTSH_RHOM4       ------------------------------------------------------------
FTSH1_SALRM      ------------------------------------------------------------
FTSH_PELLD       ------------------------------------------------------------
FTSH4_SYNY3      ------------------------------------------------------------
FTSH_ACAM1       ------------------------------------------------------------
FTSH_ANAD2       ------------------------------------------------------------
FTSH2_SORC5      ------------------------------------------------------------
FTSH_PARP8       ------------------------------------------------------------
FTSH_PSEP1       ------------------------------------------------------------
FTSH2_BDEBA      ------------------------------------------------------------
FTSH_METPP       ------------------------------------------------------------
FTSH_RALPJ       ----------------------------------------------------MEKPRRLR
FTSH_SYNFM       ----------------------------------------------------MARKSDED
FTSH_BURP1       ------------------------------------------------------------
FTSH_PIRSD       ----------------------------------------------------MSSDNGSG
FTSH2_RHOBA      ----------------------------------------------------MSNEPKSK
FTSH_METCA       ------------------------------------------------------------
FTSH1_METI4      ------------------------------------------------------------
FTSH_ACIFD       ------------------------------------------------------------
FTSH_ACIC1       ------------------------------------------------------------
FTSH1_SORC5      ------------------------------------------------------------
FTSH1_SYMTH      ------------------------------------------------------------
FTSH_OPITP       ------------------------------------------------------------
FTSH3_SORC5      ------------------------------------------------------------
FTSH2_SYMTH      ------------------------------------------------------------
FTSH2_SPHTD      ------------------------------------------------------------
FTSH3_SPHTD      ------------------------------------------------------------
FTSH2_CONWI      ------------------------------------------------------------
FTSH_THET8       ------------------------------------------------------------
FTSH_LEPBD       ------------------------------------------------------------
FTSH_STRM9       ------------------------------------------------------------
FTSH1_ALKMQ      ------------------------------------------------------------
FTSH_LACP7       ------------------------------------------------------------
                                                                             

FTSH_MYCGE       --------------------------MKKRNKGLVEQTTT------------EKN-NFSR
FTSH_MYCPN       --------------------------MKK-NKGLNEATTS------------EKP-QFPK
FTSH_MYCGH       --------------------------MSNTSNFNERVTEN------------AKPPKNVK
FTSH_MYCPE       RALKLNTNSNKKNSFYNKFLNLRNKVLNIQKNSLDQPSDAPSNNKKRNLDQPDNPNQKEP
FTSH_UREP2       ------------MYFLKKIVNLFSSKIESEDNNVKKDDLTQPR---------KQSPEARK
FTSH_MESFL       -------------------------------------------------------MKTKK
FTSH_MYCPU       ----------------------------------------------------MDKMKKPK
FTSH_MYCS5       ----------------------------------------------------MKQNIKRN
FTSH_MYCMO       --------------------------------------MSELDNKKDKSKDSNKKPKKPG
FTSH_MYCA5       --------------------------------------------MQDQNNSNTPKKKKLS
FTSH_MYCCR       ----------------------------------------------------MKQRMKKP
FTSH_AYWBP       -------------------------------------------------------MSFFD
FTSH2_PHYMT      ------------------------------------------------------MKKNIK
FTSH3_PHYMT      ------------------------------------------------------MKYKKK
FTSH1_PHYMT      ------------------------------------------------------MKTHYF
FTSH_ACHLI       ----------------------------------------------------MNKQQKPK
FTSH2_THEPX      ------------------------------------------------------------
FTSH_AQUAE       -----------------------------------------------------------M
FTSH_HYDS0       -----------------------------------------------------------M
FTSH_ECOLI       ------------------------------------------------------------
FTSH_SHIFL       ------------------------------------------------------------
FTSH_ECO57       ------------------------------------------------------------
FTSH_SALTI       ------------------------------------------------------------
FTSH_SALTY       ------------------------------------------------------------
FTSH_BUCAI       ------------------------------------------------------------
FTSH_BUCAP       ------------------------------------------------------------
FTSH_BUCBP       ------------------------------------------------------------
FTSH_PHOPR       ----------------------------------------MWLQVTNCSTLHSSLSYCGA
FTSH_HAEIN       ------------------------------------------------------------
FTSH_MAGMM       ------------------------------------------------------------
FTSH_CUPMC       ---------------------------------------------MQCSYPLARQLERSS
FTSH_RICCN       ------------------------------------------------------------
FTSH_RICFE       ------------------------------------------------------------
FTSH_RICPR       ------------------------------------------------------------
FTSH_RICTY       ------------------------------------------------------------
FTSH_RICBR       ------------------------------------------------------------
FTSH_NEORI       ------------------------------------------------------------
FTSH_BARBK       ------------------------------------------------------------
FTSH_CAUVN       ------------------------------------------------------------
FTSH_ZYMMN       -----------------------------------------MKGLIYYMAMNDNNKTPQD
FTSH_HALO1       ------------------------------------------------------------
FTSH_MYXXD       ------------------------------------------------------------
FTSH4_SORC5      ------------------------------------------------------------
FTSH1_BDEBA      ------------------------------------------------------------
FTSH_ACIC5       ------------------------------------------------------------
FTSH_AKKM8       VMVLLIVGVLAFGFFTPESFGLGPRKENLESFEAQYKAGRVVLNDPKAPVEVVLSENGSE
FTSH2_METI4      ------------------------------------------------------------
FTSH_LEPBJ       ------------------------------------------------------------
FTSH_BORBZ       ------------------------------MNGN--NNMNNNGKSN--------------
FTSH_PELPB       ------------------------------MSENPVKRPGKDGSRNKFKPVQEEGGTPGW
FTSH_UNCTG       ------------------------------------------------------------
FTSH_SYNAS       -----------------------------MDSNVDSQRVPDGQIFFRPVHPGISGKDMES
FTSH_THET1       -----------------------------MTNNQTD----------RPRPPGPESRRFDN
FTSH3_CONWI      -----------------------------MTGDPPERR-SNGDRLPAERPPSNEGQTPPR
FTSH_MARHV       ---------------------------------------------MTPSNEPGKQDQIPQ
FTSH_NITOC       ---------------------------------------------MD--NE--KQASPPP
FTSH_HAHCH       -----------------------------------------------------MSNTDPQ
FTSH4_SPHTD      -------------------------------------------MREPTNRQGSPGPGEPR
FTSH2_THERP      ----------MRGSWLFRSCLVRRSDGYPIERVQSKRIGRGCSKRLARRIEGSSMDERNR
FTSH_PELCD       ------------------------------------------------------------
FTSH_PELPD       ------------------------------------------------------------
FTSH1_RHOBA      ---------------------------------------------MKKDSESNSSDKSNK
FTSH2_SALRM      ------------------------------------------MADQTSQNDNQNGSGLPG
FTSH_BACPE       ------------------------------------------------------------
FTSH_BACSU       ------------------------------------------------------------
FTSH_STAHJ       ------------------------------------------------------------
FTSH_STRPN       ------------------------------------------------------MKKQN-
FTSH_STRR6       ------------------------------------------------------MKKQN-
FTSH_LACPL       ------------------------------------------------------MNNRR-
FTSH_LACPJ       ------------------------------------------------------MNNRR-
FTSH_LEUMM       ------------------------------------------------------MNNNK-
FTSH_OENOE       ------------------------------------------------------MKNKN-
FTSH_LACLA       ------------------------------------------------------MNNNKQ
FTSH2_ALKMQ      ------------------------------------------------------------
FTSH1_THEPX      -----------------------------------------------------------M
FTSH_CALBD       ------------------------------------------------------------
FTSH_RUMCH       ------------------------------------------------------------
FTSH_CLONN       --------------------------------------------------------MGGI
FTSH_VEIPT       ------------------------------------------------------------
FTSH_HALOH       ------------------------------------------------------------
FTSH_NATTJ       ------------------------------------------------------------
FTSH3_SYMTH      ------------------------------------------------------------
FTSH_MYCTU       ------------------------------------------------------------
FTSH_MYCTA       ------------------------------------------------------------
FTSH_MYCBO       ------------------------------------------------------------
FTSH_MYCLE       ------------------------------------------------------------
FTSH_RHOE4       ------------------------------------------------------------
FTSH_CORGL       ------------------------------------------------------------
FTSH_ROTMD       -------------------------MGVPAGMPHPNGLQPQRKDKALAQNPNTPQKGSEA
FTSH_TROWT       ------------------------------------------------------------
FTSH_BRAFD       ----------------------------------------------MADSAKTPRGK---
FTSH_CUTAS       -----------------------------------------------------------M
FTSH1_CONWI      ------------------------------------------------------------
FTSH_RUBXD       ------------------------------------MIVFATILFGALSAEDPDVEKLDS
FTSH_SLAHD       RPTWLSEFSDKEEDFASRLNTRPPQRASIITIIIIFLVAFFIGSQMMNMVHGEETDDLTT
FTSH_PORPU       ------------------------------------------------------------
FTSH_PYRYE       ------------------------------------------------------------
FTSH_GUITH       ------------------------------------------------------------
FTSH2_SYNY3      ------------------------------------------------------------
FTSH_NOSS1       --------------------------------------MAIFARRIGLNQHSAYGSRQRV
FTSH1_SYNY3      ------------------------------------MSHRPRSDRHSFSSPSRFWHRLGM
FTSH_TRIEI       -----------------------------------MKNFGQQIKTDELKGINHHNWSLCQ
FTSH_CYACA       ------------------------------------------------------------
FTSH_CYAM1       ------------------------------------------------------------
FTSH_TRICV       --------------------------------------------------MNDNKNN---
FTSH_VAULI       --------------------------------------------------MKSWSVN---
FTSH_HETA2       --------------------------------------------------MNKKETNTSW
FTSH_ECTSI       --------------------------------------------------MKNQTTK---
FTSH3_SYNY3      -----------------------------------------------------MSKN--N
FTSH_SYNJB       -----------------------------------------------------MSQKGKN
FTSH1_SPHTD      -----------------------------------------------------MAEN---
FTSH1_THERP      -----------------------------------------------------MSDN---
FTSH_CHLAD       -----------------------------------------------------MGDN---
FTSH_PSELT       ---------------------------------------MNG------------------
FTSH_THEMA       ---------------------------------------MN-------------------
FTSH_KOSOT       ---------------------------------------MD-------------------
FTSH2_PETMO      ---------------------------------------MNNNPNRR-------------
FTSH3_PETMO      ---------------------------------------MQNKRNQ--------------
FTSH1_PETMO      ---------------------------------------MPENKNDKENKNDKENKNTKE
FTSH_HELPY       -----------------------------------------------MKPTNEP--KKPF
FTSH_HELPJ       -----------------------------------------------MKPTNEP--KKPF
FTSH_HELFC       -------------------------------------------MDNNHKGPNDPNSKKPL
FTSH_SULNB       -----------------------------------------MANPNNNNDNKQNNNNNFF
FTSH_ATOPD       --------------------------------------------------------MANN
FTSH_CLOP1       ------------------------------------------------------------
FTSH_TREPA       ------------------------------------------------------------
FTSH_PARD8       -----------------------------------------------MENKNDMFNKTPK
FTSH_SULMD       ------------------------------------------------------MDKQSK
FTSH_RHOM4       -------------------------------------------MSQNERDSLELERKN--
FTSH1_SALRM      -------------------------------------------MCFCIVSSPEAMHSNAD
FTSH_PELLD       -------------------------------------------MAKNSLKPSNPYNSEPE
FTSH4_SYNY3      --------------------------------------------------MAIKPQPQWQ
FTSH_ACAM1       --------------------------------------------------MPIETEPNRT
FTSH_ANAD2       --------------------------------------MSADEKKGHGQRSERGRGPGGP
FTSH2_SORC5      ------------------------------------------------------------
FTSH_PARP8       -----------------------------------------------------------M
FTSH_PSEP1       -----------------------------------------------------------M
FTSH2_BDEBA      ------------------------------------------------------------
FTSH_METPP       -----------------------------------------------------------M
FTSH_RALPJ       PRARPQCRGLMKVNLGDFQASILGTHTNARLSGAYPGRPPTFPALETRLTFNKVDLEKNP
FTSH_SYNFM       TNPMDKFMDRLRGSPGD----------------GGPGRP-------------------DP
FTSH_BURP1       ------------------------------------------------------------
FTSH_PIRSD       RQGGDRGGSTGYNLLMYLGFGAIIATLVALYVLQMFQTSLDYTDLERLVAASQY--EKD-
FTSH2_RHOBA      RGGSSENRGGGNVWLVLLAVTG--AVVLSAFLFSDNRRRLAYPHLKELLAMSAE--RQEM
FTSH_METCA       --------------------------MAKHSQHSSPPRKLFDTLNDLWQRAKSEAGLSAE
FTSH1_METI4      ---------------------------------------------MKLSPPKKNLPPQKN
FTSH_ACIFD       -----------------------------------------------MMPSSQRPSPRGS
FTSH_ACIC1       ---------------------------------------------MSREVTSGLPQDKPT
FTSH1_SORC5      ------------------------------------------------------------
FTSH1_SYMTH      ------------------------------------------------------------
FTSH_OPITP       -----------------------------------------------------------M
FTSH3_SORC5      ------------------------------------------------------------
FTSH2_SYMTH      ------------------------------------------------------------
FTSH2_SPHTD      ------------------------------------------------------MNKYRR
FTSH3_SPHTD      ------------------------------------------------------------
FTSH2_CONWI      --MTDEPQSDEQQTTEQERPLGTKRATRADGLRRPGVRSGLAERRSPAADSVRNGAAAVR
FTSH_THET8       ------------------------------------------------------------
FTSH_LEPBD       ---------------------------------MADR---------DKNDIRKRLEELRK
FTSH_STRM9       ---------------------------------MEDKNIKDDEILDDQNDNQEDVQNQDE
FTSH1_ALKMQ      ---------------------------------------------------------MLK
FTSH_LACP7       ------------------------------------------------------------
                                                                             

FTSH_MYCGE       KTAWKVFWWV--------------------------------------------------
FTSH_MYCPN       RTAWKIFWWV--------------------------------------------------
FTSH_MYCGH       SIIWKTIGII--------------------------------------------------
FTSH_MYCPE       GKARKIIWSF--------------------------------------------------
FTSH_UREP2       RRNRRIIFWL--------------------------------------------------
FTSH_MESFL       SKSTLWFWLI--------------------------------------------------
FTSH_MYCPU       INWLLIVIVG--------------------------------------------------
FTSH_MYCS5       WIWILIVMI---------------------------------------------------
FTSH_MYCMO       AFSIGNIIIF--------------------------------------------------
FTSH_MYCA5       FWGIIGIVAS--------------------------------------------------
FTSH_MYCCR       SLGTFILILI--------------------------------------------------
FTSH_AYWBP       KIFKKFHMGV--------------------------------------------------
FTSH2_PHYMT      DIFKNFNIFW--------------------------------------------------
FTSH3_PHYMT      NILFITTIIV--------------------------------------------------
FTSH1_PHYMT      KKIFNLKFLV--------------------------------------------------
FTSH_ACHLI       RSPLRPDYLV--------------------------------------------------
FTSH2_THEPX      -MKKNLHIII--------------------------------------------------
FTSH_AQUAE       NALKNFFIWA--------------------------------------------------
FTSH_HYDS0       QTAKNILIWF--------------------------------------------------
FTSH_ECOLI       -----MAK---------------------------------------------NLILWLV
FTSH_SHIFL       -----MAK---------------------------------------------NLILWLV
FTSH_ECO57       -----MAK---------------------------------------------NLILWLV
FTSH_SALTI       -----MAK---------------------------------------------NLILWLV
FTSH_SALTY       -----MAK---------------------------------------------NLILWLV
FTSH_BUCAI       -----MVK---------------------------------------------NLIFWLV
FTSH_BUCAP       -----MVK---------------------------------------------NLIFWLV
FTSH_BUCBP       -----MAK---------------------------------------------NLMLWLV
FTSH_PHOPR       NTLSDMAK---------------------------------------------NLILWLV
FTSH_HAEIN       -----MVK---------------------------------------------NLVLWVV
FTSH_MAGMM       --MNGFFK---------------------------------------------NLSLWLV
FTSH_CUPMC       ALNNNLFQ---------------------------------------------KAAIWLV
FTSH_RICCN       --MNNQGR---------------------------------------------SILAWAT
FTSH_RICFE       --MNNQGR---------------------------------------------SILTWAA
FTSH_RICPR       --MNNQGR---------------------------------------------SILAWAA
FTSH_RICTY       --MNNQGR---------------------------------------------SILAWAA
FTSH_RICBR       --MNNQGK---------------------------------------------NIIVWAV
FTSH_NEORI       --MKKLLE---------------------------------------------NLSLWMG
FTSH_BARBK       --MNSNFR---------------------------------------------SLMIWGL
FTSH_CAUVN       ----MNFR---------------------------------------------NLAIWLV
FTSH_ZYMMN       PQANNWMK---------------------------------------------TLLIGGG
FTSH_HALO1       --MKQSHK---------------------------------------------TILLWAL
FTSH_MYXXD       --MRSTYK---------------------------------------------TIGLWVI
FTSH4_SORC5      --MKQSHK---------------------------------------------TLLLWVL
FTSH1_BDEBA      --MRSTQK---------------------------------------------TLALWFF
FTSH_ACIC5       --MNSTVK---------------------------------------------TIVFWVF
FTSH_AKKM8       GVIHALVY---------------------------------------------RKEIQPK
FTSH2_METI4      ------------------------------------------------------------
FTSH_LEPBJ       --MNKNLK---------------------------------------------NVFFVLI
FTSH_BORBZ       --NKKKNK---------------------------------------------NWILGLV
FTSH_PELPB       FRSKGESP---------------------------------------------QGKFPGF
FTSH_UNCTG       --MKKSNP---------------------------------------------WFVFFWI
FTSH_SYNAS       GTSDGQQRKMMEFEISEEADMRLTRQQTQNRTGFASADTKQGSPEGADRKKMPPGKAWLW
FTSH_THET1       NDKNNR-----------------------------------------NRWGPIPSWAWIV
FTSH3_CONWI      KPGRNEPGSPPDWRVTPAPDGRGTPRRGRNG--------------GGMRPFRFPGGRWGI
FTSH_MARHV       PGPTIPNQ----------------------------------------------YSFLWL
FTSH_NITOC       AAPPLNWR----------------------------------------------YLLWII
FTSH_HAHCH       PPQKLPLN----------------------------------------------WVVWTL
FTSH4_SPHTD      PPAQGRPR-------------------------------------------FPTWILWVA
FTSH2_THERP      TPREQRERSTNPFGKALR-----------------------------GIFGSRFGLLWII
FTSH_PELCD       MTRSLLWQ-----------------------------------------------MVIVL
FTSH_PELPD       -MNQSFWR-----------------------------------------------PLFAI
FTSH1_RHOBA      EELSTGRR---------------------------------------------GGNPMII
FTSH2_SALRM      GGPSGTGR--------------------------------------------GRLIIWVI
FTSH_BACPE       --MNRIFRNT---------------------------------------------IFYLL
FTSH_BACSU       --MNRVFRNT---------------------------------------------IFYLL
FTSH_STAHJ       --MQKAFRNV---------------------------------------------LVIAI
FTSH_STRPN       ---NGLIKNP---------------------------------------------FLWLL
FTSH_STRR6       ---NGLIKNP---------------------------------------------FLWLL
FTSH_LACPL       ---NGLFRNS---------------------------------------------LFYIL
FTSH_LACPJ       ---NGLFRNS---------------------------------------------LFYIL
FTSH_LEUMM       ---GGFLRSS---------------------------------------------VFYIF
FTSH_OENOE       ---RGFFRSS---------------------------------------------LSYAF
FTSH_LACLA       PKQGNFVKNI---------------------------------------------LMWVI
FTSH2_ALKMQ      --MRKFFRGA---------------------------------------------SFYIL
FTSH1_THEPX      NDNNKIIRSM---------------------------------------------VLYLL
FTSH_CALBD       --MRNLFKTA---------------------------------------------TIYIL
FTSH_RUMCH       ---MKYFKGI---------------------------------------------SFYII
FTSH_CLONN       NVKKRLSSAT---------------------------------------------IWIVL
FTSH_VEIPT       --MGRFTKNI---------------------------------------------VLYLL
FTSH_HALOH       --MNNFMKNI---------------------------------------------GFYLV
FTSH_NATTJ       --MNRFTRQA---------------------------------------------VLYLL
FTSH3_SYMTH      --MNKLFRSL---------------------------------------------AFYML
FTSH_MYCTU       -MNRKNVTRT---------------------------------------------ITAIA
FTSH_MYCTA       -MNRKNVTRT---------------------------------------------ITAIA
FTSH_MYCBO       -MNRKNVTRT---------------------------------------------ITAIA
FTSH_MYCLE       -MNRKNVIRM---------------------------------------------VTAIA
FTSH_RHOE4       -MNRKTVFRN---------------------------------------------VLLVA
FTSH_CORGL       -MKNKKYLQF---------------------------------------------GGIAA
FTSH_ROTMD       FLKKLIHSSW---------------------------------------------FFPGA
FTSH_TROWT       --MSKITKSP---------------------------------------------VLYIV
FTSH_BRAFD       --KRRPFTGL---------------------------------------------ALWII
FTSH_CUTAS       KNASRIFKGP---------------------------------------------LIWIL
FTSH1_CONWI      --MSRFFKSA---------------------------------------------AFPIL
FTSH_RUBXD       QEFQRAVEER---------------------------------------------AFALG
FTSH_SLAHD       SEFVQAVEQG---------------------------------------------RVENV
FTSH_PORPU       --MKLSWKTL---------------------------------------------LLWSL
FTSH_PYRYE       --MKLSWKTL---------------------------------------------LLWSL
FTSH_GUITH       --MKISWKNI---------------------------------------------LLTLI
FTSH2_SYNY3      --MKFSWRTA---------------------------------------------LLWSL
FTSH_NOSS1       IVMKNFGKKA---------------------------------------------LIKQQ
FTSH1_SYNY3      GLLVAGTLAL---------------------------------------------PVSTL
FTSH_TRIEI       AQSNTQKAKI---------------------------------------------LFGRI
FTSH_CYACA       --MKKQWKKI---------------------------------------------VLFVL
FTSH_CYAM1       --MKNLWIWS---------------------------------------------LPLIV
FTSH_TRICV       -TVRNLLIGI---------------------------------------------ALLSG
FTSH_VAULI       -KII-MLISL---------------------------------------------FLLEV
FTSH_HETA2       WRIILISLGI---------------------------------------------SIICI
FTSH_ECTSI       -NIILVFVGL---------------------------------------------ALLSG
FTSH3_SYNY3      KKWRNAGLYA---------------------------------------------LLLIV
FTSH_SYNJB       KKWRSAGLYA---------------------------------------------LLAIV
FTSH1_SPHTD      KWLRNGFVWI---------------------------------------------VLIIA
FTSH1_THERP      KWLRNGFVWM---------------------------------------------ILIIA
FTSH_CHLAD       RWLKNSFVYL---------------------------------------------IILVA
FTSH_PSELT       --NRPNYISL---------------------------------------------IFAAL
FTSH_THEMA       ---RSNIWNL---------------------------------------------LFTIL
FTSH_KOSOT       --QRPKFGMI---------------------------------------------LFYIV
FTSH2_PETMO      ----GSLIGP---------------------------------------------LFIYF
FTSH3_PETMO      ----SRVLWL---------------------------------------------LLIYI
FTSH1_PETMO      EKKKVKFSNI---------------------------------------------IWVYI
FTSH_HELPY       FQSPIILAV---------------------------------------------------
FTSH_HELPJ       FQSPIVLAV---------------------------------------------------
FTSH_HELFC       LQNPLLLIA---------------------------------------------------
FTSH_SULNB       NDNPLLAFA---------------------------------------------------
FTSH_ATOPD       DNKHRRSMS---------------------------------------------------
FTSH_CLOP1       MFKDKKMLK---------------------------------------------------
FTSH_TREPA       ------------------------------------------------------------
FTSH_PARD8       SGKPKMFRF---------------------------------------------------
FTSH_SULMD       FRIKTFFKK---------------------------------------------------
FTSH_RHOM4       TPPDGPRLP---------------------------------------------------
FTSH1_SALRM      SPSSGPGLQP-------------------------------------------------V
FTSH_PELLD       TPQPRPKLP---------------------------------------------------
FTSH4_SYNY3      RRLASVLLW---------------------------------------------------
FTSH_ACAM1       RKNFEPKRF---------------------------------------------------
FTSH_ANAD2       GTQPRIPLA---------------------------------------------------
FTSH2_SORC5      -------MR---------------------------------------------------
FTSH_PARP8       DFNREHKIN---------------------------------------------------
FTSH_PSEP1       AMNKDKPWT---------------------------------------------------
FTSH2_BDEBA      -MN-EPNRN---------------------------------------------------
FTSH_METPP       KIPFDRWLG---------------------------------------------------
FTSH_RALPJ       MEPRQQQFS---------------------------------------------------
FTSH_SYNFM       SQ-RKVHFS---------------------------------------------------
FTSH_BURP1       -MKSETGYM---------------------------------------------------
FTSH_PIRSD       -ESKLTAGS---------------------------------------------------
FTSH2_RHOBA      LEAQRSASE---------------------------------------------------
FTSH_METCA       GPEGTRRRN---------------------------------------------------
FTSH1_METI4      NEPPFPYLR---------------------------------------------------
FTSH_ACIFD       RQSPSPDQRG--------------------------------------------------
FTSH_ACIC1       GSAPPPPPPW--------------------------------------------------
FTSH1_SORC5      --MADEKRPA--------------------------------------------------
FTSH1_SYMTH      ------------------------------------------------------------
FTSH_OPITP       LPIRWFLALL--------------------------------------------------
FTSH3_SORC5      --MNSWFLQV--------------------------------------------------
FTSH2_SYMTH      -MSSDRTREV--------------------------------------------------
FTSH2_SPHTD      GLALGALALA--------------------------------------------------
FTSH3_SPHTD      ------------------------------------------------------------
FTSH2_CONWI      RFLLRDVFAL--------------------------------------------------
FTSH_THET8       --MPRAPFSL--------------------------------------------------
FTSH_LEPBD       DNNRRNNR---------------------------------------------------Q
FTSH_STRM9       EKEIKPKKPKKKVYISDDENA--------------------------EEIKKRIESLKNK
FTSH1_ALKMQ      LTKKQLIIVLG-------------------------------------------------
FTSH_LACP7       -MKKLYWIIL--------------------------------------------------
                                                                             

FTSH_MYCGE       -----------IILAVVIGVLAYIFSPRAATAVVESWKLNGGSNSTLTA-----------
FTSH_MYCPN       -----------VILAIIIGILVYILMPRATTAVIEKWELSG---TTLSA-----------
FTSH_MYCGH       -----------IVMAIIIGLILFYVLPRNTIANISNIQYVDG-NLVATA-----------
FTSH_MYCPE       -----------IIIILVLGVLALIILSGFSFSATSLNAASFTENGTSSF-----------
FTSH_UREP2       -----------IILLIIGTIIGVIIYFSVRKEYDNVIVKSAQTEVVNNK-----------
FTSH_MESFL       -----------ILLAIIVTIIIIAVTVKGTTQVISDATFADW--MSKSP-----------
FTSH_MYCPU       -----------IIAALLITVLVLLFSPKTQ--PKSFDYLLKHFEEAAKS-----------
FTSH_MYCS5       -----------VIGIILYFSIRNLFSTKVA--EWSISELLNNIERAKEN-----------
FTSH_MYCMO       -----------VIVALLLIWVVFAFLPNNPGTNKSFDGFLKDLQDAARL-----------
FTSH_MYCA5       -----------ILVLLVIAYIIYYYVSQTTVLKRDFSFLNRAIQEAAKS-----------
FTSH_MYCCR       -----------LIGILAYVLWQFLSPKLGY---KSLSDLEQRIITNAKS-----------
FTSH_AYWBP       -----------LYFAVILIGATFIYCYFTKHEKKDNN-----------------------
FTSH2_PHYMT      -----------FCFIFLLLSLLYCLIMMEISHQHDNNKPSEIIAVLKEIKELQTKSTEES
FTSH3_PHYMT      -----------IYLAFLFNWLEIGIFK----PKGESISESE-------------------
FTSH1_PHYMT      -----------IFFSILFCILLILDLTFERRIKGIKKRTDE-------------------
FTSH_ACHLI       -----------IVIIILLAIGMYFFFTEMMAPKVKQFDEFE-------------------
FTSH2_THEPX      -----------LALSIFINLLFIYIFISEV------------------------------
FTSH_AQUAE       -----------IIIGAAIVAFNLFEGKRE-------------------------------
FTSH_HYDS0       -----------LIIGFMIVAFNLFEEKGSS------------------------------
FTSH_ECOLI       IA---------VVLMSVFQSF---GPSE--------------------------------
FTSH_SHIFL       IA---------VVLMSVFQSF---GPSE--------------------------------
FTSH_ECO57       IA---------VVLMSVFQSF---GPSE--------------------------------
FTSH_SALTI       IA---------VVLMSVFQSF---GPSE--------------------------------
FTSH_SALTY       IA---------VVLMSVFQSF---GPSE--------------------------------
FTSH_BUCAI       IT---------VVLMSIFQNF---NTND--------------------------------
FTSH_BUCAP       IT---------VVLMSVFQNF---NSSD--------------------------------
FTSH_BUCBP       IA---------VVLMSIFQNF---SANN--------------------------------
FTSH_PHOPR       IA---------VVLMSVFQSF---GPSD--------------------------------
FTSH_HAEIN       VA---------VIMMTAYQSF---NSS---------------------------------
FTSH_MAGMM       IG---------LLMVMLFNLF---NSPQ--------------------------------
FTSH_CUPMC       IA---------LVLFTVFKQF---DKP---------------------------------
FTSH_RICCN       LF---------IFVILLFNVFQSDSLLG--------------------------------
FTSH_RICFE       LF---------VFVILLFNVFQSDGLLG--------------------------------
FTSH_RICPR       LF---------IFVILLFNVFQSDGLLG--------------------------------
FTSH_RICTY       LF---------IFVILLFNVFQSDGLLG--------------------------------
FTSH_RICBR       IF---------VFVILLFNVFQSDGLLS--------------------------------
FTSH_NEORI       II---------ILVTLLFGQVALNFGFG--------------------------------
FTSH_BARBK       IA---------LFLIVLFSFFNGNRQR---------------------------------
FTSH_CAUVN       IV---------AVLGGVFVVSQNSRTK---------------------------------
FTSH_ZYMMN       II---------AAMTLAVTFFDGNGGRD--------------------------------
FTSH_HALO1       LI---------FLFVMIYNLISDGTSGE--------------------------------
FTSH_MYXXD       LI---------VLFVAFYNFFSQGN-----------------------------------
FTSH4_SORC5      LI---------MMFLAIWQFLSPDSRPA--------------------------------
FTSH1_BDEBA      LI---------IMAVFLFQAYESKQ--Q--------------------------------
FTSH_ACIC5       IL---------ACCILLWQVFQRSSN-T--------------------------------
FTSH_AKKM8       VE---------MTPFALTYSMSLPDRDKPLLNELSGYRVVESPYRTEEG---------KN
FTSH2_METI4      ---------------MLAYYVSVNQG----------------------------------
FTSH_LEPBJ       IM---------MVVLIIAYNYENNAG----------------------------------
FTSH_BORBZ       VV---------FLISAIFMSYFIR---G--------------------------------
FTSH_PELPB       LL---------FLMAGLLMLFVFLRFFS--------------------------------
FTSH_UNCTG       TL---------LVIVLMFINFARQ------------------------------------
FTSH_SYNAS       FV---------LILIV---NFLMVRLLIPD------------------------------
FTSH_THET1       LI---------VALLL---NWLVAPILFPE------------------------------
FTSH3_CONWI      LV---------FILVLLGLNWWISSNALAP------------------------------
FTSH_MARHV       SA---------AIFLMF----LWLQGNNQ-------------------------------
FTSH_NITOC       LL---------GIFLI-----SWLGNAGR-------------------------------
FTSH_HAHCH       AV---------ALMLYY----LPAMRDRP-------------------------------
FTSH4_SPHTD      LL---------ALALWN----VYTFFWPS-------------------------------
FTSH2_THERP      VG---------LILFYN----LYAVFRPER------------------------------
FTSH_PELCD       GA---------ILMVNY----VLTTLTPQT------------------------------
FTSH_PELPD       LL---------FMLVFH----LTNIFFAQQ------------------------------
FTSH1_RHOBA      AL---------VITVLA----AMLFFNQP-------------------------------
FTSH2_SALRM      AG---------TLLALW-----AYSYWGMG------------------------------
FTSH_BACPE       IF---------LVIVGIVSVFNS-------------------------------------
FTSH_BACSU       IL---------LVVIGVVSYFQT-------------------------------------
FTSH_STAHJ       IG---------VIIFGVFSYING-------------------------------------
FTSH_STRPN       FI---------FFLVTGFQYFYSG------------------------------------
FTSH_STRR6       FI---------FFLVTGFQYFYSG------------------------------------
FTSH_LACPL       MF---------LSLMGIIYFFFGG------------------------------------
FTSH_LACPJ       MF---------LSLMGIIYFFFGG------------------------------------
FTSH_LEUMM       IF---------LAVVGMVYGLFG-------------------------------------
FTSH_OENOE       VI---------LAVIFLIYSFFG-------------------------------------
FTSH_LACLA       LA---------IVVVVGFNFFFS-------------------------------------
FTSH2_ALKMQ      AF---------IIILFIVQNFG--------------------------------------
FTSH1_THEPX      IF---------IAIYAMVQLYS--------------------------------------
FTSH_CALBD       IA---------LVILLLVDIFSGGLSYNQFF-----------------------------
FTSH_RUMCH       IF---------ILILVIITFFT--------------------------------------
FTSH_CLONN       LI---------VLFFAAITVLE--------------------------------------
FTSH_VEIPT       II---------AAFVIAIDAFS--------------------------------------
FTSH_HALOH       LI---------ALSILVAQFFVDTDVNTIVD-----------------------------
FTSH_NATTJ       IL---------MIVVGIFQQLNQ-------------------------------------
FTSH3_SYMTH      IL---------VISVAIAVQLGG-------------------------------------
FTSH_MYCTU       VV--------VLLGWSFFYFSDDT------------------------------------
FTSH_MYCTA       VV--------VLLGWSFFYFSDDT------------------------------------
FTSH_MYCBO       VV--------VLLGWSFFYFSDDT------------------------------------
FTSH_MYCLE       VV--------VLLGWSFFYFSDDT------------------------------------
FTSH_RHOE4       VV--------LLVIYAFSYFSNDT------------------------------------
FTSH_CORGL       VI--------LIVLFLVSLFSSDT------------------------------------
FTSH_ROTMD       AI--------VVMLGFLMASFFT-------------------------------------
FTSH_TROWT       LL--------VVGVWVAVNLFLT-------------------------------------
FTSH_BRAFD       VA--------LLLGMAMFSLFGR-------------------------------------
FTSH_CUTAS       LC--------IGLIIVFLQFAGSG------------------------------------
FTSH1_CONWI      IV--------VVLAFFAQRLINPG------------------------------------
FTSH_RUBXD       PE--------DHAPAGGEGQGAAG------------------------------------
FTSH_SLAHD       VY--------NAGEYTVTGKYYPA------------------------------------
FTSH_PORPU       PI-------FVVGFFFWQGFLGPTT----------------------------------T
FTSH_PYRYE       PI-------FVIGFFFWQGFLGPTT----------------------------------T
FTSH_GUITH       PL-------GLISFLVWQGFNNTTN----------------------------------P
FTSH2_SYNY3      PL-------LVVGFFFWQGSFGGAD----------------------------------A
FTSH_NOSS1       SPKRVAWTGALAASLIMLPTMFGGN----------------------------------P
FTSH1_SYNY3      AQEGGEGAQPKASPSPIQSPNSSNGEATPRSF--------------------------FN
FTSH_TRIEI       PG-------GKLTRKLGWKILATGIIAQAVLL--------------------------VS
FTSH_CYACA       PV--------IITLITLSSFLFYNQ-----------------------------------
FTSH_CYAM1       LA--------FIGWQELANQM---------------------------------------
FTSH_TRICV       IS-------LTAKKFDLIGVQGSESGKN------------------------------IN
FTSH_VAULI       ID-------SQIISNNIINNFNTKQ-----------------------------------
FTSH_HETA2       LA-------AFLAMKDGFFVLENNTKNN------------------------------NP
FTSH_ECTSI       F---------VYLKWDNFTDVGTNLIN---------------------------------
FTSH3_SYNY3      VL------------ALASAFFDRPT-----------------------------------
FTSH_SYNJB       LI------------SLATTFLGNRP-----------------------------------
FTSH1_SPHTD      VV------------ALWVTFMKDGG-----------------------------------
FTSH1_THERP      AI------------AVWVTFVQGGR-----------------------------------
FTSH_CHLAD       AL------------ALFFQYLGPGA-----------------------------------
FTSH_PSELT       VI--------LSLFWLVRSFYF--------------------------------------
FTSH_THEMA       II--------VTLFWLARFFYV--------------------------------------
FTSH_KOSOT       LG--------VFLMVALRGLYT--------------------------------------
FTSH2_PETMO      IL--------AMLIFMSISQL---------------------------------------
FTSH3_PETMO      TI--------GIFIYVGVNSLI--------------------------------------
FTSH1_PETMO      IF--------AVFFIGALISL---------------------------------------
FTSH_HELPY       --------LGGILLIFFLRSFNSDG-----------------------S---------FS
FTSH_HELPJ       --------LGGILLIFFLRSFNSDG-----------------------S---------FS
FTSH_HELFC       --------IFGIIIFVAMRVMNSDE-----------------------G---------FG
FTSH_SULNB       --------IFSIVIILIFKSFVGEGESLG-------------------T---------MM
FTSH_ATOPD       --------MLLYIAVAIFVYLLLSN-----------------------T---------LL
FTSH_CLOP1       --------YIVIYSIIAFGILLTFN-----------------------M---------VK
FTSH_TREPA       ---------MRIIPFSEFKDRIASG-----------------------E---------IV
FTSH_PARD8       ---------NLYWMYGLIFIMLVA----------------------------------LY
FTSH_SULMD       ---------IIFFL--IIFCFFYF----------------------------------FN
FTSH_RHOM4       --ERRPRFSVWIYLAIFLALLVHF----------------------------------FL
FTSH1_SALRM      WTTLRSPYVFWIGGAILLALLVHL----------------------------------GI
FTSH_PELLD       ----------MIYYVVVIALLIGL----------------------------------QL
FTSH4_SYNY3      ----------GSTIYLLVNLLAPAL----------------------------------F
FTSH_ACAM1       ----------GGSLFILFTLLLFLN----------------------------------L
FTSH_ANAD2       ----------SPAAWLVLIALAIFL----------------------------------F
FTSH2_SORC5      ----------SLWIVLVLVLGSALL----------------------------------L
FTSH_PARP8       ----------FLYVLAAMVGVLLIQ----------------------------------S
FTSH_PSEP1       ----------LYLLAVGLAVLAAVQ----------------------------------F
FTSH2_BDEBA      ----------FFWIFFLILGIFWLQ----------------------------------S
FTSH_METPP       ----------WPTLLLLLLGLWLLG----------------------------------S
FTSH_RALPJ       ----------LWYVLVTILAMLAIQ----------------------------------T
FTSH_SYNFM       ----------IWYFILALLLIVWMQ----------------------------------T
FTSH_BURP1       ----------GFVVVLVFMVLLALQ----------------------------------L
FTSH_PIRSD       ----------PGYIDVKVEARNTLR----------------------------------R
FTSH2_RHOBA      ----------SGDAAANVDGESRPE----------------------------------S
FTSH_METCA       ----------NLILYLLLVLSTLYL----------------------------------L
FTSH1_METI4      ----------LLVQVGIALFLVWIW----------------------------------Q
FTSH_ACIFD       ---------RIAFAILATLVVAVLLLTLFS------------------------------
FTSH_ACIC1       ---------RRWLLPIGLLVSLVLLFTFPM------------------------------
FTSH1_SORC5      ---------SRAWLGYLLIAVGILVLSGIV------------------------------
FTSH1_SYMTH      ---------MRWWAGAALLLAALLFGRPAA------------------------------
FTSH_OPITP       ---------AVFLAVAGLDLWFSQTGARPS------------------------------
FTSH3_SORC5      ---------SKRLGPAGRRLWLLGFMGVVL------------------------------
FTSH2_SYMTH      ---------TKRILMVLFGLWLLQFFFLPP------------------------------
FTSH2_SPHTD      ---------VFILIGVGISMRATPQPVNLT------------------------------
FTSH3_SPHTD      ------------------------------------------------------------
FTSH2_CONWI      ---------GLMIAALVIVILFFTLLGATK------------------------------
FTSH_THET8       ---------LALVLGLAFLAWAFSLAGTVG------------------------------
FTSH_LEPBD       DNGNRSPFSGFLFFIFVILLFTFTLLFHRD------------------------------
FTSH_STRM9       NNNISFRVKPPIFFFLILILMSTLFYFYGN------------------------------
FTSH1_ALKMQ      ---------IAIVVVSAIGYAVYTQYFN--------------------------------
FTSH_LACP7       -----------IAVVLACSGILMSLHLS--------------------------------
                                                                             

FTSH_MYCGE       ------KVSGFSNE-LTFKQINGS-------------------------TYVTDTILQVS
FTSH_MYCPN       ------QIKGLSGK-HTFQRINNS-------------------------TYVTDDILQVS
FTSH_MYCGH       ------TINGRSGR-FILDLENSTY----------------------QTSYTSGLSLSIS
FTSH_MYCPE       ------KITTNTNQTRTIGGAPSTI----------------------YQRDSTLYVIYIE
FTSH_UREP2       ------KVLYLNTI-----RPNSTQ----------------------ITRYTIDEDQLLT
FTSH_MESFL       ------QIDPNADK-----------------------------------------YWKNV
FTSH_MYCPU       ------TTDDIYFETIKINSLDNTI----------------------GVIFRNGAMREEY
FTSH_MYCS5       ------TTDALYFKEITVNPFTNSI----------------------TGVFNN-------
FTSH_MYCMO       ------GDDTIFFRNISFDVVLSRF----------------------NVTFVN-------
FTSH_MYCA5       ------ATDDIYFKSIVDNPYNNSL----------------------VATMQLPENVWAA
FTSH_MYCCR       ------ATDDNFFWAFGFDISDFRI----------------------KVVEQVGNRIESY
FTSH_AYWBP       ------TFDALAQKNEIEKIQYNPI----------------------FANSAFCDIVVTT
FTSH2_PHYMT      KKESKESKESKEDKTKIIKIKKFDI----------------------HETSNYGSYLIVF
FTSH3_PHYMT      ------MLSKISR-KDISESVRYSV----------------------YKTMFLKDKPFDI
FTSH1_PHYMT      ------IIKKIKDDNHLVEEIVFYE----------------------TNSTIFEKSFYRV
FTSH_ACHLI       ------FIAAIESGQIATVRSEYVG----------------------GDNFNLWEVTGTF
FTSH2_THEPX      ------------------------------------------------------------
FTSH_AQUAE       ------FTTKVSLNEVVKLVEEGK-----------------------VSYAEVRGNTAII
FTSH_HYDS0       ----SPSATPMSLTTLVDMVKQNK-----------------------IGEADIKGDKIIA
FTSH_ECOLI       -----SNGRKVDYSTFLQEVNNDQ-----------------------VREARINGREINV
FTSH_SHIFL       -----SNGRKVDYSTFLQEVNNDQ-----------------------VREARINGREINV
FTSH_ECO57       -----SNGRKVDYSTFLQEVNNDQ-----------------------VREARINGREINV
FTSH_SALTI       -----SNGRKVDYSTFLQEVNQDQ-----------------------VREARINGREINV
FTSH_SALTY       -----SNGRKVDYSTFLQEVNQDQ-----------------------VREARINGREINV
FTSH_BUCAI       -----VNNHKVDYSTFLSEVNQDQ-----------------------IREAYINGRMISV
FTSH_BUCAP       -----TSNHRVDYSTFLSEVNQDQ-----------------------VREAYINGRIISV
FTSH_BUCBP       -----INNRKIDYSTFLSDVNQDQ-----------------------VREVHISGREMNI
FTSH_PHOPR       -----SAGRQVDYTTFVREIGQDQ-----------------------IREARFNEREITV
FTSH_HAEIN       -----SVENSTDYTTFVYDVSNGQ-----------------------VTAARFDANEITV
FTSH_MAGMM       -----GPGQSITFSDFSEMVAQGK-----------------------VTAVTLEGRTVRG
FTSH_CUPMC       -----RAQDSVTYSQFMDDAKNGK-----------------------VSRVDVQGRNLVV
FTSH_RICCN       -----GRN-NITFSDFLTRVDEKT-----------------------VNSVKIQGRVIEG
FTSH_RICFE       -----GRN-NITFSDFLTRVDEKT-----------------------VNSVKIQGRVIEG
FTSH_RICPR       -----VRN-NITFSDFLTRVDEKT-----------------------INSVKIQGRVIEG
FTSH_RICTY       -----VRN-NITFSDFLTRVDERT-----------------------INSVKIQGRVIEG
FTSH_RICBR       -----SKN-NISFSEFLTKVDEKT-----------------------VNSVKIQGRIIEG
FTSH_NEORI       -----IRNEKIQFSEFLDLVEKGE-----------------------VQKIVIEGYDISG
FTSH_BARBK       -----ASNGEVSYSEFLQKIDNNE-----------------------LKTVTIQGQKLTG
FTSH_CAUVN       -----SSS-EISYSQLLKDVDAGK-----------------------IKSAEIAGQTVLA
FTSH_ZYMMN       -----HNTTSVAYSEFLNRVDNNG-----------------------VKDVTIGHDELSG
FTSH_HALO1       -----ETLDTTEFKTLLQARIDERLADAGEGPALSDDRRALAQRAGEIASVTVEPNPND-
FTSH_MYXXD       -----DQVQEPSFTQLLTKVEEKK-----------------------VQEVAVKGNTY--
FTSH4_SORC5      -----TQVAFSEFMAQVQVEAKDK--------------------DPHVESVTIKDREYTF
FTSH1_BDEBA      -----KAIADFNFSKFTEAVKAGE-----------------------VATVTFRQDTSEV
FTSH_ACIC5       -----GKEQEISFSQFLNDAQQGQ-----------------------IHDVTVVGGEVHG
FTSH_AKKM8       VSLIPEGAQKLSVPEFNRLALE---------------GRIAGGKDGIILAEDGNQNVLVG
FTSH2_METI4      -----PGIEQKSLPQLTRLLDQ---------------GRVKALV--FIRDTSTGQTFLEG
FTSH_LEPBJ       ------ATKDISYSDFLNMLEPVEGKKPL--------GKLYKGNVDKYNKIQIEKDVIEG
FTSH_BORBZ       ----GESYKNVPYSTFQSYLDNGL-----------------------VESVVIIDKNLIQ
FTSH_PELPB       ----GTDAPEITYNEYKSVLSRAL-----------------------VTEVTVKTYEDKS
FTSH_UNCTG       ----GGNEVELEYSQFKQHIKAGS-----------------------VFKVLVAPGLIRG
FTSH_SYNAS       ----AEQPVMVPYTLFKGEVGKGN-----------------------VKEIFSRGDTITG
FTSH_THET1       ----GKGAVSIPYTSFKQQLENNN-----------------------VAEVTTQADKITG
FTSH3_CONWI      ----SERVRVPYSPNFIQQVRDGN-----------------------VKEISSTGASIQG
FTSH_MARHV       -----QQQQELAYSEFKQAVISGQ-----------------------VAEVTLRTEEISG
FTSH_NITOC       -----QAGDEITYTEFKQALHQGK-----------------------IAKVTLEGQHISG
FTSH_HAHCH       -----EPAIKLPYSEFRMLLREGQ-----------------------ISSVTLRGSELDG
FTSH4_SPHTD      ----SGARLNIPYSAFIQQVEGEN-----------------------VSSVTIRGQRVSG
FTSH2_THERP      ----SGPQSEIAYSSFVAAVEKGL-----------------------VSTVTLSGQTIDG
FTSH_PELCD       ----QEPVVDVSYSRFKTELAADN-----------------------VAAITFEGNNVVG
FTSH_PELPD       ----GAQVAQISYSRLRAELAQDN-----------------------IKKITLKGTAVTG
FTSH1_RHOBA      -----EPSSLISASFFRSQLEKNN-----------------------IESVEIGDIEVSG
FTSH2_SALRM      ----ASGGERISYSEFRTQLQQEN-----------------------VERVEVKGNAING
FTSH_BACPE       ---DQTETENVSFNEFAERLENGQ-----------------------VQELSVKPERQ-V
FTSH_BACSU       ---SNPKTENMSYSTFIKNLDDGK-----------------------VDSVSVQPVRG-V
FTSH_STAHJ       ---NGNTPKQLSYSQFVEKLDKGD-----------------------LKTLEIQPEQN-V
FTSH_STRPN       --NNSGGSQQINYTELVQEITDGN-----------------------VKELTYQPNGS-V
FTSH_STRR6       --NNSGGSQQINYTELVQEITDGN-----------------------VKELTYQPNGS-V
FTSH_LACPL       --NSGSQTQNIRYSEFVKQLDKNN-----------------------VKNVSIQPSGG-V
FTSH_LACPJ       --NSGSQTQNIRYSEFVKQLDKNN-----------------------VKNVSIQPSGG-V
FTSH_LEUMM       --NDKTTTKTITSSEFIKALNDKE-----------------------LKSVTVQPGNS-I
FTSH_OENOE       --RSDGSVKHLSTTTFLKELKNNK-----------------------IKDFTIQPGDSGV
FTSH_LACLA       --SNQSSVDKISYSQLMTKLDGNK-----------------------IENVTMQPSDS-L
FTSH2_ALKMQ      --RPTQEIDELDFSEFYRALVNDR-----------------------VTEAHLVER-SVE
FTSH1_THEPX      --QSTEPITDIDYGQLIKYIDANQ-----------------------VKSITLVGN-DVK
FTSH_CALBD       --SNLSERREVIYSELINDINDGK-----------------------VTRIVLSYN-NVS
FTSH_RUMCH       ---ATDNPPKMSYSELLTEMKAGN-----------------------VKSIGLQTD-TAT
FTSH_CLONN       ---SSKTSGAISYNEFKKYWIENK-----------------------VSRVEIKQD-GRT
FTSH_VEIPT       --GQSANKSELSYTGFIQQVQQKK-----------------------VESVTITNDHGIK
FTSH_HALOH       --TDVNTIKDFTYSDLINYVEQGK-----------------------INEVTIIGN-EAV
FTSH_NATTJ       ---EPEAEEDLFYNEFLNKVEAGE-----------------------VDRVDITER-DIE
FTSH3_SYMTH      ---TSQQTTQLVYSDLVRYIQQGE-----------------------VRSITLSGA-YAE
FTSH_MYCTU       -----RGYKPVDTSVAITQINGDN-----------------------VKSAQIDDREQ-Q
FTSH_MYCTA       -----RGYKPVDTSVAITQINGDN-----------------------VKSAQIDDREQ-Q
FTSH_MYCBO       -----RGYKPVDTSVAITQINGDN-----------------------VKSAQIDDREQ-Q
FTSH_MYCLE       -----RGYKFVDTSVAMSQINGHN-----------------------VKSAQIDDREQ-Q
FTSH_RHOE4       -----RDFKTVDTSVAISQLDAKN-----------------------VASAQIDDREQ-Q
FTSH_CORGL       -----RNFQEVDTSVAMAQLDAGN-----------------------VAEAQIDDREQ-R
FTSH_ROTMD       -----QPSRQVDTNVGLQLLNDHQ-----------------------VKSAKIYDGDQ-R
FTSH_TROWT       -----NAYQSIRTEEGLELIKSDS-----------------------LVSVRIVDRDQ-R
FTSH_BRAFD       -----DGYQQIDTQQGLELLAGDT-----------------------VEQAKIIDGNQQR
FTSH_CUTAS       -----NGYKDIPTSEAVSIINSSKK----------------------LDSVTLTDGDQ--
FTSH1_CONWI      -----DSGPRYDYSTFQQDLSEGN-----------------------VKSAVVKTKGNLL
FTSH_RUBXD       -----HRELRHPVGRAPSGGAGSD-----------------------LEPGPLKVYDESQ
FTSH_SLAHD       -----ATAGSTIAESYNSAIESVD-----------------------VKLGTILEPSNPS
FTSH_PORPU       DVGSNIASSRMTYGRFLEYLDMGW-----------------------VKRVDLYENNHTA
FTSH_PYRYE       DVGSNIASSRMTYGRFLEYLDMGW-----------------------VKRVDLYENNHTA
FTSH_GUITH       QFTKNIASSRMTYGRFLEYLDLGW-----------------------VKKVDLYDEGHTA
FTSH2_SYNY3      NLGSNTANTRMTYGRFLEYVDAGR-----------------------ITSVDLYENGRTA
FTSH_NOSS1       VLAQKAERESLSYGELIQKVNQEQ-----------------------VKRVELDETEQIA
FTSH1_SYNY3      SGSPRSAEPKMNYGQLIDAIKANQ-----------------------VAKVEVDTNRRQA
FTSH_TRIEI       PAFANSTQKNLSYSQLLDKIQAGE-----------------------VTEIDYYPSRGIA
FTSH_CYACA       DVVHNWSSSRMTYGRFLEYIDMNW-----------------------VKKVDLYDNARTA
FTSH_CYAM1       ----PVATSRMTYGRLLEYMQMGW-----------------------VKRIDVYD--RTA
FTSH_TRICV       QVNPNVISSKMTYGRFLEYLEMGW-----------------------VNQVDLYDNSRNA
FTSH_VAULI       ----NSNNIKMTYGRFLEYLDMGW-----------------------IKKVDFYDNGRIA
FTSH_HETA2       DSPENKASSKMAYARLLNYIEKGW-----------------------IKTIDFYENGQIA
FTSH_ECTSI       -LKNSHPTQMVSYDTFLHYLENGA-----------------------IKKVDLYENAELA
FTSH3_SYNY3      -----QTRETLSYSDFVNRVEANQ-----------------------IERVNLSADRTQA
FTSH_SYNJB       -----PERLEISYSDLISRVERGE-----------------------VSKVLVETAPDGR
FTSH1_SPHTD      -----SAREEN-FADVAADIRQGR-----------------------VARIVMTEGSNDI
FTSH1_THERP      -----GGATIT-TQEMAADIKAGK-----------------------VERLVMTSGSDEI
FTSH_CHLAD       -----SQTEEKGIADVIADAQAGL-----------------------VREIQAQAGDEQI
FTSH_PSELT       ---DTSAPSKMSFSDFIQMAYEEPTR---------------------IAEVVVRDDGILR
FTSH_THEMA       ---ENSPVSKLSYTSFVQMVEDERSV---------------------VSEVVIRDDGVLR
FTSH_KOSOT       ---TDTNLS-VPYNRFLEDVNDKK-----------------------IIKIVIYDDGRIV
FTSH2_PETMO      ---NTSNITEISYTDLVNLINQDT-----------------------IISLQIDTSGLIQ
FTSH3_PETMO      ---GTPDVSKIEYSELVQMLEDKK-----------------------IVSLEIEDSGYAR
FTSH1_PETMO      ---NWENNPIISYSEMLSLINDGQ-----------------------VESMKINQNGNVE
FTSH_HELPY       DNFLASSTKNVSYHEIKQLISNNE-----------------------VENVSIGQTL---
FTSH_HELPJ       DNFLASSTKNVSYHEIKQLISNNE-----------------------VENVSIGQTL---
FTSH_HELFC       DRFLSTSTKNISYHEMKELIEKKE-----------------------VDSVSIGQTL---
FTSH_SULNB       NTQGVAQTKQVKYSEIKKRIEEGA-----------------------VKSVKLTPSM---
FTSH_ATOPD       PGLLRQQIQTVSYSEFLNKIESNE-----------------------VTKVDLNTGN---
FTSH_CLOP1       DEMLYEK---VDYSTFMQMLDKKE-----------------------VKSVNFSGNQ---
FTSH_TREPA       KVVVGSP----YFVGYTSARPAPS-----------------------ARGFSLLSER---
FTSH_PARD8       MTNDSSGTKELGWTEFQKLAQENV-----------------------FDKMTVYNKKN--
FTSH_SULMD       FIKKTKKITHTTQDKFFELLSKNK-----------------------INKFIVLNKK---
FTSH_RHOM4       FWTGTDTST-IEYSQFLEYVEKGY-----------------------VERVEIVNDTKVQ
FTSH1_SALRM      KWQQASAPVRIEYSTFLEHVESGY-----------------------VERVEIVNGKRIN
FTSH_PELLD       AFFWSGSSREIPYSTFRTFITENK-----------------------VESVRIAPEK--I
FTSH4_SYNY3      RSQP----PQVPYSLFIDQVEGDK-----------------------VASVYVGQNEIRY
FTSH_ACAM1       FVLRGPRFPITAYSDFITQVEAGQ-----------------------VERVEVRPDRIRY
FTSH_ANAD2       RAFQDVGVRRIPYSQFKEMVRQSA-----------------------FERVVIGPDWVRG
FTSH2_SORC5      QVMAASD-DRIPYARFRSLAERGE-----------------------LAEIEIRDDMYIG
FTSH_PARP8       LVSQPDHIRTIPYSEFQQLASQGK-----------------------VTDLVVGPTRITG
FTSH_PSEP1       GLFSQPAVQAIPYSQFLQLLDQQK-----------------------VSDLHIEHERILG
FTSH2_BDEBA      VWFGSRTVQQIPYSQYESLVKQGD-----------------------VQNLIVTENHIRG
FTSH_METPP       SLRDQRTVEAVPYSVFEQYLRDGQ-----------------------LTDVQVGDQVISA
FTSH_RALPJ       LFVSG-HVETIPYSDFKVLLKAGK-----------------------LKDVAIGEQAISG
FTSH_SYNFM       YMGEQ-QSEKISYSEFKQRVHDGN-----------------------VQNLVIEHDRITG
FTSH_BURP1       ATLSA-PATQIAYSDFRKLAAAAQ-----------------------LDDLEVSPTRITG
FTSH_PIRSD       MRVSNLRKVELGPTAVRGQIDLVE-----------------------LKPVGTSGDRWEP
FTSH2_RHOBA      SVISRSSSALISGDPANDIPVPKI-----------------------VVPSSTKEDVWHE
FTSH_METCA       NGYQTLRNEEIPYSEFLKAVAEGR-----------------------VEQAVVTEQTISG
FTSH1_METI4      ESLHKATVSTIPYSEFLNKINQKE-----------------------IIECKITPDEIYG
FTSH_ACIFD       ---HAPSGQPLGYSTFIHDVQAKQ-----------------------VRTAVLNNTTGQI
FTSH_ACIC1       ---RPSSGKTLTYSEFLTALHHHD-----------------------IKTITIHSD-GEA
FTSH1_SORC5      ---RSRGRPLVPYDEAVAEVRRGE-----------------------ISAAIVKPDEIEL
FTSH1_SYMTH      ---AMEAQP-VAYSEFIQDVQARR-----------------------VAYARITGQRLEA
FTSH_OPITP       ---SATGEERLDGAAFLAAANAGE-----------------------LREGHIVYRANST
FTSH3_SORC5      ---AVTLGLALRAARESATQRTAT-----------------------YTELLQIAQAGQA
FTSH2_SYMTH      ---LTTRPTELSYSAFLDALEDRR-----------------------VQEAVVRDRVLQG
FTSH2_SPHTD      ---QVLTDIRDGRVTEIHLANDGQ-----------------------AAEVTYTDESKTR
FTSH3_SPHTD      --------------------------------------------------------MNPR
FTSH2_CONWI      ---PTSSGTGIPLSQVFTLARDRA-----------------------IVEATLLDEDARV
FTSH_THET8       ---APSGT--VNYTTFLEDLKAGR-----------------------VKEVVVRAGDTRI
FTSH_LEPBD       IQTYFQEKREISYTEFVSKTQKGD-----------------------FSEINEKDDKLIS
FTSH_STRM9       KTALFQEKREISYTQFVTKVKQGD-----------------------ITEIRESQEKLTG
FTSH1_ALKMQ      -----EDKLEISYTAFLESTEAGE-----------------------IRTVNLSEG-PKL
FTSH_LACP7       -----VTKEEMTYPSFLDAVNQNQ-----------------------VASVQFKENDSTL
                                                                             

FTSH_MYCGE       ITFDGLNS--------------------PLTVTAHKTVNSNGNVIFNIANLSINQSNGQI
FTSH_MYCPN       ISFQGIN---------------------PIVVTAHKATNGSGETIFNIANLSINQSTGKA
FTSH_MYCGH       VFLRNLNNANG---------------QSFFVSLIRPATSSANDAVFNIANLSINQTRGVA
FTSH_MYCPE       NSFSGYYYSAI---------------ITDISVSNNTASVGNGSNTTGGSTSNLQKGLQIA
FTSH_UREP2       ARVNILNN-------------------TNFQIISNASSLGLSRISFNIVREGVEK-----
FTSH_MESFL       IIYYGSNN--------------------TVVVKGSYFLESTGKYVNFVAYLTQKR-----
FTSH_MYCPU       FVAASAAQA-------------------NFLTSGNVEVREILQLANVQAYIQSIKTLNGT
FTSH_MYCS5       ---TDNTST-------------------SFVTYTNLDLLRLSGVASDQGVISKIFTPEVF
FTSH_MYCMO       ---GATTSS-------------------YFVNYPSSVAFQNLQIPGTTFTGLELATLAIA
FTSH_MYCA5       LNGMTSTSTRI--------------RVVTFEVHATTSMKNILYNEIISSIGGATPSFSRG
FTSH_MYCCR       QVVADPTIIRLYQAGTGGVISENILSQLGSSAPKVNSWREIIQLATKASLTSEIIENAIN
FTSH_AYWBP       TDGR----------------------------------------VIDFFNIPYDK-----
FTSH2_PHYMT      QWGTGNKDSFEWE------------KELKFPNVDQETYKEIMKICFEIIGTPIDKKDNIT
FTSH3_PHYMT      RNVYQ----------------------------------------IELTTHNNEK-----
FTSH1_PHYMT      EILVK----------------------------------------NKNNLTTKEK-----
FTSH_ACHLI       TTGNA----------------------------------------PEGVGSYVII-----
FTSH2_THEPX      ------------------------------------------------------------
FTSH_AQUAE       QTKDG-----------------------------------------QKLEVTLPPN----
FTSH_HYDS0       YTKDG-----------------------------------------QKVETYIPKGY---
FTSH_ECOLI       TKKD-----------------------------------------SNRYTTYIPVQ----
FTSH_SHIFL       TKKD-----------------------------------------SNRYTTYIPVQ----
FTSH_ECO57       TKKD-----------------------------------------SNRYTTYIPVQ----
FTSH_SALTI       TKKD-----------------------------------------SNRYTTYIPIN----
FTSH_SALTY       TKKD-----------------------------------------SNRYTTYIPIN----
FTSH_BUCAI       TKKD-----------------------------------------SSKYTTYIPIN----
FTSH_BUCAP       TKKD-----------------------------------------SSKYITYIPIN----
FTSH_BUCBP       IRKD-----------------------------------------NGRYITYIPIS----
FTSH_PHOPR       FKRD-----------------------------------------NTRYVTYLPVFN---
FTSH_HAEIN       TKTD-----------------------------------------GSKYSTVMPPLE---
FTSH_MAGMM       LSTD-----------------------------------------GSPFSSRVPDN----
FTSH_CUPMC       SPKE-----------------------------------------GSKYTIISPGD----
FTSH_RICCN       TSND-----------------------------------------GSTFNTYAPDY----
FTSH_RICFE       TSND-----------------------------------------GSTFNTYAPDY----
FTSH_RICPR       TAND-----------------------------------------GSTFSTYSPDY----
FTSH_RICTY       TSND-----------------------------------------GSTFSTYSPDY----
FTSH_RICBR       TSND-----------------------------------------GSSFSTYAPDY----
FTSH_NEORI       VLKS-----------------------------------------GTRFYTKATQY----
FTSH_BARBK       QTAD-----------------------------------------RRMISTYAPRD----
FTSH_CAUVN       KTAD-----------------------------------------NKTLTVNAPMN----
FTSH_ZYMMN       HFTD-----------------------------------------NSAFKTVAPSD----
FTSH_HALO1       NATYV------------------------------------LRYEGSGEDGLDPDKKTLV
FTSH_MYXXD       SGKFT------------------------------------DTSEKFRTTGPAPD-----
FTSH4_SORC5      WVKDP------------------------------------KSGTKTKKVTIGPDN----
FTSH1_BDEBA      VGEMK------------------------------------PEFEKKYNGTHFSIVGNTQ
FTSH_ACIC5       HFRSA------------------------------------NAAFHVEVPTNYPQ-----
FTSH_AKKM8       QIVTR------------------------------------IWPAATGDASVDKQRFERV
FTSH2_METI4      RYTRP------------------------------------AGPTENAEIVVPFR--TVV
FTSH_LEPBJ       FYIPS------------------------------------EYLESKTAKPVKFR---TT
FTSH_BORBZ       FVVKG------------------------------------SNFAKSYFSTSIPYL----
FTSH_PELPB       AILSGKLNAPAQLQLIDK-----------------------TTLQTNRFAVRVPSF----
FTSH_UNCTG       QFRDG-------------------------------------DGVFKRFKTVPMDD----
FTSH_SYNAS       RFKEEIAYQAAEEK---------------------AGDSRKASKAVTTFTTTVPSFVD--
FTSH_THET1       EFKQAVKVPGVDQ-------------------------------PVKRFVTHIPAFGD--
FTSH3_CONWI      DFRADVTYPPKDD---------------------------KDSVTAKKFSTEVPAFADT-
FTSH_MARHV       SFTDSGASR----------------------------FANDSRPPSSSFITLRPQVED--
FTSH_NITOC       TYHEAGGNI----------------------------QPEGK--DSKGFSTTRPPFDD--
FTSH_HAHCH       KFITPRMFP----------------------------EQRRQ---YSRFLTQLPDFGN--
FTSH4_SPHTD      TFTEEVRVAGDQVLSPGDPV--------------PPGTSPNEIRTGTQFQTTIPENSQ--
FTSH2_THERP      QFTQPLRVANGIVYLPGEPL--------------PDTVDPAQVRSVTRFRTVIPENTQ--
FTSH_PELCD       NLRERTILNR--------------------------VEGTEEVQSFLRFRTTMPPVTD--
FTSH_PELPD       EFRGKTRVSAL-------------------------VQGKEQQREFTGFSSVLPTIDD--
FTSH1_RHOBA      TFKTRPQMPASE----------------------SADGDAKPKELLKRFRFTRPAGADYA
FTSH2_SALRM      SLKSQATRS-----------------------------EQGNTIEYQNFVTYLPSFGD--
FTSH_BACPE       YLVRGQFNDQA----------------------------------EDEFFQTYALRSEQT
FTSH_BACSU       YEVKGQLKNYD----------------------------------KDQYFLTHVPEG-KG
FTSH_STAHJ       YLVSGKTKND------------------------------------EDYSSTILYNNEKD
FTSH_STRPN       IEVSGVYKNPKTSKEETG------------------IQFFTPSVTKVEKFTSTILPADTT
FTSH_STRR6       IEVSGVYKNPKTSKEGTG------------------IQFFTPSVTKVEKFTSTILPADTT
FTSH_LACPL       YKVTGSYRKARTTSSANA------------------LGIKSAS-TKTTSFSTTMLENNST
FTSH_LACPJ       YKVTGSYRKARTTSSANA------------------LGIKSAS-TKTTSFSTTMLENNST
FTSH_LEUMM       YNVTGTYKKAQTATKDKG-------------------LSLFQPTQKVTKFTSTLLPNDAS
FTSH_OENOE       YTIAGDFKKAQKSSSSSSS----------------TTTLLSGYQSSVTKFTAYVLPNNSS
FTSH_LACLA       ITVTGEYKEPVKVKGTNN------------------FPLLGNSSSEVKNFQAYIIPTDSV
FTSH2_ALKMQ      GIWVNNNNEEM------------------------------------SYRSFVPEVFSEE
FTSH1_THEPX      GVLKNGTE----------------------------------------FKSRVPDVTN--
FTSH_CALBD       GQYADGTK---------------------------------------FDNVFVPSPDK--
FTSH_RUMCH       IELKKPKENNR------------------------------------TKFVVIVPPDVTS
FTSH_CLONN       VAGEL-NDKAK------------------------------------TQFQVVVPQSLLV
FTSH_VEIPT       GKLKNGTE----------------------------------------FNSYAPTDET--
FTSH_HALOH       KGTYNHRE----------------------------------------FNVPIPPEAV--
FTSH_NATTJ       GELTDGTS----------------------------------------FVTRDPGD----
FTSH3_SYMTH      GELVSGEK----------------------------------------FTVQLPPSSS--
FTSH_MYCTU       LRLILKK-----------------------------------GNNETDGSEKVITKYPTG
FTSH_MYCTA       LRLILKK-----------------------------------GNNETDGSEKVITKYPTG
FTSH_MYCBO       LRLILKK-----------------------------------GNNETDGSEKVITKYPTG
FTSH_MYCLE       LRLTLKK-----------------------------------GNNDTDGSDKVITKYPTG
FTSH_RHOE4       VRLWLKN-----------------------------------GNDATDGKTQILAKYPAS
FTSH_CORGL       VRLTLREPI---------------------------------TVDEREGVEEILAQYPAR
FTSH_ROTMD       VELQLKDDY---------------------------------KKGNDNYGKSVRFYYVQP
FTSH_TROWT       VDLELATPY---------------------------------K----NHGTKVQFNYVSQ
FTSH_BRAFD       VDLVLTEDF---------------------------------KDGDEDKGTQVRFSYVDA
FTSH_CUTAS       -VIKITENE---------------------------------N-------KKYRSYWVGN
FTSH1_CONWI      ---EVT--L---------------------------------KSPAN-QKHEVGYVPDN-
FTSH_RUBXD       ---KVTGLL---------------------------------KPEGGGEPREFEYSYPE-
FTSH_SLAHD       SVGIETTSL---------------------------------EEKTLGTERNYTATYVG-
FTSH_PORPU       IVEAVGPEL-------------------------------------GNRVQRIRVELPAS
FTSH_PYRYE       IVEAVGPEL-------------------------------------GNRVQRIRVELPAS
FTSH_GUITH       IVEAIGPEL-------------------------------------GNRIQRIRVELPAT
FTSH2_SYNY3      IVQVSDPE--------------------------------------VDRTLRSRVDLPTN
FTSH_NOSS1       KVYLKGQK---------------------------------------PDAPPIQVRLLEQ
FTSH1_SYNY3      IVTLKDAP---------------------------------------PGSKPQTVQLLDN
FTSH_TRIEI       KVSLKGQR---------------------------------------SREGMYIVQMFEH
FTSH_CYACA       IVDIINPDI-------------------------------------KGEEQLVRVELPTF
FTSH_CYAM1       LIEASSPET-------------------------------------GW--QWIRVDLPAN
FTSH_TRICV       IVQASSPE-------------------------------------LGNRPQTIRVEIPVG
FTSH_VAULI       IIEASSPE-------------------------------------LGDRLQKIRVEIPVG
FTSH_HETA2       IVEASSSE-------------------------------------LSDRPQRLRVEIPAG
FTSH_ECTSI       VFDAFESLDQNLLKPVPLL-----------------SSDTLFGILNSDEFRPIGVKIPVR
FTSH3_SYNY3      QVPN-PSG-----------------------------------------GPPYLVNLPN-
FTSH_SYNJB       QVAI-AEAE------------------------------------INNRATQVQVNLPPL
FTSH1_SPHTD      QVQYIGEEE------------------------------------PRSSRLPPDVNIYQA
FTSH1_THERP      QVQYIGTNE------------------------------------VRTLRLPPNVDIFEL
FTSH_CHLAD       IVTYNDGKK------------------------------------YRS-RLESADSVMRL
FTSH_PSELT       VTTKRGEYY------------------------------------EIYAPWFMQD-----
FTSH_THEMA       VYTKDGRVY------------------------------------EVDAPWAVND-----
FTSH_KOSOT       YTTSESSKR------------------------------------SLETKVSPQTLSTDR
FTSH2_PETMO      AKAKNGQLF------------------------------------QVYAPTLLMD-----
FTSH3_PETMO      ARDNRGLYY------------------------------------ETYAPTLLSD-----
FTSH1_PETMO      ILSKDGTTY------------------------------------ESFSPALVID-----
FTSH_HELPY       ----------IKASHKEG---------------------------NNRVIYIAKRVP---
FTSH_HELPJ       ----------IKASHKEG---------------------------NNRVIYIAKRVP---
FTSH_HELFC       ----------IKAISKEG---------------------------NNKTIYVAKRVP---
FTSH_SULNB       ----------VEAIIEDN---------------------------GRKVRYVAQNVPTY-
FTSH_ATOPD       ----------RNIRFTTG---------------------------SGDSEKIFETTQFP-
FTSH_CLOP1       ----------IEITPSDS---------------------------SNLKGKILYTTNPAV
FTSH_TREPA       ----------EAPTYHAI---------------------------GVLSD----------
FTSH_PARD8       ---------LVEATVKNGKT--------------EQV-------FGNMDVSKIGVSPKVY
FTSH_SULMD       ---------KVSFTLNEKKS--------------HLD-------SNNYNFFSKLHLSRYE
FTSH_RHOM4       -------GRFTEAAVREGLV--------------SVPVRQTDLLRGAQTPELIRRFTTTK
FTSH1_SALRM      -------GTYTAAAVQNDRV--------------ETR-PPPAAPMGAVVDRSRRAFATHK
FTSH_PELLD       -------YVTLKPGVDSGLP--------------KQE---------EGNDTTRKLLPGAK
FTSH4_SYNY3      --------QLKPEAEDEGKE--------------K-----------AAEGQILRTTPI--
FTSH_ACAM1       --------ILKSDQ-YGFNE--------------G-----------TETAAVFDTVPVG-
FTSH_ANAD2       VPKPVEAGAAQGGGAQPQQQ--------------AQGEGERNGQALPYVATRIPGGGD--
FTSH2_SORC5      -------RAVSGLSARAPQ---------------------------SYRTGRIEQTEK--
FTSH_PARP8       --------TLKDAPKDSPR---------------------------HFSTLRVDQA----
FTSH_PSEP1       --------RLQE-PIDGHS---------------------------VFSTVRVDPA----
FTSH2_BDEBA      --------EFKQ-PQNGFK---------------------------SFVTNRVEPE----
FTSH_METPP       --------RFTS-PHDGKA---------------------------TVVAELVEPA----
FTSH_RALPJ       --------TFSTEGIDNLLA--------------KQQIEEIRREAKGDHAFSTLRVAD--
FTSH_SYNFM       --------TMKEND-------------------------------GPGRRFNTIRVED--
FTSH_BURP1       --------VLRSASAAAALP--------------ASDAEAIKR-AGTPWRFSTKRVTD--
FTSH_PIRSD       --------DSK-----------------------TLRQNVEFRTNLSDKGSNRD------
FTSH2_RHOBA      --------FSRLDNIFVADD--------------RITGKVHFKSFVKNHPSEKEPAEEVT
FTSH_METCA       --------TLKPEAEGE-----------------------------STRPFITVPLWN--
FTSH1_METI4      -------KMLVSKPEEKGQP--------------P-----------KIALFSTVRVDD--
FTSH_ACIFD       TGSLTNGTA---------------------------------------YSVTGPL-----
FTSH_ACIC1       SGQFADGRP---------------------------------------YSTTIPI-----
FTSH1_SORC5      VRRESPQRPEER------------------------------------VRVTRLP-----
FTSH1_SYMTH      AYRDGT------------------------------------------VRVVTLP-----
FTSH_OPITP       GLADLHAQRKGAAGAGATH---------------------------VRATARLTD-----
FTSH3_SORC5      TAVEVSGDRFLVRQAGGAV---------------------------V--TAVVDE-----
FTSH2_SYMTH      KMVGGE-------------------------------------------SFTVTL-----
FTSH2_SPHTD      VALPAG-------------------------------------------ESLTTL-----
FTSH3_SPHTD      PVRPGG-------------------------------------------SLQQSL-----
FTSH2_CONWI      QVHTRDGAE--------------------------------------YWAAYPSS-----
FTSH_THET8       QGVLEDGS---------------------------------------AFTTYAAS-----
FTSH_LEPBD       QVKENGK--------------------------------------DVLYYTKKITDRVGD
FTSH_STRM9       IKKVAGK--------------------------------------VEVFETNKLTDRLGQ
FTSH1_ALKMQ      TGVFE----------------------------------------DGK--QFITDHPR--
FTSH_LACP7       KVILN----------------------------------------SDKDTTYIVPNPK--
                                                                             

FTSH_MYCGE       TVNSN-------------------------GTMMNGGSSNN---TKSIAGFETL---GTF
FTSH_MYCPN       IVN---------------------------GMMTQDQKSNNGTELASIKGLHDI---GTF
FTSH_MYCGH       TLVTEGGSYSAVLTTTLTALPLTGQKFLPEGFNLDTANTDAYRAAGAIPGIQRLLAVGNV
FTSH_MYCPE       NLLVDGSGNVYKNK---------------DNNGSTTSGTTTFSLNSNLTSAMKLQGWSSN
FTSH_UREP2       -------------------------------FKLGETNIYAPISGNTNNQWNWLTSIITQ
FTSH_MESFL       --------------------------------------------FETIMADKPY----PW
FTSH_MYCPU       ISW------------------------------FTFMNKF-----LAQHPGYDASKAGLF
FTSH_MYCS5       LT-------------------------------------------------ANNVSGSLK
FTSH_MYCMO       NT------------------------------------------------SASGIGTLNF
FTSH_MYCA5       LAM------------------------------ILGYSE----------NGVTKAGEFLS
FTSH_MYCCR       QKI------------------------------NNALSLVGAGQSVSKNTIVNANLPVIF
FTSH_AYWBP       -VFEKK-----------------------------------------PNGKYKYNTYSVD
FTSH2_PHYMT      NLSQMI-----------------------------------------TKIKEKTNLIPLQ
FTSH3_PHYMT      -FHAEI-----------------------------------------IKNTKEELSFELL
FTSH1_PHYMT      -WYAVV-----------------------------------------DSIFFHEIHSLIK
FTSH_ACHLI       -LYGDR-----------------------------------------LNNIQDIIITYNE
FTSH2_THEPX      ------------------------------------------------------------
FTSH_AQUAE       ---------------------------------TNLVDKMVE------KGVRVEVANPE-
FTSH_HYDS0       ---------------------------------TSIIDEMIK------DGVKVKASPSSG
FTSH_ECOLI       --------------------------------DPKLLDNLL------TKNVKVVGEPPEE
FTSH_SHIFL       --------------------------------DPKLLDNLL------TKNVKVVGEPPEE
FTSH_ECO57       --------------------------------DPKLLDNLL------TKNVKVVGEPPEE
FTSH_SALTI       --------------------------------DPKLLDNLL------TKNVKVVGEPPEE
FTSH_SALTY       --------------------------------DPKLLDNLL------TKNVKVVGEPPEE
FTSH_BUCAI       --------------------------------DPKLLDNLL------VKRVKIIGAIPEE
FTSH_BUCAP       --------------------------------DPKLLDNLL------TKNVKIVGEIPEE
FTSH_BUCBP       --------------------------------DPKLLDNLL------VKNVKIIGAAPEE
FTSH_PHOPR       --------------------------------DQKLLDDLI------NANVKVLGTPPEE
FTSH_HAEIN       --------------------------------DKKLLDDLL------SKKVKVEGTPFER
FTSH_MAGMM       ---------------------------------YDLTKDLL------AHGVDIDVREPEG
FTSH_CUPMC       ---------------------------------IWMVGDLM------KYGVQVTGKADDE
FTSH_RICCN       --------------------------------PD-LVNRLT------SNDVNIEVVPLET
FTSH_RICFE       --------------------------------PD-LVNRLT------SNDVNIEVVPLET
FTSH_RICPR       --------------------------------PD-LVNRLT------SNDVNIEVVPLET
FTSH_RICTY       --------------------------------PD-LVNRLT------SNDVNIEVVPLET
FTSH_RICBR       --------------------------------PD-LVNRLN------NNDVNIEVVPPET
FTSH_NEORI       --------------------------------TE-LIPLLR------KNNVDFQVASGDS
FTSH_BARBK       --------------------------------PG-LVQRLN------TNKVNIRAVPESS
FTSH_CAUVN       --------------------------------SEELVNRMV------AKNADVKFK---S
FTSH_ZYMMN       --------------------------------PL-LVQRLQ------SKNVTFRALPEDT
FTSH_HALO1       Y----------------------------GEYKGTIENLLT------AAGISYEVKAKEE
FTSH_MYXXD       ---------------------------------AAMLNQLR------SNGVDVKYEREEQ
FTSH4_SORC5      --------------------------------ADEITKTIV------DNKVAVFFEKEDT
FTSH1_BDEBA      ---------------------------------DEGYKFLQ------QHGITPNYERADN
FTSH_ACIC5       -----------------------------------LYDILN------KNHVAVTVK-DNS
FTSH_AKKM8       E----------------------------VPFTLEFQGDRV------KQLLGPDTKFKRE
FTSH2_METI4      D----------------------------LEFNRDLKQFLA------SKGF-PEIDVKVI
FTSH_LEPBJ       V----------------------------APLDKDLIASLR------KANVSFDARSAEE
FTSH_BORBZ       --------------------------------DINLLSELK------NKKVELSSG---K
FTSH_PELPB       --------------------------------TLEQADMLT------EKGVRLKVE---K
FTSH_UNCTG       --------------------------------PNLVKDMED------NKVLEFSAT---E
FTSH_SYNAS       ---------------------------------PGLEAFLI------SNGVEISAKPIHE
FTSH_THET1       ---------------------------------DQLMSQLD------QKGVIVNVQPESS
FTSH3_CONWI      ---------------------------------DELSKLLQ------DNDVTVNASPADN
FTSH_MARHV       ---------------------------------PELLPLLE------RQEV-LVRGSR-S
FTSH_NITOC       ---------------------------------PELMKLLE------QKGV-VVQAKS-E
FTSH_HAHCH       ---------------------------------EAILAELE------EQNI-PLEVKEGH
FTSH4_SPHTD      ---------------------------------TELVPLLQ------SHGV-TVKIDQ-A
FTSH2_THERP      ---------------------------------AEVTAFLQ------QHNV-LLKVQP-S
FTSH_PELCD       ---------------------------------TRLLDDLE------QRKV-DVKVRPES
FTSH_PELPD       ---------------------------------QTLVPELM------ARKV-EVSALSTE
FTSH1_RHOBA      ---------------------------------VQLSEDLE------KRNIKDWKFSPPD
FTSH2_SALRM      ---------------------------------EQLMDLLE------SQGVNVVTKPE--
FTSH_BACPE       A----------------------------ELLFNAEDPTG--------TPFNLEIEPAD-
FTSH_BACSU       A----------------------------DQIFNALKKT------------DVKVEPAQ-
FTSH_STAHJ       L----------------------------QKITNEAKSQ---------KGLDFKVKEEE-
FTSH_STRPN       V----------------------------SELQKLATDH----------KAEVTVKHES-
FTSH_STRR6       V----------------------------SELQKLATDH----------KAEVTVKHES-
FTSH_LACPL       V----------------------------DQVSKLAAKH----------DVKVTAKAEE-
FTSH_LACPJ       V----------------------------DQVSKLAAKH----------DVKVTAKAEE-
FTSH_LEUMM       L----------------------------KSVTDAATKT----------KTELVTKQAE-
FTSH_OENOE       L----------------------------KQITTAAQKA----------GVAVNPKPAA-
FTSH_LACLA       V----------------------------KDIQNAAKSN----------DVKLSVVQAS-
FTSH2_ALKMQ      R----------------------------LTLIIEEKIDQ--------EGLRVSAAPPP-
FTSH1_THEPX      -----------------------------FMSFVNPYILQ--------GKLDFKSEPQV-
FTSH_CALBD       -----------------------------FLDQIQPAIQA--------KKIQIVTKEPP-
FTSH_RUMCH       A----------------------------SERFTAALDNK--------LIEDFHVTQPP-
FTSH_CLONN       Q----------------------------DILVN---NPK--------SSVNVKFEPAS-
FTSH_VEIPT       ---------------------------------LIKTLQD--------NGVEITAAPPE-
FTSH_HALOH       -----------------------------PDLMAELREAD--------VEIKTEPEP---
FTSH_NATTJ       -----------------------------PELIETLKEYE--------VNIKDHEVP---
FTSH3_SYMTH      -----------------------------QAPLVEMLQQH--------PNIKLDFRQDN-
FTSH_MYCTU       Y----------------------------AVDLFNALSA--------KNA-KVSTVVNQ-
FTSH_MYCTA       Y----------------------------AVDLFNALSA--------KNA-KVSTVVNQ-
FTSH_MYCBO       Y----------------------------AVDLFNALSA--------KNA-KVSTVVNQ-
FTSH_MYCLE       Y----------------------------AVDLFNALSA--------KNT-KVTTAVNE-
FTSH_RHOE4       A----------------------------SEQIFDKVEG--------AGADKFNTTVTQ-
FTSH_CORGL       T----------------------------APAIFEKVEA--------SNTDSYTTNVTQ-
FTSH_ROTMD       R----------------------------GDEVAKAMES-------AEL-ESYTDQPVE-
FTSH_TROWT       R----------------------------ATEIVNAVNK-------AKIKDGFTDEVPA-
FTSH_BRAFD       R----------------------------GDAVVQAVED-------AAPAKGYTDEIAS-
FTSH_CUTAS       Q----------------------------SDQLVDRLNDRVK----AKTLKSWQGENPG-
FTSH1_CONWI      -----------------------------GNTLVGQLER---------ERVAFDIEGTK-
FTSH_RUBXD       -----------------------------GYDIARVLNE---------ANIPFTTDPQT-
FTSH_SLAHD       -----------------------------QDSLMELLS----------AHPEVEYQVTL-
FTSH_PORPU       A----------------------------PELITKLRKAN--------VDLDAHPPKST-
FTSH_PYRYE       A----------------------------PELITKLRKAN--------VDLDAHPPKST-
FTSH_GUITH       A----------------------------PELITKLRKAN--------VDLDAHATNDS-
FTSH2_SYNY3      A----------------------------PELIARLRDSN--------IRLDSHPVRNN-
FTSH_NOSS1       N----------------------------NELINRLKEKN--------VDFGEISSANS-
FTSH1_SYNY3      N----------------------------PELLNLLRSRSE------TIDLDINRTPDN-
FTSH_TRIEI       V----------------------------PELLDQVRAQK--------IDFELKRSPDN-
FTSH_CYACA       S----------------------------SELVSKLKNKL--------IDFDAHPSSSN-
FTSH_CYAM1       S----------------------------SDWLEQAKTLH--------IDVDVHAVS---
FTSH_TRICV       A----------------------------SQLIQKLKEYN--------IDFDAHPAEQK-
FTSH_VAULI       D----------------------------SPLIVKLRTAK--------VDFTAHSTINS-
FTSH_HETA2       S----------------------------TSLIGKLKEAN--------VDINAHPPKLDI
FTSH_ECTSI       N----------------------------SSLILTLRDYK--------IDFTAYPIVNF-
FTSH3_SYNY3      D----------------------------PDLINILTQHN--------VDIAVQPQSDE-
FTSH_SYNJB       T----------------------------PEFENTLVANG--------VELAVRPVQEE-
FTSH1_SPHTD      L----------------------------EQYGLSGAD----------VEIRVNPASQW-
FTSH1_THERP      L----------------------------KTFGIDPQQ----------VDIQTHRASQW-
FTSH_CHLAD       L----------------------------ADYGVPLRNEQGQ----RTINVIVQPAPAW-
FTSH_PSELT       -----------------------------SETIKVLSEK----------GVRVTGEKGV-
FTSH_THEMA       -----------------------------SQLIEKLVSK----------GIKVSGERSG-
FTSH_KOSOT       F----------------------------QNYIDQLVTD----------GVNVVYEKGN-
FTSH2_PETMO      -----------------------------QAYVRALAND----------GIKVEYIQNT-
FTSH3_PETMO      -----------------------------QQYVYGLANQ----------GIEIKYVRSL-
FTSH1_PETMO      -----------------------------KQYVNSLIQK----------GIKVEYVESV-
FTSH_HELPY       --------------------------------DLTLVPLLDE-----KKINYSGFSESN-
FTSH_HELPJ       --------------------------------DLTLVPLLDE-----KKINYSGFSESN-
FTSH_HELFC       --------------------------------DLSLVPLLDS-----QKINYSGFSESN-
FTSH_SULNB       --------------------------------DRDLIPLLDK-----KKISYEGVVGNG-
FTSH_ATOPD       -------------------------------NDSTLVQTLRE-----HKVDFSASIPDNS
FTSH_CLOP1       A----------------------------GITQPELIKDLTV-----AGVEFNVTKPEN-
FTSH_TREPA       ----------------------------------SFLSMLDE-----RQVVYSIKPRER-
FTSH_PARD8       V----------------------------KIPSADKFSDFYDKAVADSHIDTQVRFEEGD
FTSH_SULMD       F----------------------------EIGDLQLFQKKIDFYKELYEINPNFEFKNYK
FTSH_RHOM4       P----------------------------ADHDLTSFLLAYNERARAEG-RPTVQFTARI
FTSH1_SALRM      P----------------------------TAHELTAFLRRHNEAATGTG-TAPVTFAATQ
FTSH_PELLD       T----------------------------PENEVTVNPVRDESLTALLE-THGVRYEGSP
FTSH4_SYNY3      -------------------------------FDLELPKRLEA-------KGIEFAAAPPA
FTSH_ACAM1       -------------------------------IDLELPKFLRE-------HDVQYFAPPPS
FTSH_ANAD2       ----------------------------------DLVQAVEK-------AGVPYDAV--A
FTSH2_SORC5      ----------------------------------DLLADLDR-------RGIPYTRV--A
FTSH_PARP8       -----------------------------------LAQSLTN-------ENVTFSGE--P
FTSH_PSEP1       -----------------------------------LSEQLGR-------SGVAFSGV--V
FTSH2_BDEBA      -----------------------------------LAKELSG-------AGVTYRRE--I
FTSH_METPP       -----------------------------------MAERMSH-------YGVSYRRV--R
FTSH_RALPJ       ---------------------------------PELVQELEA-------AKVRFVGQ--P
FTSH_SYNFM       ---------------------------------PELVKQLEA-------KNIRFSGD--V
FTSH_BURP1       ---------------------------------ERLIDTLAA-------TGTRYRGA--D
FTSH_PIRSD       ----------------------------------DIETAIRN-------SNIPFRHA--D
FTSH2_RHOBA      FLTIRGYPN--------------------DLIAAELEDLLVQ-------SGVKWDND--R
FTSH_METCA       ---------------------------------HELAAELEK-------KGVKYTVRY-G
FTSH1_METI4      ---------------------------------PDLVKRLQS-------AGVVYGSV--K
FTSH_ACIFD       ---------------------------------PYTSSEL-STLSKAHVQVSYITPGPGI
FTSH_ACIC1       ---------------------------------GLAGSQLLNELENNGVQISARPPGPSL
FTSH1_SORC5      ---------------------------------GVEDEPLVRALLDKQVRIEAKSPQ---
FTSH1_SYMTH      ---------------------------------PGE-ARLPLVLMQYGARVEFVRPA---
FTSH_OPITP       ---------------------------------AEVTALRTQHFAEDDPVSYAAARAVSA
FTSH3_SORC5      ---------------------------------PTLRQELVSRFAGAGASVDFASREDPS
FTSH2_SYMTH      ---------------------------------PPDAAGLAERLEEAGVEQRYEVTRTPW
FTSH2_SPHTD      ---------------------------------LTDAGIPVERWPDIYPAGNGAISAD--
FTSH3_SPHTD      ---------------------------------LALGSLSV-------------------
FTSH2_CONWI      ---------------------------------GAQTATLSSALERGGAIVAVKQQPGKA
FTSH_THET8       ---------------------------------PPDNATLEGWMARG---VSVRVEP--P
FTSH_LEPBD       E--------------------------------PNIISAIGQ------KKVKLNSLQPSG
FTSH_STRM9       D--------------------------------TYLMEISKE------KNVNIVVLGTPV
FTSH1_ALKMQ      ----------------------------------------------TDSLKENLLLHGIQ
FTSH_LACP7       ----------------------------------------------TENFTEFLLLRNIK
                                                                             

FTSH_MYCGE       IAPDTRARDVLNGLFGLLP-IIIFVVFFLLFWRSA------------------RGISAGG
FTSH_MYCPN       VAPDTRARDVLNIFFGLLP-IIIFVIFFLLFWRSA------------------RGISGGG
FTSH_MYCGH       QLPNQSTAILTQFLTSIIPFVILIVIYIVIARRFS------------------RTMGAGG
FTSH_MYCPE       QSMSLPTSYSFYTAASLVLSILPFILLIGIIYYSM------------------RKMGQAG
FTSH_UREP2       NAGIPSSGFNPQVIISPLISIIFFIIFLYIILRVS------------------KAQS---
FTSH_MESFL       PALVYQGSVGMALLVSLAPLLIYVLLFGGIIWFMM------------------KSSSGAG
FTSH_MYCPU       GQHIVQENGFITFIKAIWFPALIAIIIFLGYKAQS------------------RAASG--
FTSH_MYCS5       SVATPQPNPFLGILISSVPVLILIFVMVWIYRSQV------------------KMMNGQG
FTSH_MYCMO       SGLVTPTNQALAILLSLIPTFLFVGIIFFVYKMQS------------------KANGGM-
FTSH_MYCA5       TGAPTESIWSTVLRYGTNIIFLLLFAASFIFMFMS------------------FRSQRGT
FTSH_MYCCR       NFDRPRGNFLSSFIVPYIPFLLISLFGFWLFFRLS------------------QNSQAGG
FTSH_AYWBP       PRPWNGYEHVFWVFRQCLTMLFFYCFFLFFADTIK------------------QMGQEIL
FTSH2_PHYMT      RIPYQPY-FGFAPFISAVNICILIIIFYFIYNSIE------------------KTSAQI-
FTSH3_PHYMT      PRNKISYQYEFRPFSWLLSIFSILLNFINVLSSLV------------------FTIYIFL
FTSH1_PHYMT      GRENIQIKDPKTDFH----LSELILSLVPIVSSTI------------------FMFYIIS
FTSH_ACHLI       LNPSTPITVSFVPHVS-VDFWNIISTLLLIAAPIV------------------LVVIMFR
FTSH2_THEPX      ---KPNLNLNLSFILTAAVIVVTYLLFKNKFSELM------------------PVNY---
FTSH_AQUAE       ----PPGGWLVNVFLSWLPILFFIGIWIFLLRQMSGGGN-------------VNRAFNFG
FTSH_HYDS0       GDISSSGNWLVSMLISWFPVLLFAGIWILMMRQMGNGG--------------PTRAFSFG
FTSH_ECOLI       -----PS-LLASIFISWFPMLLLIGVWIFFMRQMQ-GGGG-------------KGAMSFG
FTSH_SHIFL       -----PS-LLASIFISWFPMLLLIGVWIFFMRQMQ-GGGG-------------KGAMSFG
FTSH_ECO57       -----PS-LLASIFISWFPMLLLIGVWIFFMRQMQ-GGGG-------------KGAMSFG
FTSH_SALTI       -----PS-LLASIFISWFPMLLLIGVWIFFMRQMQ-GGGG-------------KGAMSFG
FTSH_SALTY       -----PS-LLASIFISWFPMLLLIGVWIFFMRQMQ-GGGG-------------KGAMSFG
FTSH_BUCAI       -----PS-LFISILISWFPMLLLIGVWIFFMRQMQ-MGGG-------------KGAMSFG
FTSH_BUCAP       -----PS-LLISIFISWFPMLLLIGVWIFFMRQMQ-MGGG-------------KGAMSFG
FTSH_BUCBP       -----QS-FFTAIFISWFPMLLLIGVWVFFMRQMQ-VGGG-------------KGAMSFG
FTSH_PHOPR       -----PS-LLASIFISWFPMLLLIGVWVFFMRQMQ-GGGGG------------KGAMSFG
FTSH_HAEIN       -----RG-FLSQILISWFPMLFLVGVWVFFMRQMQ-GGGG--------------KAMSFG
FTSH_MAGMM       -----TP-MLMQILISWFPMLLLIAVWIYFMRQMQ-SGGG-------------RGAMSFG
FTSH_CUPMC       -----PN-VLVQALYYLGPTLLIIVFWFYMMRQMQ-GGGK-------------GGAFSFG
FTSH_RICCN       -----RMNTFLGFLISWFPMLLLIGVWVFFMRQMH-GGG---------------KAMGFG
FTSH_RICFE       -----RMNTFLGFLISWFPMLLLIGVWVFFMRQMH-GGG---------------KAMGFG
FTSH_RICPR       -----RMNTFLGFLISWFPMLLLIGVWVFFMRQMH-GGG---------------KAMGFG
FTSH_RICTY       -----RMNTFLGFLISWFPMLLLIGVWVFFMRQMH-GGG---------------KAMGFG
FTSH_RICBR       -----RMNTFLSFLISWFPMLLLIGVWVFFMRQMH-GGG---------------KAMGFG
FTSH_NEORI       -----FLGLLFNILISWFPMLLLIGVWIFFMKQMQ-AGGN--------------KTMTFG
FTSH_BARBK       -----GNSIFLNLLFSLLPVLIIVGAWIFFMRQMQ-GGSR--------------GALGFG
FTSH_CAUVN       -----GSISFLAILVQLLPILLVVGVWLFLMRQMQ-GGAK--------------GAMGFG
FTSH_ZYMMN       -----VSFWQILLSQFLLPFILFVGLGFLFVRQMQKNGGG--------------GAMGFG
FTSH_HALO1       -----ST-FWQSLLISWLPMLLLFALFFFFMRQLQAGGGK---------------AMSFG
FTSH_MYXXD       -----NS-LWLTILGQWMPVVFLFLFFIFFMRQLQGGSGK---------------AMTFG
FTSH4_SORC5      -----SP-FWPGAIMYLLPTVFLLVMFYLFMRQLQAGGGK---------------AMSFG
FTSH1_BDEBA      -----GG-FFQSLLVNWLPLILIVAMFLFIMRQIQAGGGK---------------AMSFG
FTSH_ACIC5       -----GS-PWWSILIQFSPVLVLVALWFFMIRQMQSGGNK---------------ALSFG
FTSH_AKKM8       -----SG-SWGGILLNLLPIVLILVILFFMFRAQSG-GAR--------------GAMSFG
FTSH2_METI4      -----HN-FWGQAFLSVLPFLLFILALYFLFRQQIRMAGR--------------GAFSFG
FTSH_LEPBJ       -----GK-FWSVIGSNILLIVILIGLFWFIMMRQIQSTGN--------------KAFSFG
FTSH_BORBZ       -----SQASLIGVLLQTLPWILFFIFFFFIFRQTQGGGG---------------KVFTFG
FTSH_PELPB       -----GSSDLNTFLALFAPWIIFAALYFFLFRRMSGQNGAQ----------A-KNIFSFG
FTSH_UNCTG       -----KSGWLGSLLLNWGPVVLLILFCFWMMRGMSMGNK---------------QAMSFG
FTSH_SYNAS       -----ERSPWATIVYSFGPGLLFIAFYIWLFRRMAQQGGL------------GGGIMGIG
FTSH_THET1       -----TRSLLLSILISFGPTILFFLLFLWLISKAQSS---------------QQGLFGLG
FTSH3_CONWI      -----GPSLLVSILLGFGPVILIIALFVFLSRRMAGAA--------------GGGMMSFG
FTSH_MARHV       -----GRPWWQELILGFLPWILLLALMFWFWGAAQKRMTQG----------G--GPFDYG
FTSH_NITOC       -----EPSLWMQAIIGILPWFLILGLIFYVSYRMQQRMMGG----------GRGGPFGFG
FTSH_HAHCH       -----DASSSKVILLSYLPWIMFMIILFWLSRRTFRNFSGR----------G--GAFDFD
FTSH4_SPHTD      -----GGSVWPSLLATIVPLFLFIGLMVYLGRSMSRGQ---------------QNVFSFG
FTSH2_THERP      -----GGASLPGLLLSVLPFVFLIGLLFLLGRNLSRGQ---------------QNVFSFG
FTSH_PELCD       -----KPSPWATAMIYMLPWLLIVGVWWFVIKGMRTRQGPG----------GG-MMGGFS
FTSH_PELPD       -----TP-LLLNALIYVAPWVILIAIWWVGMRSMRS-QGPS----------G--MMGGFS
FTSH1_RHOBA      -----NTAAILNLLILVGLPLAIFFFIFMMIRRTRNDMMGG----------G--FLSGFS
FTSH2_SALRM      -----SSFPWGLVIMGLLPVLLLFGVGYIFLRRMQSQG---------------QGLFSVR
FTSH_BACPE       -----ETSGWVQFFTGIIPFIIIFILFFFLLSQAQ-------------GGGS--RVMNFG
FTSH_BACSU       -----ETSGWVTFLTTIIPFVIIFILFFFLLNQAQ-------------GGGS--RVMNFG
FTSH_STAHJ       -----KQSVFVSMLTTLIPVLIIAFLFIFFLSQAQ-------------GGGGGGRMMNFG
FTSH_STRPN       -----SSGIWINLLVSIVPFGILFFFLFSMMGNMG-------------GGNGRN-PMSFG
FTSH_STRR6       -----SSGIWINLLVSIVPFGILFFFLFSMMGNMG-------------GGNGRN-PMSFG
FTSH_LACPL       -----SSGIWVTLLMYIAPVILMLFLFYMMMGQAG-------------QGGGNNRVMNFG
FTSH_LACPJ       -----SSGIWVTLLMYIAPVILMLFLFYMMMGQAG-------------QGGGNNRVMNFG
FTSH_LEUMM       -----NSGFWLNLLVSLVPVLLIVAVFYLMMNQAG------------GGKGGQGGMMSFG
FTSH_OENOE       ------SNFWGSMLTLILPTLIMFALLYWMLIGSQRGQ---------GGSGGPGGIMSFG
FTSH_LACLA       -----SSGMWVQILSYIIPMLLFVGIFWLMMGGMGAR-----------GGGGGGNPMSFG
FTSH2_ALKMQ      -----TTPWFIELLPSIFMVLIFIVFWFVFMQQSQ--------------GGG-NRVMSFG
FTSH1_THEPX      -----GPPWWVQMLPSLFLIVIFIIFWYIFMQQAQ--------------GGGGSKVMSFG
FTSH_CALBD       -----QVPWWLSTFLPMLIFAGLMIFVWIFMLQQT--------------QGGGSKIMSFT
FTSH_RUMCH       -----QPPWWVSMLPTVGLVIILILIWFFFIQQSQG------------GGGGNR-VMSFG
FTSH_CLONN       -----SMPMWISWIPTIILILVMVGFWVMFMQQSQG------------GGGGNRGVMNFG
FTSH_VEIPT       -----QPAWWMSLLGSAIPIIILVVLFFFIMQQTQ---------------GGGGRVMNFG
FTSH_HALOH       -----TAPWWTGMLAYILPIILLIGAWFFIMQRMQ---------------GGGSQMMSFG
FTSH_NATTJ       -----GPPWWASLFTYIIPFVLLIAIFFFFMQQSQ---------------GGGGRMMNFG
FTSH3_SYMTH      -----TSGIWAMLLQTLVPVVLVLLAFFFIMQQTQ---------------GSGNRVMQFG
FTSH_MYCTU       ------GSILGELLVYVLPLLLLVGLFVM-FSRMQ-------------GGARMG--FGFG
FTSH_MYCTA       ------GSILGELLVYVLPLLLLVGLFVM-FSRMQ-------------GGARMG--FGFG
FTSH_MYCBO       ------GSILGELLVYVLPLLLLVGLFVM-FSRMQ-------------GGARMG--FGFG
FTSH_MYCLE       ------GSILGELLVYVLPLLLLVGLFVM-FSRMQ-------------GGARMG--FGFG
FTSH_RHOE4       ------ESWLTSILLFVLPMIILFGIFFFVMNRMQ-------------GGGGRGGVMGFG
FTSH_CORGL       ------ESFLMSMLSFILPMVIIFGLLMFFLTRMQ-------------GG---G-MFGIG
FTSH_ROTMD       ------HSFLGSLVSLLLPILLFGVLFWFLMG-RV-------------GGGSS--VMSFS
FTSH_TROWT       ------PSVWGSIISMLLPIAAIGLFLWFMAGPQA-------------AGGRG--IAQFS
FTSH_BRAFD       ------SSWWSTLLLSFLPLLIFIGLFWFLIMNAQ-------------GGGK---AMQFG
FTSH_CUTAS       ------QSIWKALLINFLPFVIILLFFLWAMNAAQ-------------GMGGRGGVMGFG
FTSH1_CONWI      ------SNGWLSLLTYVLPFLIFIGFWIFLMNQVQ-------------GGG--SKVMSFG
FTSH_RUBXD       ------AGPWARAIAVMAPFVLILLLFFLMTRTGR-------------SASQSSRMTDFG
FTSH_SLAHD       ------PSNVTEILISVLPMLLFAGLLIYFFSQMS-------------KAN--NSQMSFG
FTSH_PORPU       ------SAVWGLLGNLLFPLILVGGLAFLFRRSNN-------------ASGGPGQAMSFG
FTSH_PYRYE       ------SAVWGLLGNLLFPLLLVGGLAFLFRRSNN-------------ASGGPGQAMSFG
FTSH_GUITH       ------TPAWSLIGNLIFPILLIAGLAFLFRRSSN-------------LPGGPGQAMNFG
FTSH2_SYNY3      ------GMVWGFVGNLIFPVLLIASLFFLFRRSSN-------------MPGGPGQAMNFG
FTSH_NOSS1       ------RAAVGLLINLMWILPLVALMLLFLRRSTN-------------ASS---QAMNFG
FTSH1_SYNY3      ------SALYGLLTNLLVVAILIGLVVMVVRRSAN-------------ASG---QAMSFG
FTSH_TRIEI       ------SVAMGIIFNILIVFVVIVVLLAILRRSSQ-------------SQG---NALNFG
FTSH_CYACA       ------VNLVSWLSNLLLPLILIITLFFFFRRGNK-------------SSSGPGQAFNFG
FTSH_CYAM1       -------NWINVASNWIIPLIIIGVVIWLLSRS---------------ASSNTTGALNFG
FTSH_TRICV       ------NIFVNILSNILLPIIFITGLVYLFQNSEN----------FG--GGSGQSPMSLG
FTSH_VAULI       ------KGIFTQLSNIFIPLIIIIGLIFLFRRSTN----------FM--SGPGQ-LMSFR
FTSH_HETA2       -----FKTISDTLGSLIVPGLVVAVFYLFLERANNNNNNNSNGSPFGPGGGPNQNMRGLG
FTSH_ECTSI       ------DSIWPILSVLLIPVLLIVVYRLFFSEGSN-----------------YDFFGNLR
FTSH3_SYNY3      ------GFWFRIASTLFLPILLLVGIFFLFRRAQS---------------GPGSQAMNFG
FTSH_SYNJB       ------GLLGRILSTFFLPVLLLLGLFFLLRRAQN---------------GPGSQALNFG
FTSH1_SPHTD      ------GNWLSAL-TFILPTLFLIGIVIFMMRQAQ---------------GTNNQAISFG
FTSH1_THERP      ------GNVLGTL-TFLLPTLFLIGVIIFMMRQAQ---------------GTNNQALSFG
FTSH_CHLAD       ------GGLLSIF-TILLPTLLLIGFFVFFMRQAQ---------------GSNNQAMSFG
FTSH_PSELT       -----SSSFWVNVIGNVIFIGFLLFMFFFMMRTIS---------------GRNNQAFTFT
FTSH_THEMA       -----SSSFWINVLGTLIPTILFIVVWLFIMRSLS---------------GRNNQAFTFT
FTSH_KOSOT       -----DSLFWVNLLGTIIPLAIIVFIWFFAMRSLS---------------GRNSQAFTFT
FTSH2_PETMO      -----GASWWVTMLIYMLPLIILMFFWFWMFRRSGT--------------GEGIPGANYR
FTSH3_PETMO      -----ENSWWISILTFLLPVFLLIFLFTFLFRSSG---------------GGANQGMNFI
FTSH1_PETMO      -----GTKWWFGLLINIIPIVVMVLFFFWLYRSAS---------------AGARSSMNFG
FTSH_HELPY       --------FFTDMLGWLMPILVILGLWMFMANRMQKNMG--------------GGIFGMG
FTSH_HELPJ       --------FFTDMLGWLMPILVILGLWMFMANRMQKNMG--------------GGIFGMG
FTSH_HELFC       --------FFADILGWLLPVLVILGLWMFMASRMQKNMG--------------GGIFGMG
FTSH_SULNB       --------FFSELISMMLPILIFFAIWIFLAKKMSKGMG--------------GGILGAG
FTSH_ATOPD       -----ANMLMYALIQYGIPLIIFLGIGFFINRSLKRAMGD------------DGPSMNFG
FTSH_CLOP1       ------YQLLGLLMSWVFPLILIFFVGRMMFSKMNNKMG--------------GGVMSFG
FTSH_TREPA       -------NYLIETFQYLFPLLILFFVWRFFFKRMASNVSG------------LGSSIFSA
FTSH_PARD8       ------DAIWNFLVSFGPIILLIGV-WMFLMRRMSGGTGAG-----------PGGVFSVG
FTSH_SULMD       -----IYTVLNFFYDYGFFLMIIIICWIFIFRKIASRSSES-----------E-FKFKIG
FTSH_RHOM4       -----EENWFGGLLTWIFPLILIVALWVFLLRRMS--PSS--------------QVLNIG
FTSH1_SALRM      -----ESDWVGTLLLWGLPLGLIVGIWLFFMRRMA--TGG--------------REEQIG
FTSH_PELLD       -----GTTWISELIQWVLPFALLFGLYFFIFRRMG--AGGP-----------GAQFMNIG
FTSH4_SYNY3      -----KNSWFGTLLSWVIPPLIFVGIWSFFLNRNNN---GA-----------PGGALAFT
FTSH_ACAM1       -----SLSWLPTLLGWVVPPLIFFGIWSWLINRNQ----GA-----------GPAALTVG
FTSH_ANAD2       -----GGGMGDLFWVWIAPIAIGLLFWAWVMRRMSGQLGQG-----------PPGVMAFG
FTSH2_SORC5      -----DE-LGLPPYLWLLLPLAGLAAMGHLASRRATTAGTI-----------SGAATAFG
FTSH_PARP8       -----EPGPWPTILGWLMPIVGFALVWMFLIRPMSMGPGM-------------DGMMSIG
FTSH_PSEP1       -----EDNTVATVMGALMPLLMLLALWYFLFHGLGQKQGL-------------GGLMGVG
FTSH2_BDEBA      -----ENTFFRDLLSWVVPALIFVAVFLYFSRKFAEKGGM-------------SGLMSVG
FTSH_METPP       -----ESNWLSQLLSWMAGPLLLLGFWYFMSRRIDGQQGG-------------AGFLGIG
FTSH_RALPJ       -----DNKWLSTILSWVVPAVIFFGIWSFLIKRVGGAAGS---------------MMEIG
FTSH_SYNFM       -----QNPWLGLITWWLLPFAIMIFFWSFLMRRMGGGPQG---------------VLSVG
FTSH_BURP1       -----DDTWIGTLASWIVPIAVFALVWNLMLRRPRGGLQD---------------WSGVG
FTSH_PIRSD       -----PPGPWEQHSQLIIGMLLAAMLIYIVVRRL-SAAGS---------------PMSFG
FTSH2_RHOBA      -----PSRFLENHWPELLMIGVLVALGIVMLKRM-GGVGS---------------PMSFS
FTSH_METCA       -----SNWFSSLIFNWIVPIVLLTLFWTWMARRMTGGRGF----------------LSIG
FTSH1_METI4      -----PSLLSQILFSWVVPILIFFLVWFALARFMGGGGAG-------------YSLLNIG
FTSH_ACIFD       -----ASTIIEYVIFFGIFI------GIWVYLTRRT-QGSVN------------------
FTSH_ACIC1       -----ASQVLAGVLSFLPFLLLL---GLFAYSGRRAGAGFLA------------------
FTSH1_SORC5      -----TSVWMQVAIWMLPLVLIN---AAFFMMLRRAGQGAG-------------------
FTSH1_SYMTH      -----DPIAFRTLLRFIPPLLIL---GAILWFTRRTAGGSG-------------------
FTSH_OPITP       -----RERTASIVHAIVHPLGLITLIVGILFVVQRYAGRF--------------------
FTSH3_SORC5      -----RAASAVLPVVVLAAVGFA------LFTVSRRRSP---------------------
FTSH2_SYMTH      -----WVTLLPTVLWLAVMVGLF------AWAQKRQAGAFGL------------------
FTSH2_SPHTD      -------LMLLLRILTIVAVGVV------IFVLFRRFGPSSI------------------
FTSH3_SPHTD      ------------------AVGLA------VWQQ-RTLG----------------------
FTSH2_CONWI      -----QVTIVVQFLLPILLLVCL---FALFMRIGQDGGAGGI------------------
FTSH_THET8       -----QGQNALGFLWPLLLVGLL---IGALYYFSRNGRAGPS------------------
FTSH_LEPBD       ------GGFFLLLLGQFLPMIIMIGLMVYLAKKMVGGSQGGG----------PGNIFGFG
FTSH_STRM9       ------SSIITRAIFSFAPLFMLLFFFYFINKKMMG-SSGGV----------IGNPFNIG
FTSH1_ALKMQ      VRETTDQYSVVQVITFVVLIGGFIGVAIFLSKKNATQTSKEY------------------
FTSH_LACP7       VD-NSDSYSATKVIQIILIITVGTGVFLFIR----TSGGKDK------------------
                                                                             

FTSH_MYCGE       R------EEDNIFSIGKTQAKLAKSTVKFTNIAGLQEEKHELLEIVDYLKNPLKYAQMGA
FTSH_MYCPN       RS-----EEDNIFSIGKTQAKLAKSSVRFDNIAGLQEEKHELLEIVDYLKNPLKYAQMGA
FTSH_MYCGH       AIG---EDGENVFTIGKSQAKLAKSTFKFTDVAGIEEEKSELIELVDYLKRPGKYVQMGA
FTSH_MYCPE       GG------QDNVFSIGKSQAKLAKSTVLFSDVAGIEEEKEELIEIVDYLKRPDRYAAMGA
FTSH_UREP2       ---------DSLLGTNKANAKLTKSGVRFSDVAGIAEVKEELIEIVDFLKEPKKYVAAGA
FTSH_MESFL       AG------AGNIFGMGKNRARAEKSDVKFANVAGIEEEKSELVELVDYLKFPAKYAEAGA
FTSH_MYCPU       ----------GIFNPGKNQAVIVKTDKKFTDIAGNKEPIEEVQELVDYLKNPKKYAAAGA
FTSH_MYCS5       ----------GAFGGDKGTAQIIKSDKKFTDIAGNKEPIEEISEVVDYLKNPGKYQQSGA
FTSH_MYCMO       ----------GGFNPGKNQAERIYTKIKFSDIAGNEEVKEEVAELVDYLKNPKKYSASGA
FTSH_MYCA5       ----------GGLLDNKSVAQRIYSNKKFSDIAGNEEVKEEVKELVDYLKNPKKYSTAGA
FTSH_MYCCR       ----------GLFNPGKNQAIRIKSNKKFTDVAGNAEVKEEIAEFVDYLKNPKKYAAAGA
FTSH_AYWBP       AS----TSGKKGAKSR-KVIINHK-RFTFSDVAGADEEKEEMSELIDFLKNPRKYAAMGA
FTSH2_PHYMT      -------SGKNLNISRQKVLVNQQ-EFTFKDIAGADEEKEEMSELINFLKNPFKYEAMGA
FTSH3_PHYMT      AI----HRESGKLNSKSLITSKQKSLFTFKDVAGNTEEKEEMTELIDFLKQPQKYETIGA
FTSH1_PHYMT      NI----KKSSGKLNSNAKVSAKQKSLFTFKDVAGNTEEKEEMTELIDFLKQPQKYETIGA
FTSH_ACHLI       SMSS--QSNKAQDFTKNRAKLSQGRKVKFSDIAGADEEKAEMAELIDFLKNPKKYADMGA
FTSH2_THEPX      ----------NNITETKEDTSHRKTNITFKDVAGLDEVIDELKVIIDFMTNTEKYNKMGA
FTSH_AQUAE       -----------KSRAKVYIEE--KPKVTFKDVAGIEEVKEEVKEIIEYLKDPVKFQKLGG
FTSH_HYDS0       -----------KSKAKVYIEE--KPNVKLDNVAGMDEVKEEVAEVIEYLKDPARFRKLGG
FTSH_ECOLI       -----------KSKARMLTE--DQIKTTFADVAGCDEAKEEVAELVEYLREPSRFQKLGG
FTSH_SHIFL       -----------KSKARMLTE--DQIKTTFADVAGCDEAKEEVAELVEYLREPSRFQKLGG
FTSH_ECO57       -----------KSKARMLTE--DQIKTTFADVAGCDEAKEEVAELVEYLREPSRFQKLGG
FTSH_SALTI       -----------KSKARMLTE--DQIKTTFADVAGCDEAKEEVAELVEYLREPSRFQKLGG
FTSH_SALTY       -----------KSKARMLTE--DQIKTTFADVAGCDEAKEEVAELVEYLREPSRFQKLGG
FTSH_BUCAI       -----------KSKARMLSE--DQIQTTFADVAGCDEAKEEVSELVEYLKEPSRFQKLGG
FTSH_BUCAP       -----------KSKARMLSE--DQIQTTFADVAGCDEAKEEVSELVEYLKEPSRFQKLGG
FTSH_BUCBP       -----------KSKARMLPE--DQVKITFSDVAGCDEAKEEVQELVEYLKEPSRFQKLGG
FTSH_PHOPR       -----------KSKARMMSE--DQIKTTFADVAGCDEAKEDVKELVDYLRDPSRFQKLGG
FTSH_HAEIN       -----------KSRAKMLNQ--DQIKVTFADVAGCDEAKEEVGEIVDFLRDPNKFQNLGG
FTSH_MAGMM       -----------KSKAKLMSD--KAAKVTFQDVAGIEEAKEELQEVVQFLKDPHKFQRLGG
FTSH_CUPMC       -----------KSRARLIDE--NQNAVTFADVAGCDESKEEVVELVDFLKDPQKFQKLGG
FTSH_RICCN       -----------KSKARLLSD--KGPKITFKDVAGIDEAKEELTEIVDFLRDPSKFQKLGG
FTSH_RICFE       -----------KSKARLLSD--KGPKITFKDVAGIDEAKEELTEIVDFLRDPSKFQKLGG
FTSH_RICPR       -----------KSKARLLSD--KGPKITFKDVAGIDEAKEELTEIVDFLRDPSKFQKLGG
FTSH_RICTY       -----------KSKARLLSD--KGPKITFKDVAGIDEAKEELTEIVDFLRDPSKFQKLGG
FTSH_RICBR       -----------KSKAKLLSD--KGPKITFKDVAGIDEAKDELTEIVDFLRDPSKFQKLGG
FTSH_NEORI       -----------KSKARLLSD--RSNKVTFHDVAGIDEAKEELAEIVEFLREPKKFQKLGG
FTSH_BARBK       -----------KSKAKLLTE--AQGRVTFKDVAGVEEAKQDLQEIVDFLREPQKFQRLGG
FTSH_CAUVN       -----------KSKARLLTE--NKNRITFEDVAGVDEAKEELQEVVDFLKDPAKFQRLGG
FTSH_ZYMMN       -----------KSRARLLTE--KQGRVTFKDIAGIEEAREELEEIVDFLKDPTRFSRLGG
FTSH_HALO1       -----------KSKARLLTD--HQNKVTFKDVAGVEEAKDEVEEIIAFLKDPKKFTRLGG
FTSH_MYXXD       -----------KSKAKLLSE--SHNKVTFADVAGADECKEELEEIVAFLKDPKKFTKLGG
FTSH4_SORC5      -----------KSRARLLSE--AQNKVTFADVAGIDEAKDELEEIIAFLKDPKKFQKLGG
FTSH1_BDEBA      -----------KSRARLLTE--HKNRVTFKEVAGVDEAKEDLQEIVSFLKDPKKYTKLGG
FTSH_ACIC5       -----------KSRARLLSM--QQKKVTFKDVAGVDEAKEELKEIIEFLREAQKFQKLGG
FTSH_AKKM8       -----------KSRARLISP--DKNKVTFKDVAGISEAKEEVWELVEFLRNPEKFRDLGA
FTSH2_METI4      -----------KSRARLLSG--GKTKVTFKDVAGVEEAKEEVQELVEFLKDPKKFQKLGG
FTSH_LEPBJ       -----------KSKAKMTMD--PKVKITFEDVAGCEEAKEELVEIIEFLKDPKKFHAIGA
FTSH_BORBZ       -----------KSNAQKYEA--GKNKITFKDVAGQEEVKQELREVVEFLKNPKKFEKIGA
FTSH_PELPB       -----------KSRAKMVSE--FEVKTTFKDVAGVDEAIEELQETVEFLTNPEKFQKIGG
FTSH_UNCTG       -----------KTKAKLAVG--ASKKITFKDVAGCDEAKEELQELIEFLKDPARFQKLGG
FTSH_SYNAS       -----------KSKARRYDQE-EGRKVTFDDVAGIDEAENELVEIVDFLKDPPKYTRLGG
FTSH_THET1       -----------KSRAKRYNAT-ESTRVTFDDVAGIEEAKQELAEIVDFLKNPQKYQRLGG
FTSH3_CONWI      -----------RSRARRSEGG-E-AQVTFRDVAGIDEAEAELNEIVDFLKNPQKYQRLGG
FTSH_MARHV       -----------KSRARRARR--ETSTTTLDDVAGIESAKRDISEIIDFLKSPDKYRRLGA
FTSH_NITOC       -----------KAPVKRFRE--GSIGVTFEDVAGVENAKRDLREIVDYLKEPGQFKAVGA
FTSH_HAHCH       -----------KRLETQFEC--QKPDTTFDEVAGQTNAKREVQELVEYLRDPDRFHRVGA
FTSH4_SPHTD      -----------RSKARVYDA--ERPRVTFADVAGEEEAKAELSEVVDFLRNPMKYHAIGA
FTSH2_THERP      -----------RSRARVYDV--ERPQVTFADVAGEEEAKAELAQVVDFLKNPAKYHRIGA
FTSH_PELCD       -----------KSGAKMYTK--ERSRVTFADVAGLDEAKQELMEIIEFLRNPKKFMRLGA
FTSH_PELPD       -----------RSGAKAYLAG-DKMAVSFKDVAGMEDSKQELKEVVDYLRNPKQFARIGG
FTSH1_RHOBA      -----------KSPAKRFEA--TDKVITFNDVAGLEGVKADLQEIVDFLKTPEKFQKLGG
FTSH2_SALRM      -----------QSKAELYDK--DEEDTTFDDVAGADSAKEELREIIKFLKNPKRFEGLGG
FTSH_BACPE       -----------KSKAKMVNED-K-KKAKFKDVAGADEEKQELVEVVEFLKDPRKFSAIGA
FTSH_BACSU       -----------KSKAKLYTEE-K-KRVKFKDVAGADEEKQELVEVVEFLKDPRKFAELGA
FTSH_STAHJ       -----------KSKAKMYDNQ-K-RRVRFSDVAGADEEKQELIEIVDFLKDNKKFKQMGS
FTSH_STRPN       -----------RSKAKAANKE-D-IKVRFSDVAGAEEEKQELVEVVEFLKDPKRFTKLGA
FTSH_STRR6       -----------RSKAKAANKE-D-IKVRFSDVAGAEEEKQELVEVVEFLKDPKRFTKLGA
FTSH_LACPL       -----------KTKAKPADSK-Q-NKVRFSDVAGEEEEKQELVEVVEFLKDPRKFVSLGA
FTSH_LACPJ       -----------KTKAKPADSK-Q-NKVRFSDVAGEEEEKQELVEVVEFLKDPRKFVSLGA
FTSH_LEUMM       -----------KSKAKPSDPK-D-NKVRFADVAGAEEEKQELVEVVEFLKAPKKFVNLGA
FTSH_OENOE       -----------RSKAKPADPK-Q-NKIRFADVAGEEEEKQELVEVVEFLKDPKKFTKLGA
FTSH_LACLA       -----------KSRAKQQDGK-T-SKVRFADVAGSEEEKQELVEVVDFLKNPKKYHDLGA
FTSH2_ALKMQ      -----------KSKAKLHKDD-EGKRITFDDVAGLDEEKAEVEELVDFLKNPKKYIELGA
FTSH1_THEPX      -----------KSRARMITDK-D-KRVTFNDVAGADEEKEELQEIVEFLKYPKKFLELGA
FTSH_CALBD       -----------KSRAKTIQDL-K-KKVTFADVAGADEEKEELKEVIDFLKNPRKYIELGA
FTSH_RUMCH       -----------KSRAKMTVDD-K-KKITFENVAGADEEKEELAEIVEFLKAPKKFVELGA
FTSH_CLONN       -----------KSRAKLATPD-S-QKVTFKDVAGADEEKGELEEIVDFLKEPKKYLDMGA
FTSH_VEIPT       -----------KSRAKLMGEG-N-VKVSFKDVAGAEEAKQELEEVVEFLKDPGKFTTIGA
FTSH_HALOH       -----------KSRARLSENG-KK--VTFEDVANYEEVKEELQEVVEFLKNPDKFTRMGA
FTSH_NATTJ       -----------KSKAKLHEGD-QKSNVKFHDVAGADEEKEELVEVVNFLKEPQKFIDLGA
FTSH3_SYMTH      -----------KSRARLVTDD-RK-RVTFDDVAGIDEVKEELAEIVDFLKHPKRYLELGA
FTSH_MYCTU       -----------KSRAKQLSKD-M-PKTTFADVAGVDEAVEELYEIKDFLQNPSRYQALGA
FTSH_MYCTA       -----------KSRAKQLSKD-M-PKTTFADVAGVDEAVEELYEIKDFLQNPSRYQALGA
FTSH_MYCBO       -----------KSRAKQLSKD-M-PKTTFADVAGVDEAVEELYEIKDFLQNPSRYQALGA
FTSH_MYCLE       -----------KSRAKQLSKD-M-PKTTFADVAGVDEAVEELYEIKDFLQNPCRYQTLGA
FTSH_RHOE4       -----------KSKAKQLTKD-M-PKTTFADVAGADEAVEELYEIKDFLQNPARYQALGA
FTSH_CORGL       -----------GSKAKQLTKD-M-PTNTFADVAGAEEAVDELHEIKDFLEDPTRYEALGA
FTSH_ROTMD       -----------KSRAKKFTKD-K-PEVRFSDVAGVDEALAELEEVREFLAEPEKFTRLGA
FTSH_TROWT       -----------RMRSRLVSKE-M-PKVRFTDVAGADEAVEELQEIKDFLSDPDKYRKLGA
FTSH_BRAFD       -----------KSKAKLFNKE-A-PKVTFADVAGADEAVEELDEIKQFLVDPGRYQAVGA
FTSH_CUTAS       -----------KSKAKVGSKD-T-PKSTFADVAGCQEAIDELQEIREFLAEPAKFQRVGA
FTSH1_CONWI      -----------KSRARRLSVD-S-PKITFRDVAGADEAVEELHEIKEFLENPKKFQALGA
FTSH_RUBXD       -----------KSRARRMTKD-Q-PKVTFADVAGADEAVQELTEIKEFLENPQKFQKLGA
FTSH_SLAHD       -----------KAKAKKTTEE-R-PDVRFSDVAGEDEAVEELQEIKDFLVNPGKYQKLGA
FTSH_PORPU       -----------KSKALFQMEA-K-TGVVFNDVAGVEEAKEEFQEVVTFLKQPESFTAVGA
FTSH_PYRYE       -----------KSKALFQMEA-K-TGVVFNDVAGVEEAKEEFQEVVTFLKQPESFTAVGA
FTSH_GUITH       -----------KSKARFQMEA-K-TGVTFNDVAGVDEAKEEFEEVVSFLKKPERFTAVGA
FTSH2_SYNY3      -----------KSKARFQMDA-K-TGVMFDDVAGIDEAKEELQEVVTFLKQPERFTAVGA
FTSH_NOSS1       -----------KSRARFQMEA-K-TGVKFDDVAGIEEAKEELQEVVTFLKQPERFTAVGA
FTSH1_SYNY3      -----------KSKARFQMEA-K-TGVGFDDVAGIDEAKEELQEVVTFLKQPEKFTAIGA
FTSH_TRIEI       -----------KSRARFQMEA-K-TGVLFEDVAGIEEAKEELQEVVSFLKKPEKFTAIGA
FTSH_CYACA       -----------KAKARFHMEA-K-TGIVFEDVAGIEEAKEELQEIVAFLKDSRKFTNVGA
FTSH_CYAM1       -----------KSKARFQMVA-K-TGIMFDDVAGIEEAKEELAEVVAFLKNPSKFLAVGA
FTSH_TRICV       -----------KSTARFERRP-D-TGVSFKDIAGIDEAKTEFEEIVSFLKEPDKYTIVGA
FTSH_VAULI       -----------KARAKVQTEI-N-TDVVFDDVAGIDEVKEEFEEVVTFLRKPQRFLSVGA
FTSH_HETA2       -----------EIKKEIQKEP-D-TGITFKDIAGIEEVKEEFEEIVTFLKDPSRFTAVGA
FTSH_ECTSI       -----------KARAKIQLDA-D-TGVLFSDVAGIDEAKQEFEEFVSFLKMPQLFTAVGA
FTSH3_SYNY3      -----------KSKARVQMEP-Q-TQVTFGDVAGIEQAKLELTEVVDFLKNADRFTELGA
FTSH_SYNJB       -----------KSRARVQMEP-K-TQITFNDVAGIDQAKLELAEVVDFLKNSERFTALGA
FTSH1_SPHTD      -----------KSRARMFTGN-K-PTVTFADVAGVEEAKEELVEVVEFLKYPDKFASLGA
FTSH1_THERP      -----------KSRARVFTSN-R-PTVTFDDVAGVDEAKEELQEIVEFLKYPEKFAALGA
FTSH_CHLAD       -----------KSRARMFAGD-K-PTITFADVAGQEEAKQDLAEIVEFLKFPDKFAALGA
FTSH_PSELT       -----------KSRAQMNRP--GQARVTFKDVAGVDEAVEELKETVLFLKDPGRFSKIGA
FTSH_THEMA       -----------KSRATMYKPS-GNKRVTFKDVGGAEEAIEELKEVVEFLKDPSKFNRIGA
FTSH_KOSOT       -----------KSPAKKYLS--NDKNVTFKDVAGVDEAIEELQDAVNYLKNPNAFSQTGA
FTSH2_PETMO      -----------RNPARRYDS--KRNKITFNDVAGIDEVKEELEDIVNFLKDPKNFSALGA
FTSH3_PETMO      -----------KSPAKKYDP--KKTRTTFNDVAGVKEAKEELTDVVKFLKDPKVFNRLGA
FTSH1_PETMO      -----------KSGAKKYEP--IGEKVTFKDVAGIDEVLDEIEDIVKFLKNPQEFQELGA
FTSH_HELPY       ------------SAKKLINAEKPN--VRFNDMAGNEEAKEEVVEIVDFLKYPERYANLGA
FTSH_HELPJ       ------------SAKKLINAEKPN--VRFNDMAGNEEAKEEVVEIVDFLKYPERYANLGA
FTSH_HELFC       ------------SSKKLINAEKPK--VRFNDMAGNEEAKEEVVEIVDFLKYPDRYASLGA
FTSH_SULNB       ------------KADKLINSEKPD--TRFDDVQGVEEAKDEVKEIVDFLKFPERYIELGA
FTSH_ATOPD       GGFGGLGGNLGRSSAKEIKGEDTG--ITFKDVAGQEEAKESMQEIVSFLKTPDKYKEIGA
FTSH_CLOP1       -----------KNNAKLYAENETG--ITFKDVAGQDEAKESLVEIVDFLHDTRKYVEIGA
FTSH_TREPA       G----------HARSAAVEEGKVT--TRFADVAGVDEAKEELMEVVDFLKFPKKYTEIGG
FTSH_PARD8       -----------KAKAQLFDKDNDR-KVTFKDVAGLAEAKQEVEEIVSFLKNPEKYTELGG
FTSH_SULMD       -----------KSKAKLYYYNN----ITFKDVAGLEGPKEEIKEIVDFLKSPNKYTKLGG
FTSH_RHOM4       -----------KNRAILYDAMGDH-RVTFKDVAGLDEAKEEVAEIVEFLKNPKKFTRLGG
FTSH1_SALRM      -----------SDTAALFEEAGGR-RVTFDDVAGLAEPKEEVAEVVEFLRRPQKFTRLGG
FTSH_PELLD       -----------KNKAALYENLDEHTRITFKDVAGLDEAKAEVMEVVDFLKDPKKYTRLGG
FTSH4_SYNY3      -----------KSKAKVYVEGD-STKVTFDDVAGVEEAKTELSEVVDFLKFPQRYTALGA
FTSH_ACAM1       -----------QSKARIYSEG--STGVTFDDVAGVEEAKTELLEIVDFLAHADKYTRLGA
FTSH_ANAD2       -----------KSRARIHMEP--DTGVTFQDAAGIDEAVEELQEIVEFLKTPEKYRRLGG
FTSH2_SORC5      -----------KHKARLYEER--GAIATFRDVAGNAEAKTELSEIVDFLKAPERYEKLGG
FTSH_PARP8       -----------KSKARVYVEK--DIKVTFADVAGVDEAKDELKEVVSFLRDPRSYGRLGA
FTSH_PSEP1       -----------KSRARVYVEH--DTQVTFADVAGIDDVKGELTEIVSFLKNKAWYARLGA
FTSH2_BDEBA      -----------KSGARLYAET--GVKVSFGDVAGVEEAKAELYEVVQFLKSPQEFGRLGA
FTSH_METPP       -----------RSHAKVYMEK--STGVRFDDVAGVDEAKAELQEIVDFLRDPKAHGRLGA
FTSH_RALPJ       -----------KSKAKVYMQK--ETGVTFADVAGIDEAKEELSEIVSFLKDPQRYQRLGG
FTSH_SYNFM       -----------KARVKIFAEK--EITITFDDVAGIDEAKGELEEIVQFLKDPGKFQRLGG
FTSH_BURP1       -----------KSKPRVYVEA--KTGIDFDDIAGIDEAKAELQQIVAFLRAPARYQRLGG
FTSH_PIRSD       -----------RSRGKLYAQE--ELGITFNDVAGIDEAVEEVREVVDFLRSPEKYQKLGG
FTSH2_RHOBA      -----------RSRGKLYSED--DLPTTFEDVAGIEEAVDEVREVVDFLKNSEKYQSLGG
FTSH_METCA       -----------K-KTRIQADT--AAKVTFGDVAGADEAKQELRETIEFLQNPTRIQSLGG
FTSH1_METI4      -----------KSRARLLVDE--STGVTFADVAGCDEAKYELQEVVDFLKNPSRYRALGA
FTSH_ACIFD       ------GIMSVGRSRAKTYTTERPK-TTFDDVAGYQGVKGEVKEVVDFLRDPSRFSQLGA
FTSH_ACIC1       ------GLPGIGRARAKIFTTERPQ-TRFSDVAGYDGVKAEIAEVVDFLRSPERYRRAGA
FTSH1_SORC5      ------GPLGFLRSKAKIYDRSRQDPVRFSDVAGVDEAKDELVEVVDFLKEPSRYRSLGG
FTSH1_SYMTH      ------GLLTMEQSPARLY-RVGEASVTLQDVAGLDEVKAELQEVIDFLREPERYRAMGA
FTSH_OPITP       -----------TAFSAQRLRPVTS-GVSFSSVAGCDEAKDEVYEVVEFLRDPARFRQTGG
FTSH3_SORC5      -----------KVFSDVKAGAARA-AVRFADVAGMHEVKQELAETVEFLKSPDRFARLGG
FTSH2_SYMTH      -----------ARSTVKPLAPGES-PVTFADVAGMDEVKGELEEIVDYLKNPDKYRAIGA
FTSH2_SPHTD      ------GTTPTRRGSFEPIRPGER-VITFDDVAGAEEVKEEVADIVDYLRDPERFRRLGA
FTSH3_SPHTD      ------------RGRSDSVTAVERPETTFSDVAGLIEAKEELAEIVTFLRDPERFRRMGA
FTSH2_CONWI      ------ASFSNFTGRGRKKGKGTAHRVTFADIAGVPEAVAELAEIRDYLDDPSRYLDLGA
FTSH_THET8       ------DSAFSFT-KSRARVLTEAPKVTFKDVAGAEEAKEELKEIVEFLKNPSRFHEMGA
FTSH_LEPBD       -----------KSRVNKIDKK---PDVKFDDVAGVDGAKEELREVVDFLKNPEKYTKAGA
FTSH_STRM9       -----------KG-KGKISER---PNVKFSDVAGLTEEKEELKEIVEFLKNPARFEKAGA
FTSH1_ALKMQ      -----------DKMSDVEFSTQKDSSIRFADIAGNQEAKENAMELVDFLKNPEKYSRYGA
FTSH_LACP7       -----------PLMKDAAKNKKAENRVKLGDVAGNAEAKSMVGDIIDFIKEPEKYSALGA
                                             : .  .             ::         *.

FTSH_MYCGE       RSPRGVILYGPPGTGKTLLAKAVAGEAGVPFFQSTGSGFEDMLVGVGAKRVRDLFNKAKK
FTSH_MYCPN       RSPRGVILYGPPGTGKTLLAKAVAGEAGVPFFQSTGSGFEDMLVGVGAKRVRDLFNKAKK
FTSH_MYCGH       RTPRGVVLYGPPGTGKTLLAKAVAGEAGVPFFQVTGSAFEDMLVGVGAKRVRNLFAKAKK
FTSH_MYCPE       RVPKGVILYGPPGTGKTLLAKAVAGEAKVPFFQVSGSAFEDMLVGVGAKRVRDLFNKAVK
FTSH_UREP2       RIPKGVMLYGPPGTGKTLIAKAVAGEANVPFFQTTGSSFEDTFVGVGARRVRELFEKARK
FTSH_MESFL       RAPKGVLMEGPPGTGKTLLAKAVAGEAGVSFFSIAGSEFEEMFVGVGASRVREMFNDAKK
FTSH_MYCPU       RFPKGILLGGPPGTGKTLLAKATAGEANVPFFFISASSFVELYVGLGAKRVREMFKEARK
FTSH_MYCS5       RMPHGILLGGPPGTGKTLLAKATAGEANVPFYFVSASSFVELFVGMGAKRVRQVISEARK
FTSH_MYCMO       RIPRGILLGGPPGTGKTLLAKATAGEANVPFYFISGSNFVELFVGVGAKRVRELFKEARK
FTSH_MYCA5       RIPKGILLGGPPGTGKTLIAKATAGEANVPFFFISASNFVEMFVGLGAKRVRDMFEEARK
FTSH_MYCCR       KIPKGILLGGPPGTGKTLLAKATAGEANVPFFFISASNFVELYVGVGAKRVRELFKEARA
FTSH_AYWBP       RIPKGVLLYGPPGTGKTLLAKAVAGEAGVPFFAASGSDFDEVYVGVGASRVRDLFKEAQL
FTSH2_PHYMT      RIPKGVLLYGPPGVGKTLLAKAVAGEAKVPFFAVSGSDFIEVYVGLGASRIRKLFNEAKQ
FTSH3_PHYMT      AIPRGVLLEGPPGTGKTLLAKALAGEASVPFYAVSGSEFVEMYVGVGASRVRKLFKEAKL
FTSH1_PHYMT      AIPKGVLLEGPPGTGKTLLAKALAGEASVPFYAVSGSEFVEMYVGVGASRVRTLFKEAKL
FTSH_ACHLI       RVPKGVLLVGQPGTGKTLLAKAVAGEAQVPFFSISGSDFVELYVGVGASRVRDLFKVAKQ
FTSH2_THEPX      KIPKGILFYGPPGTGKTLLATALAGETNSTFISASGSEFVEKYVGVGASRIRALFAKAKK
FTSH_AQUAE       RPPKGVLLYGEPGVGKTLLAKAIAGEAHVPFISVSGSDFVEMFVGVGAARVRDLFETAKK
FTSH_HYDS0       RPPKGILFYGEPGVGKTLLAKALAGEAHVPFISVSGSDFVEMFVGVGAARMRDTFETARK
FTSH_ECOLI       KIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMFEQAKK
FTSH_SHIFL       KIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMFEQAKK
FTSH_ECO57       KIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMFEQAKK
FTSH_SALTI       KIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMFEQAKK
FTSH_SALTY       KIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMFEQAKK
FTSH_BUCAI       KIPKGILMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMFEHSRK
FTSH_BUCAP       KIPKGILMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMFEHARK
FTSH_BUCBP       KIPKGILMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMFEHSRK
FTSH_PHOPR       KIPTGILLVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMFEQAKK
FTSH_HAEIN       KIPKGILMVGPPGTGKTLLARAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMFEQAKK
FTSH_MAGMM       KIPKGVLLVGPPGTGKTLLARAIAGEANVPFFNLSGSDFVEMFVGVGAARVRDMFEQGKK
FTSH_CUPMC       RIPRGVLLVGPPGTGKTLLARAIAGEAKVPFFSISGSDFVEMFVGVGAARVRDMFENAKK
FTSH_RICCN       KIPKGCLLIGPPGTGKTLLAKAIAGEANVPFFSISGSDFVEMFVGVGASRVRDMFEQGKR
FTSH_RICFE       KIPKGCLLIGPPGTGKTLLAKAIAGEANVPFFSISGSDFVEMFVGVGASRVRDMFEQGKR
FTSH_RICPR       KIPKGCLLIGPPGTGKTLLAKAIAGEANVPFFSISGSDFVEMFVGVGASRVRDMFEQGKR
FTSH_RICTY       KIPKGCLLIGPPGTGKTLLAKAIAGEANVPFFSISGSDFVEMFVGVGASRVRDMFEQGKR
FTSH_RICBR       KIPKGCLLIGPPGTGKTLLAKAIAGEANVPFFSISGSDFVEMFVGVGASRVRDMFEQGKR
FTSH_NEORI       KIPKGCLLIGPPGTGKTLLAKAIAGEAKVPFFSISGSDFVEMFVGVGASRVRDMFEQGKK
FTSH_BARBK       RIPRGVLLVGPPGTGKTLLARSIAGEANVPFFTISGSDFVEMFVGVGASRVRDMFEQAKK
FTSH_CAUVN       KIPKGALLVGPPGTGKTLIARAVAGEAGVPFFTISGSDFVEMFVGVGASRVRDMFEQAKK
FTSH_ZYMMN       KIPKGALLVGPPGTGKTLLARAIAGEAGVPFFSISGSDFVEMFVGVGASRVRDMFEQAKK
FTSH_HALO1       RIPKGVLMMGPPGTGKTLLARAIAGEAGVPFFSISGSDFVEMFVGVGASRVRDLFEQGKK
FTSH_MYXXD       RIPKGVLMMGSPGTGKTLLARAVAGEAGVPFFSISGSDFVEMFVGVGASRVRDLFEQGKK
FTSH4_SORC5      RIPKGVLMMGPPGTGKTLLARAIAGEAGVPFFSISGSDFVEMFVGVGASRVRDLFEQGKK
FTSH1_BDEBA      RIPKGVLLVGSPGTGKTLLARAVAGEAGVPFFTISGSDFVEMFVGVGASRVRDLFEQGKK
FTSH_ACIC5       RIPKGVLLVGPPGTGKTLLARAVAGEANVPFFSISGSDFVEMFVGVGASRVRDLFEQGKK
FTSH_AKKM8       TIPRGVLMVGAPGTGKTLLARAIAGESNASFYSISGSDFVEMFVGVGASRVRDMFEQAKR
FTSH2_METI4      RIPKGVLMVGPPGTGKTLLAKAIAGEADVPFFSISGSDFVEMFVGVGASRVRDMFEQARR
FTSH_LEPBJ       RIPTGVLLVGPPGTGKTLLARAVAGEAGVPFFSISGSDFVEMFVGVGASRVRDLFDQGKK
FTSH_BORBZ       KIPKGVLLVGSPGTGKTLLAKAVAGEAGVSFFHMSGSDFVEMFVGVGASRVRDLFDNARK
FTSH_PELPB       KIPKGVLLLGPPGTGKTLLAKAIAGEAKVPFFSISGADFVEMFVGVGAARVRDLFEQAKK
FTSH_UNCTG       KIPKGVLLFGSPGTGKTLLAKAVAGEANVPFFSSSGSEFVEMFVGVGASRVRDLFDHGRK
FTSH_SYNAS       TAPKGVLLVGAPGTGKTLLAKAVAGEAGVPFFSMSAAEFVEMIVGVGAARVRDLFKQARE
FTSH_THET1       TIPKGVLLIGPPGTGKTLLARAVAGEAGVPFFSMSGSEFVEMIVGVGAARVRELFQQAKK
FTSH3_CONWI      KIPKGVLLSGQPGTGKTLLARAVAGEAGVPFFSMSASEFVEMIVGVGASRVRDLFRQAKE
FTSH_MARHV       VMPKGVLLVGPPGTGKTLLARAIAGEAEVPFFSISASEFIEMFVGVGAARVRDMFQTARK
FTSH_NITOC       KIPKGILLVGRPGTGKTLLARAVAGEAGVPFYSISGSDFIEMFVGVGAARVRDMFKAAKE
FTSH_HAHCH       LAPRGVLLMGPPGTGKTLLARALAGEAGVNFYPMSASEFIEVFVGVGASRVRQLFKIAKE
FTSH4_SPHTD      RLPRGILLVGPPGTGKTLLARAVAGEAGVPFFSVSASEFVEMFVGVGASRVRDLFERAKA
FTSH2_THERP      RLPRGVLLVGPPGTGKTLLARAVAGEAGVPFFSVSASEFVEMFVGVGASRVRDLFERAKA
FTSH_PELCD       KAPRGVLLVGPPGTGKTLMARAVAGEAEVPFFTISASQFIEMFVGVGASRVRDLFNNAKK
FTSH_PELPD       KVPKGVLLVGPPGTGKTLLARAVAGEAGVAFFSISASQFIEMFVGVGASRVRDLFTNAKK
FTSH1_RHOBA      QVPKGVLLNGPPGTGKTLLARAVAGEADVPFFSVNGSEFIQMFVGVGASRVRDLFKTAKE
FTSH2_SALRM      KVPKGVLLVGPPGTGKTLLARAVAGEANAPFFSVSGSDFMEMFVGVGASRVRDMFSEAKE
FTSH_BACPE       RIPKGVLLVGPPGTGKTLLARAVAGEAGVPFFSISGSDFVEMFVGVGASRVRDLFENAKK
FTSH_BACSU       RIPKGVLLVGPPGTGKTLLAKACAGEAGVPFFSISGSDFVEMFVGVGASRVRDLFENAKK
FTSH_STAHJ       RIPKGVLLVGPPGTGKTLLARAVAGEAGAPFFSISGSDFVEMFVGVGASRVRDLFENAKK
FTSH_STRPN       RIPAGVLLEGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRSLFEDAKK
FTSH_STRR6       RIPAGVLLEGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRSLFEDAKK
FTSH_LACPL       RIPSGVLLEGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRDLFEQAKK
FTSH_LACPJ       RIPSGVLLEGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRDLFEQAKK
FTSH_LEUMM       RIPKGVLLEGPPGTGKTLLAKAVAGEASVPFFSMSGSDFVEMFVGVGASRVRDLFENAKK
FTSH_OENOE       RIPKGVLLEGPPGTGKTLLAKAVAGEAKTPFFSISGSDFVEMFVGVGASRVRDLFENAKK
FTSH_LACLA       RIPAGVLLEGPPGTGKTLLAKAVAGEAGVPFYSISGSDFVEMFVGVGASRVRDLFENAKK
FTSH2_ALKMQ      RIPKGILMIGPPGTGKTYLTKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRDLFEQAKK
FTSH1_THEPX      RIPKGVLLVGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGAARVRDLFDQAKK
FTSH_CALBD       RIPKGILLVGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGAARVRDLFDQAKR
FTSH_RUMCH       RIPKGVLLVGPPGTGKTLLAKAVSGEAGVPFFSISGSDFVEMFVGVGASRVRDLFEQAKK
FTSH_CLONN       RIPKGILLVGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRDLFEQAKK
FTSH_VEIPT       KIPKGVLLAGPPGTGKTLLAKAVAGEAGVPFFTISGSDFVEMFVGVGASRVRDLFTQAKK
FTSH_HALOH       KVPKGVLLVGPPGTGKTLLARAVAGEAGVPFFIISGSDFVEMFVGVGASRVRDLFEQGKK
FTSH_NATTJ       RIPKGVLLVGPPGTGKTLLGRAVAGEAGVPFFSISGSDFVEMFVGVGASRVRDLFENAKK
FTSH3_SYMTH      RIPKGVLLYGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRDLFEQAKK
FTSH_MYCTU       KIPKGVLLYGPPGTGKTLLARAVAGEAGVPFFTISGSDFVEMFVGVGASRVRDLFEQAKQ
FTSH_MYCTA       KIPKGVLLYGPPGTGKTLLARAVAGEAGVPFFTISGSDFVEMFVGVGASRVRDLFEQAKQ
FTSH_MYCBO       KIPKGVLLYGPPGTGKTLLARAVAGEAGVPFFTISGSDFVEMFVGVGASRVRDLFEQAKQ
FTSH_MYCLE       KIPKGVLLYGPPGTGKTLLARAVAGEAGVPFFTISGSDFVEMFVGVGASRVRDLFDQAKQ
FTSH_RHOE4       KIPRGVLLYGPPGTGKTLLARAVAGEAGVPFFTISGSDFVEMFVGVGASRVRDMFEQAKQ
FTSH_CORGL       KIPRGVLLYGPPGTGKTLLARAVAGEAGVPFYSISGSDFVEMFVGVGASRVRDLFKQAKE
FTSH_ROTMD       KIPKGVLLYGPPGTGKTLLAKAVAGEAGVPFYSISGSDFVEMFVGVGASRVRDLFKEAKS
FTSH_TROWT       RIPKGVLLFGPPGTGKTLLARAVAGEAGVPFFSISGSDFVEMFVGVGASRVRDLFEQAKQ
FTSH_BRAFD       KIPKGVLLYGPPGTGKTLLAKAVAGEANVPFYSISGSDFVEMFVGVGASRVRDLFNTAKE
FTSH_CUTAS       KIPKGVLLYGPPGTGKTLLARAVAGEAGVPFFSISGSDFVEMFVGVGASRVRDLFEQAKE
FTSH1_CONWI      RIPKGVLLYGPPGTGKTLLARAVAGEAGVPFFSISGSDFVEMFVGVGASRVRDLFEQAKQ
FTSH_RUBXD       RIPKGALLVGPPGTGKTLLARAVAGEAGVPFFSISGSDFVEMFVGVGASRVRDLFEQAKQ
FTSH_SLAHD       KIPRGCLLVGPPGTGKTLLARAVAGEANVPFFSISGSEFVEMFVGVGASRVRNLFEQAKE
FTSH_PORPU       KIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKD
FTSH_PYRYE       KIPKGVLLVGPPGTGKTLLAKAIAGEASVPFFSISGSEFVEMFVGVGASRVRDLFKKAKD
FTSH_GUITH       KIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKE
FTSH2_SYNY3      KIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKE
FTSH_NOSS1       RIPKGVLLVGPPGTGKTLLAKAIAGEAAVPFFSISGSEFVEMFVGVGASRVRDLFKKAKD
FTSH1_SYNY3      KIPRGVLLIGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKE
FTSH_TRIEI       KIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKE
FTSH_CYACA       TIPKGVLLVGPPGTGKTLLAKAIAGEASAPFFSISGSEFVEMFVGVGASRVRDLFKKAKE
FTSH_CYAM1       SIPKGVLLVGPPGTGKTLLAKAIAGEASVPFFSISGSEFVEMFVGVGASRVRDLFKKAKQ
FTSH_TRICV       KIPKGILLVGPPGTGKTLLAKAIANEADVPFFSVAGSEFVEMFIGIGAARVRDLFKKASE
FTSH_VAULI       KIPKGVILIGPPGTGKTLLAKAIAGEAGVPFISISGSEFVEMFVGIGASRVRDLFKTAQQ
FTSH_HETA2       TIPKGVLLVGPPGTGKTLLAKAIAGEAKVPFINISGSEFVEMFVGVGAARVRNLFEKAKQ
FTSH_ECTSI       NPPKGVIIVGPPGTGKTLLAKAIAGEAGVPFISISGSEFVEMFVGIGASRVRDLFETAER
FTSH3_SYNY3      KIPKGVLLVGPPGTGKTLLAKAVAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFEQAKA
FTSH_SYNJB       KIPRGVLLVGPPGTGKTLLARAVAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFEQAKQ
FTSH1_SPHTD      RIPRGVLLVGPPGTGKTLLSRAVAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFDQAKR
FTSH1_THERP      RIPRGVLLVGPPGTGKTLLSRAVAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFDQAKR
FTSH_CHLAD       RIPRGVLMVGPPGTGKTLLSRAVAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFDQAKR
FTSH_PSELT       RMPKGILLVGPPGTGKTLLARAVAGEANVPFFHISGSDFVELFVGVGAARVRDLFNQAKA
FTSH_THEMA       RMPKGILLVGPPGTGKTLLARAVAGEANVPFFHISGSDFVELFVGVGAARVRDLFAQAKA
FTSH_KOSOT       RMPKGILLVGPPGTGKTLLARAVAGEANVPFFYISGSDFVELFVGVGAARVRDLFSQAKA
FTSH2_PETMO      KMPKGVLLSGPPGTGKTLVARAVAGEADVPFYFMSGSDFVELFVGVGAARVRDLFKEAKE
FTSH3_PETMO      RMPKGVLLVGEPGTGKTLLARAVAGEAGVPFFYISGSDFVELFVGVGAARVRDLFNQAKA
FTSH1_PETMO      RMPKGTLLVGPPGTGKTLTARAIAGEADVPFYYASGSDFVELFVGVGASRVRDLFKTAKE
FTSH_HELPY       KIPKGVLLVGPPGTGKTLLAKAVAGEAHVPFFSMGGSSFIEMFVGLGASRVRDLFETAKK
FTSH_HELPJ       KIPKGVLLVGPPGTGKTLLAKAVAGEAHVPFFSMGGSSFIEMFVGLGASRVRDLFETAKK
FTSH_HELFC       KIPKGVLLVGPPGTGKTLLAKAVAGEASVPFFSMGGSSFIEMFVGLGASRVRDLFDIAKK
FTSH_SULNB       KIPKGVLLVGPPGTGKTLLAKAVAGEASVPFFSVSGSGFIEMFVGVGASRVRDLFAQAKK
FTSH_ATOPD       RCPRGALLVGPPGTGKTLIAKAVAGEAGVPFFQIAGSEFVEMFVGRGAAKVRDLFKQANE
FTSH_CLOP1       KLPKGALLVGPPGTGKTLLAKAVAGEAKVPFFSMSGSDFVEMFVGMGAARVRDLFKQAEE
FTSH_TREPA       KIPRGVLLVGPPGTGKTLLARAVAGEASVPFFRISGSDFIEMFVGIGASRVRDLFKQARE
FTSH_PARD8       KIPKGALLVGPPGTGKTLLAKAVAGEANVPFFSLSGSDFVEMFVGVGASRVRDLFRQAKE
FTSH_SULMD       KIPKGALLIGPPGTGKTLLAKAVAGEAQVPFFSLSGSDFVEMFVGVGASRVRDLFYIAKL
FTSH_RHOM4       KLPKGVLLVGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGAARVRDLFRQAKE
FTSH1_SALRM      ALPTGVLLVGPPGTGKTLLAKAVAGEAGVPFASISGSDFMEMFVGVGASRVRDLFDQAKE
FTSH_PELLD       KLPKGVLLVGPPGTGKTLLAKAVAGEADVPFFSISGSDFVEMFVGVGAARVRDLFRQAKE
FTSH4_SYNY3      KIPKGVLLVGPPGTGKTLLAKAAAGEAGVPFFIISGSEFVELFVGAGAARVRDLFEQAKK
FTSH_ACAM1       KIPKGVLLVGPPGTGKTLLAKAIAGEAKVPFFSISGSEFIELFVGIGAARVRDLFEQAKQ
FTSH_ANAD2       RIPKGVLLVGPPGTGKTLLARATAGEAGVPFFSLSGSEFVEMFVGVGAARVRDLFAQATQ
FTSH2_SORC5      RMPRGVLLVGPPGTGKTLLARAIAGEASVPFFSASGSEFVEMFVGVGAARVRDLFSQARE
FTSH_PARP8       RVPKGVLLVGPPGTGKTLLARAVAGEAGVAFFSISGSEFVEMFVGVGAARVRDLFEQARK
FTSH_PSEP1       HVPKGTLLVGPPGTGKTLVAKAIAGEAAVPFFSISGSEFVEMFVGVGAARVRDLFDQARQ
FTSH2_BDEBA      RMPKGILLVGPPGTGKTLLAKAVAGEAQVPFYSITGSEFVEMFVGVGAARVRDLFEQARK
FTSH_METPP       RMPKGVLLMGPTGTGKTLLARAVAGEAGVPFFSISGSEFIEMFVGVGAARVRDLFEQARA
FTSH_RALPJ       KIPKGVLLVGAPGTGKTLLAKAVAGEAGVPFFSMSGSDFVEMFVGVGAARVRDLFKQAET
FTSH_SYNFM       RIPKGVLLVGAPGTGKTLLAKAVAGEAGVPFFSMSGSEFVEMFVGVGAARVRDLFGQAKD
FTSH_BURP1       KIPKGVLIVGAPGTGKTLLAKAVAGEAGVPFFSTSGSSFVEMFVGVGAARVRDLFEQAQQ
FTSH_PIRSD       RIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSLSGSDFVEMFVGVGAARVRDMFQQAEA
FTSH2_RHOBA      RIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSLSGSDFVEMFVGVGAARVRDMFTQAVN
FTSH_METCA       RMPKGVLLVGPPGTGKTLLARAVAGEAGVPFFNISGSEFIELFVGVGAARVRDLFEQARQ
FTSH1_METI4      KIPKGVLLVGPPGTGKTLLAKAVAGEAKVPFFSISGSEFVEMFVGVGAARVRDLFGQAKS
FTSH_ACIFD       RIPKGILLVGPPGTGKTLLARAVAGEAGVPFMSVSGSDFMEMFVGVGAARVRDLFQTARR
FTSH_ACIC1       AIPRGVLMVGPPGTGKTLMARAVAGEAGVPFLSVTGSSFVEMFVGVGASRVRDLFEEARK
FTSH1_SORC5      RIPRGLLLIGPPGTGKTLLARAVAGEANVPFFSLNASEFVEMFVGLGAARVRELFEEARK
FTSH1_SYMTH      RIPRGILLSGPPGTGKTLLARALAGEAGVPFFSASGSDFVELFAGTGAARVRALFDRARK
FTSH_OPITP       RMPKGVLLVGPPGTGKTMLAKAVAGEARANFYSLSGSDFVELYVGVGASRVRSLFKKARE
FTSH3_SORC5      RPPRGVLLTGEPGTGKTLLARAVACEAGVRFLSASGSSFQEMFVGVGASRVRALFAEARK
FTSH2_SYMTH      RIPKGVLLYGPPGTGKTLLARAVAGEAGVPFFALSGSSFVELFVGMGASRVRELFAQARK
FTSH2_SPHTD      RIPRGVLLTGPPGTGKTLLTRALAGEARASFFSVSGSEFVELYVGVGASRVRELFRKAKE
FTSH3_SPHTD      RMPRGVLLAGPPGTGKTLLARAVAGEAGVPFFAMSASQFVEVYVGVGAKRVRDLFAAARK
FTSH2_CONWI      AAPKGVLLVGPPGTGKTLLAKAVAGEADAAFFSLSGSDFVESLVGVGAARVRDLFAKARR
FTSH_THET8       RIPKGVLLVGPPGVGKTHLARAVAGEARVPFITASGSDFVEMFVGVGAARVRDLFETAKR
FTSH_LEPBD       RVPKGVLLLGRPGTGKTLLAKAVAGESGASFFSISGSEFVEMFVGVGASRVRDLFEKAKE
FTSH_STRM9       RVPKGVLLLGEPGTGKTLLAKAVAGESEAAFFPISGSEFIELYVGVGASRVRELFKDAKK
FTSH1_ALKMQ      KMPKGVILYGSPGTGKTLLARALASEAGVEFLAVSGSDFVQVYAGLGAGRIRNLFKKAKD
FTSH_LACP7       RMPKGVMLYGPPGTGKTLIAKAIATEAGVPFYAMSGSDFVQMYVGVGASRIRTLFNKAKK
                   * * :: * .*.***    : : *:   *    .: * :   * ** ::*  :  .  

FTSH_MYCGE       AAPCIIFIDEIDSVGSKRGRV--ELSSYSVVEQTLNQLLAEMDGFTSR-TGVVVMAATNR
FTSH_MYCPN       AAPCIIFIDEIDSVGSKRGRV--ELSSYSVVEQTLNQLLAEMDGFTSR-TGVVVMAATNR
FTSH_MYCGH       AAPCIIFIDEIDSVGSKRGKY--EISAGSATDQTLNQLLAEMDGFSTR-TGIIVMAATNR
FTSH_MYCPE       SAPAIIFIDEIDSVGSKRGKF--ETTAGSLADQTLNQLLAEMDGFNTK-TGVIVMAATNR
FTSH_UREP2       SAPAIIFIDEIDSVAKKRG-----NSLTAVQDQTINQLLSELDGFDTS-SGVIVMAATNR
FTSH_MESFL       SAPAIIFIDEIDAVGRKRNNG--MGSGGN--EQTLNQLLVEMDGFGTN-SGIIVMAATNR
FTSH_MYCPU       LAPAIIFIDELDAVGRSRGSG--IGGGNDEREQTLNQILVEMDGINEN-AGILIMGATNR
FTSH_MYCS5       NSPAIIFIDELDAIGRTRGSG--IGGGHDEREQTLNQLLVEMDGMKEN-SGLLFIAATNR
FTSH_MYCMO       SSPAIIFIDELDAVGRSRGAG--IGGGNDEREQTLNQLLVEMDGMTEN-SGLLVMAATNR
FTSH_MYCA5       TAPAIIFIDELDAVGRSRGAG--IGGGNDEREQTLNQLLVEMDGIKEN-SGILIMAATNR
FTSH_MYCCR       ESPAIIFIDELDAIGRSRGSG--IGGGHDEREQTLNQLLVEMDGMVEN-SGILLIGATNR
FTSH_AYWBP       AAPCIVFIDEIEAVARKRGSN---IGGSNGSEQTLNQLLVEMDGFNQK-MGVIVIAATNQ
FTSH2_PHYMT      NAPCIIFIDEIETISHQRGSV---NYSNSEHDQTLNQLLVEMDGFTKN-IGVIVMAATNQ
FTSH3_PHYMT      NAPCVLFIDEIDVLGGRRGGN--SSGGNQEKDQTLNQLLTEMDGFTPS-QGIIVIGATNR
FTSH1_PHYMT      NAPCVLFIDEIDVLGGKRGGN--SSGGNQEKDQTLNQLLTEMDGFTQA-KGIIVIGATNR
FTSH_ACHLI       SAPCIIFIDEIDAVGRQRGAG--MGGGNDEREQTLNQLLVEMDGFSAN-LGIIIMAATNR
FTSH2_THEPX      SAPSIIFIDEIDAVGTKRNTD-----NNSEKDQTLNQLLVEMDGFNSN-EGIIVIGATNR
FTSH_AQUAE       HAPCIIFIDEIDAVGRARGAI-PVGGGHDEREQTLNQLLVEMDGFDTS-DGIIVIAATNR
FTSH_HYDS0       NAPCIVFIDEIDAVGRSRGAI-NLGG-NDEREQTLNQLLVEMDGFDTS-EGILIIAATNR
FTSH_ECOLI       AAPCIIFIDEIDAVGRQRGAG--LGGGHDEREQTLNQMLVEMDGFEGN-EGIIVIAATNR
FTSH_SHIFL       AAPCIIFIDEIDAVGRQRGAG--LGGGHDEREQTLNQMLVEMDGFEGN-EGIIVIAATNR
FTSH_ECO57       AAPCIIFIDEIDAVGRQRGAG--LGGGHDEREQTLNQMLVEMDGFEGN-EGIIVIAATNR
FTSH_SALTI       AAPCIIFIDEIDAVGRQRGAG--LGGGHDEREQTLNQMLVEMDGFEGN-EGIIVIAATNR
FTSH_SALTY       AAPCIIFIDEIDAVGRQRGAG--LGGGHDEREQTLNQMLVEMDGFEGN-EGIIVIAATNR
FTSH_BUCAI       SAPCIIFIDEIDAVGRQRGAG--LGGGHDEREQTLNQMLVEMDGFDGN-EGIILIAATNR
FTSH_BUCAP       SAPCIIFIDEIDAVGRQRGAG--LGGGHDEREQTLNQMLVEMDGFDGN-EGVILIAATNR
FTSH_BUCBP       VAPCIIFIDEIDAVGRQRGAG--LGGGHDEREQTLNQMLVEMDGFDGN-EGIILIAATNR
FTSH_PHOPR       AAPCIIFIDEIDAVGRQRGAG--VGGGHDEREQTLNQMLVEMDGFEGN-EGVIVIAATNR
FTSH_HAEIN       NAPCLIFIDEIDAVGRQRGAG--LGGGHDEREQTLNQMLVEMDGFSGN-DGVIVIAATNR
FTSH_MAGMM       NAPCIIFIDEIDAVGRHRGAG--LGGGHDEREQTLNQLLVEMDGFEST-EGVIMVAATNR
FTSH_CUPMC       QAPCIVFIDEIDAVGRHRGAG--MGGGNDEREQTLNQMLVEMDGFEAN-SGVIVIAATNR
FTSH_RICCN       NAPCIIFIDEIDAVGRHRGIG--MGGGNDEREQTLNQMLVEMDGFEAN-EGVVIIAATNR
FTSH_RICFE       NAPCIIFIDEIDAVGRHRGIG--MGGGNDEREQTLNQMLVEMDGFEAN-EGVVIIAATNR
FTSH_RICPR       NAPCIIFIDEIDAVGRHRGIG--MGGGNDEREQTLNQMLVEMDGFEAN-EGVVIIAATNR
FTSH_RICTY       NAPCIIFIDEIDAVGRHRGIG--MGGGNDEREQTLNQMLVEMDGFEAN-EGVVIIAATNR
FTSH_RICBR       NAPCIIFIDEIDAVGRHRGIG--MGGGNDEREQTLNQMLVEMDGFEAN-EGVVIIAATNR
FTSH_NEORI       NAPCLIFIDEIDAVGRHRGVG--FGGGNDEREQTLNQLLVEMDGFEAN-EGVIIIAATNR
FTSH_BARBK       NAPCIIFIDEIDAVGRHRGAG--LGGGNDEREQTLNQLLVEMDGFEPN-ESIILIAATNR
FTSH_CAUVN       NAPCIIFIDEIDAVGRHRGAG--LGGGNDEREQTLNQLLVEMDGFEAN-EGIILIAATNR
FTSH_ZYMMN       NAPCIIFIDEIDAVGRHRGAG--LGNGNDEREQTLNQLLVEMDGFEAN-EGIIILAATNR
FTSH_HALO1       NAPCIIFIDEIDAVGRHRGAG--LGGGHDEREQTLNQLLVEMDGFESN-DGVILIAATNR
FTSH_MYXXD       NAPCIIFIDEIDAVGRHRGAG--LGGGHDEREQTLNQLLVEMDGFESN-DGVILIAATNR
FTSH4_SORC5      HAPCIIFIDEIDAVGRHRGAG--LGGGHDEREQTLNQLLVEMDGFESN-EGVIIVAATNR
FTSH1_BDEBA      NAPCLIFIDEIDAVGRHRGAG--MGGGHDEREQTLNQLLVEMDGFESS-EGVIMIAATNR
FTSH_ACIC5       NAPCIIFIDEIDAVGRHRGAG--LGGGHDEREQTLNQLLVEMDGFEAN-DGVILVAATNR
FTSH_AKKM8       TAPSLIFIDEIDAVGRQRGYG--MGGGNDEREQTLNALLVEMDGFENN-SNVIVIAATNR
FTSH2_METI4      HAPCIVFIDEIDAVGRARGTG--LGGGHDEREQTLNALLVEMDGIESQ-EGVIVIAATNR
FTSH_LEPBJ       NSPCIIFIDEIDAVGRLRGAG--LGGGHDEREQTLNQMLVEMDGFEKN-EGVIVMAATNR
FTSH_BORBZ       NSPCIIFIDELDAVGRSRGAG--LGGGHDEREQTLNQLLVEMDGFGTH-TNVIVMAATNR
FTSH_PELPB       NAPCIIFIDEIDAVGRSRGAG--LGGGHDEREQTLNQLLVEMDGFTTN-ENVILIAATNR
FTSH_UNCTG       SAPCLLFIDEIDAVGRHRFAG--IGGGHDEREQTLNQLLVEMDGFDSK-EGVILIAATNR
FTSH_SYNAS       HAPAIIFIDELDAIGRARGQ--VAIGGASEQEQTLNQILTEMDGFSSR-EGIIVLAATNQ
FTSH_THET1       EAPCIIFVDELDAIGRRRGSS-INVGGHDEREQTLNQLLVEMDGFDSR-QGVIVLAATNR
FTSH3_CONWI      AAPAIIFIDELDAIGRARGGGRGSFGGNDEREQTLNQILTEMDGFEPT-TAVIVIAATNR
FTSH_MARHV       EAPALIFIDELDAVGRSRGAG--LGGGHDEREQTLNQILTEMDGFEAH-ENVLVLAATNR
FTSH_NITOC       EAPSILFIDEIDSVGRARGTG--LGGGHDEREQTLNQILGEMDGFAAH-ENVVVLAATNR
FTSH_HAHCH       NSPSIIFIDELDSVGRTRGAG--YGGGHDEREQTLNQILAEMDGFAGH-DAVIVLAATNR
FTSH4_SPHTD      SAPSIMFVDELDAVGRQRFAG--LGGGNDEREQTLNQLLVEMDGFEPH-QDVIVIAATNR
FTSH2_THERP      QAPSIIFIDELDAVGRQRFAG--LGVGNDEREQTLNQLLVEMDGFEAH-TDVVVIAATNR
FTSH_PELCD       NAPSIIFIDELDAVGRSRGTG--LGGGNDEREQTLNQLLSEMDGFEAH-DEVIVMSATNR
FTSH_PELPD       AAPSIVFIDELDAVGRSRGAG--FGGGHDEREQTLNQLLSEMDGFDQH-EEVIVLAATNR
FTSH1_RHOBA      QSPSIIFIDEIDAVGRQRGAG--LGGGHDEREQTLNQILGEMDGFGGA-QAVIVIAATNR
FTSH2_SALRM      TSPAIIFIDELDSIGRKRGAG--LGGGNDEREQTLNQLLSELDGFEEN-EGVIVMAATNR
FTSH_BACPE       NAPCIIFIDEIDAVGRQRGAG--LGGGHDEREQTLNQLLVEMDGFSAN-EGIIIIAATNR
FTSH_BACSU       NAPCLIFIDEIDAVGRQRGAG--LGGGHDEREQTLNQLLVEMDGFSAN-EGIIIIAATNR
FTSH_STAHJ       NAPCIIFIDEIDAVGRQRGAG--VGGGHDEREQTLNQLLVEMDGFGEN-EGIIMIAATNR
FTSH_STRPN       AAPAIIFIDEIDAVGRQRGVG--LGGGNDEREQTLNQLLIEMDGFEGN-EGIIVIAATNR
FTSH_STRR6       AAPAIIFIDEIDAVGRQRGVG--LGGGNDEREQTLNQLLIEMDGFEGN-EGIIVIAATNR
FTSH_LACPL       NAPSIIFIDEIDAVGRQRGNG--MGGGHDEREQTLNQLLVEMDGFTGN-EGVIVMAATNR
FTSH_LACPJ       NAPSIIFIDEIDAVGRQRGNG--MGGGHDEREQTLNQLLVEMDGFTGN-EGVIVMAATNR
FTSH_LEUMM       SAPAIIFIDEIDAVGRRRGTG--MGGGNDEREQTLNQILIEMDGFEGS-EGVIILASTNR
FTSH_OENOE       SAPSIIFIDEIDAVGRRRGAG--MGGGNDEREQTLNQILIEMDGFEGS-EGVIVLASTNR
FTSH_LACLA       TAPSIIFIDEIDAVGRQRGAG--LGGGNDEREQTLNQLLVEMDGFQDDGNSVIVIAATNR
FTSH2_ALKMQ      SAPCIIFIDEIDAVGRKRGAG--LGGGHDEREQTLNQLLVEMDGFGIN-EGIIIVAATNR
FTSH1_THEPX      NAPCIVFIDEIDAVGRQRGAG--LGGGHDEREQTLNQLLVEMDGFSVN-EGIIVIAATNR
FTSH_CALBD       NAPCVVFIDEIDAVGRHRGAG--LGGGHDEREQTLNQLLVEMDGFGTN-EGIIVMAATNR
FTSH_RUMCH       NAPCIVFIDEIDAVGRHRGAG--LGGGHDEREQTLNQLLVEMDGFGIN-EGVIILAATNR
FTSH_CLONN       NSPCIIFIDEIDAVGRQRGAG--LGGGHDEREQTLNQLLVEMDGFGVN-EGIILVAATNR
FTSH_VEIPT       NAPCIIFIDEIDAVGRQRGAG--LGGGHDEREQTLNQLLVEMDGFGAN-EGIITIAATNR
FTSH_HALOH       NAPCIIFIDELDAVGRQRGAG--LGGGHDEREQTLNQLLVEMDGFEPN-EGIIVMAATNR
FTSH_NATTJ       NSPCIVFIDEIDAVGRQRGAG--LGGGHDEREQTLNQLLVEMDGFDVN-EGIIVMAATNR
FTSH3_SYMTH      NSPCIVFIDEIDAVGRQRGAG--YGGGHDEREQTLNQLLVEMDGFSAN-EGIIIIAATNR
FTSH_MYCTU       NSPCIIFVDEIDAVGRQRGAG--LGGGHDEREQTLNQLLVEMDGFGDR-AGVILIAATNR
FTSH_MYCTA       NSPCIIFVDEIDAVGRQRGAG--LGGGHDEREQTLNQLLVEMDGFGDR-AGVILIAATNR
FTSH_MYCBO       NSPCIIFVDEIDAVGRQRGAG--LGGGHDEREQTLNQLLVEMDGFGDR-AGVILIAATNR
FTSH_MYCLE       NSPCIIFVDEIDAVGRQRGTG--LGGGHDEREQTLNQLLVEMDGFGDR-AGVILIAATNR
FTSH_RHOE4       NSPCIIFVDEIDAVGRQRGAG--LGGGHDEREQTLNQLLVEMDGFGDR-TGIILIAATNR
FTSH_CORGL       NSPCIIFVDEIDAVGRARGSG--MGGGHDEREQTLNQLLVEMDGFGDR-QGVILMAATNR
FTSH_ROTMD       DPAAIVFVDEIDAVGRRRGVG--MGGGNDEREQTLNQLLVEMDGFDGN-SNVIVIAATNR
FTSH_TROWT       NSPSIIFIDEIDAVGRRRGSG--FGGGHDEREQTLNQLLVEMDGFDVK-TNIILIAATNR
FTSH_BRAFD       NAPAIIFIDEIDAVGRHRGAG--MGGGHDEREQTLNQMLVEMDGFEEN-QNVILIAATNR
FTSH_CUTAS       AAPAIIFIDEIDAVGRHRGAG--MGGGHDEREQTLNQLLVEMDGFDVH-GGVILIAATNR
FTSH1_CONWI      NAPCIIFMDEIDAVGRHRGAG--MGGGHDEREQTLNQLLVEMDGFEAK-DNIIMIAATNR
FTSH_RUBXD       NSPCIIFVDEIDAVGRQRGAG--LGGGHDEREQTLNQLLVEMDGFDSK-SGIIMLAATNR
FTSH_SLAHD       AAPSIIFIDEIDAVGRQRGTG--LGGGHDEREQTLNQLLVEMDGFEKN-DAVVLIAATNR
FTSH_PORPU       NAPCIVFIDEIDAVGRQRGTG--VGGGNDEREQTLNQLLTEMDGFEGN-TGVIVIAATNR
FTSH_PYRYE       NAPCIVFIDEIDAVGRQRGTG--VGGGNDEREQTLNQLLTEMDGFEGN-TGVIVIAATNR
FTSH_GUITH       NSPCIVFIDEIDAVGRQRGTG--IGGGNDEREQTLNQLLTEMDGFEGN-TGIIIIAATNR
FTSH2_SYNY3      NAPCLIFIDEIDAVGRQRGAG--IGGGNDEREQTLNQLLTEMDGFEGN-TGIIIIAATNR
FTSH_NOSS1       NAPCLIFIDEIDAVGRQRGTG--IGGGNDEREQTLNQLLTEMDGFEGN-TGIIIIAATNR
FTSH1_SYNY3      NAPCLVFIDEIDAVGRQRGVG--YGGGNDEREQTLNQLLTEMDGFEGN-SGIIVIAATNR
FTSH_TRIEI       NAPCIIFIDEIDAVGRQRGAG--IGGGNDEREQTLNQLLTEMDGFEGN-SGIIIIAATNR
FTSH_CYACA       KAPCIVFIDEIDAVGRQRGVG--IGGGNDEREQTLNQLLTEMDGFSGD-TGVIVVAATNR
FTSH_CYAM1       NAPCLVFIDEIDAVGRQRGAG--IGGGNDEREQTLNQLLTEMDGFEGN-TGVIVIAATNR
FTSH_TRICV       NAPCIVFIDEIDAVGRERGAG--VGGGNDEREQTLNQLLTEMDGFKEN-KGVIVVGATNR
FTSH_VAULI       NAPCIVFIDEIDAVGRQRGAG--IGGGNDEREQTLNQILTEMDGFKEN-TGIIVIAATNR
FTSH_HETA2       DTPCIIFIDEIDAVGRQRGAG--VGGGNDEREQTLNQLLTEMDGFEKN-KGIVVIAATNR
FTSH_ECTSI       NSPCILFIDEIDAIGRQRGTG--VGGTNDEREQTLNQILTEMDGFKPT-SGIIVIAATNR
FTSH3_SYNY3      NAPCIVFIDEIDAVGRQRGAG--LGGGNDEREQTLNQLLTEMDGFEGN-TGIIIVAATNR
FTSH_SYNJB       NAPCIVFIDEIDAVGRQRGAG--LGGGNDEREQTLNQLLTEMDGFEGN-SGIIVIAATNR
FTSH1_SPHTD      NAPCIVFIDEIDAVGRQRGAG--LGGSHDEREQTLNQILVEMDGFDST-TNVIVIAATNR
FTSH1_THERP      NAPCIVFIDEIDAVGRQRGAG--LGGSHDEREQTLNQILVEMDGFDSS-TNVIVIAATNR
FTSH_CHLAD       NAPCIVFIDEIDAVGRQRGAG--LGGSHDEREQTLNQILVEMDGFDTN-TNVIVIAATNR
FTSH_PSELT       NAPCIVFIDEIDAVGRHRGAG--LGGGHDEREQTLNQLLVEMDGFDVR-QGIVVMAATNR
FTSH_THEMA       HAPCIVFIDEIDAVGRHRGAG--LGGGHDEREQTLNQLLVEMDGFDSK-EGIIVMAATNR
FTSH_KOSOT       SAPSIIFIDEIDAVGRHRGAG--LGGGHDEREQTLNQILVEMDGFDAK-TGVIVMAATNR
FTSH2_PETMO      NSPAIIFIDELDAVGRQRGTG--LGGGHDEREQTLNALLVEMDGFDPR-EGIVVMAATNR
FTSH3_PETMO      NAPAIIFIDEIDAVGRQRGSG--LGGGHDEREQTLNSILVEMDGFDPS-IGIIVMAATNR
FTSH1_PETMO      NAPAIIFIDELDAVGRQRGAG--LGGGNDEREQTLNALLVELDGFDTS-TGVVVMAATNR
FTSH_HELPY       QAPSIIFIDEIDAIGKSRAAGGVVSG-NDEREQTLNQLLAEMDGFGSENAPVIVLAATNR
FTSH_HELPJ       QAPSIIFIDEIDAIGKSRAAGGMISG-NDEREQTLNQLLAEMDGFGSENAPVIVLAATNR
FTSH_HELFC       EAPSIIFIDEIDAIGKSRAAGGMISG-NDEREQTLNQLLAEMDGFGSENAPVIVLAATNR
FTSH_SULNB       EAPSIIFIDEIDAIGKSRASGGQMGG-NDEREQTLNQLLAEMDGFGTD-TPVIVLAATNR
FTSH_ATOPD       KAPCIIFIDEIDAVGKRRD--ASLNS-NDEREQTLNQLLSEMDGFDNH-KGIVVLAATNR
FTSH_CLOP1       KAPCIVFIDEIDAIGKSRD--GAIQG-NDEREQTLNQLLTEMDGFDSS-KGVVILAATNR
FTSH_TREPA       KAPGIIFIDELDAIGKSRL--NAIHS-NDEREQTLNQLLVEMDGFDNT-TGLILLAATNR
FTSH_PARD8       KSPCIVFIDEIDAVGRARGKNANMNS-NDERENTLNQLLTEMDGFGSN-SGVIILAATNR
FTSH_SULMD       KSPSIIFIDEIDAIGRARIKNNIPGG-NDERENTLNKLLTEMDGFSTK-TNVIVLAATNR
FTSH_RHOM4       KAPCIIFIDEIDAIGRSRGRGIMMGA-NDERENTLNQLLVEMDGFNTD-KGVIIMAATNR
FTSH1_SALRM      RAPCIIFIDEVDAIGRTRG-GPGGAG-TGERDNTLNQLLVEMDGFDSD-EGVVIMAATNR
FTSH_PELLD       KAPCIIFIDEIDAVGRSRGKGAMMGG-NDERENTLNQLLVEMDGFATD-KGVILMAATNR
FTSH4_SYNY3      QAPCIVFIDELDAIGKSR-ASGAFMGGNDEREQTLNQLLTEMDGFSAAGATVIVLAATNR
FTSH_ACAM1       QAPCIVFIDELDALGKARGGPGGFTGGNDEREQTLNQLLSEMDGFDP-NVGVILLAATNR
FTSH_ANAD2       KAPCIVFIDELDALGKSRN-AGIMGG-HDEREQTLNQLLAEMDGFDA-RAGLIIMGATNR
FTSH2_SORC5      KGACLVFIDELDAVGKVRGLGGSVGG-HDEREQTLNQLLTEMDGFDA-HTAMVVIGATNR
FTSH_PARP8       HAPAIVFIDELDSLGRARGSAFPGGGGHDEKEQTLNQLLAELDGFDT-SIGVVLLAATNR
FTSH_PSEP1       AAPCIIFIDELDALGKMRGVGSFGG--NDEKEQTLNQLLAELDGFDP-REGVVLLAATNR
FTSH2_BDEBA      NAPCIIFIDELDALGKVRGVAGSFGG-HDEKEQTLNQLLAELDGFDS-RSGVVILAATNR
FTSH_METPP       AAPAIIFIDELDALGKARGMGALVGG-HDEREQTLNQLLVELDGFDP-SVGVVLLAATNR
FTSH_RALPJ       KAPCIIFIDELDALGKTRALNAVGG--NEEREQTLNQLLVEMDGFDS-NKGVIIMAATNR
FTSH_SYNFM       HAPCIIFIDELDALGKARGLNPIGG--HDEREQTLNQLLVEMDGFDP-RSGVIIMAATNR
FTSH_BURP1       KAPCIIFIDELDALGKVRGAGLASG--NDEREQTLNQLLVEMDGFQA-NSGVILMAATNR
FTSH_PIRSD       KAPCIIFIDELDALGKSRGAGIMGG--HDEREQTLNALLVEMDGFGS-NSGVIVMAATNR
FTSH2_RHOBA      RAPCIIFIDELDALGKSRSGSVVGG--HDEREQTLNALLVEMDGFDS-NSGVIVVAATNR
FTSH_METCA       NAPCIIFIDELDAIGRSRGGPVVMGG-HDEREQTLNQLLTEMDGFDP-SVGVAVMAATNR
FTSH1_METI4      KAPCIVFIDELDAIGRQRGVRIQVG--SDEHEQTLNQLLVEMDGFDP-NEGIIVLAATNR
FTSH_ACIFD       QSPSIIFIDEIDSIG-RKRGT-GLGGGHDEREQTLNQMLSEMDGFDPA-EGIVVMAATNR
FTSH_ACIC1       HAPCIVFVDEIDAIGQRRAGA-GTIVANDEREQTLNQLLAEMDGFEPA-QGVVVLAATNR
FTSH1_SORC5      SAPSIVFIDEIDAVGRTRGGL-GALATHDEREQTLHQLLAELDGFDAR-TTVILMAATNR
FTSH1_SYMTH      AAPCIVFIDEIDALARRRG-V-GAGGGTEEREQTINQLLVEMDGFDSG-EGVIVVAATNR
FTSH_OPITP       TAPSIIFIDEIDAIGRQRSAA-ESGGAQQEHDQTLNALLVAMDGFDSD-DAVVVFGATNR
FTSH3_SORC5      SAPCIVFIDEIDAVGRARAKG-HGDSASAEHDQTLNQLLVEMDGFDHE-TGIVVIASTNR
FTSH2_SYMTH      NAPCIVFIDEIDAVGRQRGSA-AVVGGHDEREQTLNQLLTEMDGFGAY-EGVIVMAATNR
FTSH2_SPHTD      NAPAIIFIDEIDAIGRRRGRM-E---QSSEYDQTLNQILVEMDGFEER-TTVVVVAATNR
FTSH3_SPHTD      ASPAIVFIDEIDAIGRRRGDS-Q---SHQEYEQTLNQVLVELDGFHPR-QAVVVIAATNR
FTSH2_CONWI      MSPAIIFIDEFDAAGRKRG-A-GIGQGNDEREQTLNQLLVEMDGFSGD-GGLVVMGATNR
FTSH_THET8       HAPCIVFIDEIDAVGRKRG-S-GVGGGNDEREQTLNQLLVEMDGFEKD-TAIVVMAATNR
FTSH_LEPBD       SSPSIIFIDEIDAIGRRRSVGKNSGS-NDEREQTLNQLLVEMDGFETD-TKVIVLAATNR
FTSH_STRM9       EAPAIIFIDEIDAVGRRRGQNKNGGGGNEEREQTLNQLLVEMDGFDTD-QRIIVMAATNR
FTSH1_ALKMQ      KGKCVIFIDEIDAIGKKRDRG--GLGGSDESDRTLNALLTEMSGFKGS-EGIIVMAATNR
FTSH_LACP7       SEKAVIFIDEIDAIGKKRARS--TSASNDERDQTLNALLTEMSGFHEN-KGIVVIGATNR
                     ::*:**.:  .  :             :.*:: :*  :.*:      :  ..:**:

FTSH_MYCGE       LDVLDDALLRPGRFDRHIQINLPDIKEREGILKVHAENKNLSSKISLLDVAKRTPGFSGA
FTSH_MYCPN       LDVLDDALLRPGRFDRHIQINLPDIKEREGILQVHAKNKNLSSKISLLDVAKRTPGFSGA
FTSH_MYCGH       LDVLDDALLRPGRFDRHIQVNLPDIKEREAILKIHSRNKNISSKVNLLDIARRTPGFSGA
FTSH_MYCPE       LDVLDDALLRPGRFDRHIQVNLPDIKERVAILKIHSRNKNISETVDLEDIARRTPGFSGA
FTSH_UREP2       LDTLDDAILRPGRFDRQISVNLPDILEREQILRIHSRNKNLSAKVSLEDIARRTAGFSGA
FTSH_MESFL       ADVLDPALLRPGRFDRVIQVSLPDIKERKAILELHAKGKKIDGSVDWYRVAERTPGFSGA
FTSH_MYCPU       TDVLDPALLRPGRFDRIITVGLPDIKEREEILKLHSKGKRLSKEIKFDKIAKRTPGYSGA
FTSH_MYCS5       TDVLDPALIRPGRFDRIITVGLPDVKEREEILKLHAKGKRFESNVDFANIAKRTPGFSGA
FTSH_MYCMO       TDVLDPALLRPGRFDRTVTVGLPNVKDREAILKLHAKGKRISSEVSFQQLAKRTPGYSGA
FTSH_MYCA5       SDVLDPALLRPGRFDRTITVGLPDIKEREAILKLHAKGKRIANNVSFMMIARRTPGFSGA
FTSH_MYCCR       TDVLDPALLRPGRFDRSIIVGLPDIKEREEILKLHAKGKRISQNITLANIAKRTPGFSGA
FTSH_AYWBP       PEVLDSAILRPGRFDRHFNITLPNVKDREAILKLHASNKKLSEEISLEELAKQTPGFSGA
FTSH2_PHYMT      PESLDLAVTRPGRFDRHFHITLPSVKDREAILKLHARNKKFNDDVDFESLAKQTPGFNGA
FTSH3_PHYMT      ADMLDAALLRPGRFDRKILVNLPDIKSRAEILKLHAQNKKLSSDIDFHQLAQQTPGMSGA
FTSH1_PHYMT      ADMLDAALLRPGRFDRKILVNLPDIKSRAEILKLHAQNKKLSSDIDFHQLAQQTPGMSGA
FTSH_ACHLI       PDVLDPALLRPGRFDRQITMQVPDQKSREEILKVHARSKKLDPTIKFSEVAMRIPGFTGA
FTSH2_THEPX      IDMLDEALLRPGRFDRTIHIGAPNMKARLEILKVHTRNKPLDESVSLSELARKTHGMTGA
FTSH_AQUAE       PDILDPALLRPGRFDRQIFIPKPDVRGRYEILKVHARNKKLAKDVDLEFVARATPGFTGA
FTSH_HYDS0       PDILDPALLRPGRFDRQIFIPKPDVKGRYEILKVHAKNKPLAKDVDLELIARATPGFTGA
FTSH_ECOLI       PDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPLAPDIDAAIIARGTPGFSGA
FTSH_SHIFL       PDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPLAPDIDAAIIARGTPGFSGA
FTSH_ECO57       PDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPLAPDIDAAIIARGTPGFSGA
FTSH_SALTI       PDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPLATDIDAAIIARGTPGFSGA
FTSH_SALTY       PDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPLATDIDAAIIARGTPGFSGA
FTSH_BUCAI       PDVLDPALLRPGRFDRQVIVALPDIRGREQILKVHMRKVPLSKDVDPMIIARGTPGFSGA
FTSH_BUCAP       PDVLDPALLRPGRFDRQVIVALPDVRGRKQILKVHMRKVPLSEDVDPMIIARGTPGFSGA
FTSH_BUCBP       PDVLDPALLRPGRFDRQIFVALPDIRGREKIIQVHMKKVPLGNNVDPMIIARGTPGFSGA
FTSH_PHOPR       PDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRKVPLEGDVEPSLIARGTPGFSGA
FTSH_HAEIN       PDVLDPALTRPGRFDRQVVVGLPDVKGREQILKVHMRKVSVAQDVDAMTLARGTPGYSGA
FTSH_MAGMM       PDVLDPALLRPGRFDRQVTVPNPDILGRTQILKVHMNKVPLSDSVDAEVIARATPGFSGA
FTSH_CUPMC       ADVLDKALLRPGRFDRQVYVGLPDIRGREQILKVHMRKVPIGNDVDASIIARGTPGFSGA
FTSH_RICCN       PDVLDRALLRPGRFDRQIAVANPDINGREQILKVHLKKIKYNSTVLARIIARGTPGFSGA
FTSH_RICFE       PDVLDRALLRPGRFDRQIAVANPDINGREQILKVHLKKIKYNSTVLARIIARGTPGFSGA
FTSH_RICPR       PDVLDRALLRPGRFDRQIAVANPDINGREQILKVHLKKIKYNSTVLARIIARGTPGFSGA
FTSH_RICTY       PDVLDRALLRPGRFDRQIAVANPDINGREQILKVHLKKIKYNSTVLARIIARGTPGFSGA
FTSH_RICBR       PDVLDNALLRPGRFDRQITVSNPDIDGREKILQVHLKKVKYSTKIVPRIIARGTPGFSGA
FTSH_NEORI       PDVLDPALLRPGRFDRQITISIPDIAGRQKILEVHLKKIPTAPNVEVSIIARGTPGFSGA
FTSH_BARBK       PDVLDPALLRPGRFDRQVVVPNPDVAGREKILEVHVRNVPLAPNVNLRVLARGTPGFSGA
FTSH_CAUVN       PDVLDPALLRPGRFDRQVVVPNPDVAGREKIIRVHMKNVPLAADVDVKTLARGTPGFSGA
FTSH_ZYMMN       PDVLDPALLRPGRFDRQVIVPRPDIEGRLKILQVHMKKTPLAPDVDVRTIARGTPGFSGA
FTSH_HALO1       PDVLDPALLRPGRFDRRIIVPRPDLRGRTGILGVHTRKVPLSTEVALEVIARGTPGFSGA
FTSH_MYXXD       PDVLDPALQRPGRFDRRIVVPRPDVKGRLGVLKVHTRRVPLAPEVDLEVIARGTPGMTGA
FTSH4_SORC5      PDVLDPAILRPGRFDRRIVVNRPDVRGREGILRVHTKKVPLGPDVDMEILARGTPGFVGA
FTSH1_BDEBA      PDVLDPALLRPGRFDRRVIVNKPDLKGREQILAVHMRKTPLGPDVDASKIARGTPGFSGA
FTSH_ACIC5       PDVLDPALLRPGRFDRRVVVGRPDVRGREEVLRVHAKKVPLAEDVDLRVLARGTPGFSGA
FTSH_AKKM8       ADILDPALLRPGRFDRQVVVNLPDVRGREQILQVHARKVKMAPGVSFERIARGTSGFSGA
FTSH2_METI4      KDVLDPALLRPGRFDREVRVNLPDIRGREQILRVHAQKIKLSKNADLSALARGTPGFSGA
FTSH_LEPBJ       ADVLDPALLRPGRFDRQVMVDLPDIKGREEILKVHSRKVPMTSDISLHSIARGTPGFTGA
FTSH_BORBZ       PDVLDSALLRPGRFDRQVTVSLPDIKEREAILNIHSLKTKLSKDINLQVIARATPGASGA
FTSH_PELPB       PDVLDSALLRPGRFDRQITIDKPDIRGREAILKIHTRNTPLDGDVDITVLAKSSPGFSGA
FTSH_UNCTG       PDVLDPALLRPGRFDRQVIILSPDLKDREEILGVHSKKIRLDNDVNLNVIARRTPGFVGA
FTSH_SYNAS       PDVLDKALLRPGRFDRRVVVNLPDKVGREAILKVHTRSVPLAKDASLGELAAATPGFSGA
FTSH_THET1       PDVLDPALLRPGRFDRRVVVQRPDKVGRLKILQVHTRNVPLDPNLDLSEIAAATPGLVGA
FTSH3_CONWI      PEILDAALLRPGRFDRRVTVAAPDRNGRLMILKVHTRSVPLADDVDLESIASSTPGMVGA
FTSH_MARHV       PDVLDTALLRPGRFDRKITLDRPHREAREAILKVHVRKVPLAADVDLTQVAARTTGFSGA
FTSH_NITOC       PDVLDPALLRPGRFDRKVVLDLPDKKARQRVLEVHTKNVPLAADVDLERVARRTVGFSGA
FTSH_HAHCH       PDVLDPALMRPGRFDRHVTLDLPDQEGRVAILKVHARHIPLADDVNLNQVAAGTPGFSGA
FTSH4_SPHTD      PDVLDPALLRPGRFDRQVTVGLPDRRGREAILRIHTRGIPVADDLDLEELAAATPGFSGA
FTSH2_THERP      PDVLDPALLRPGRFDRQVVVGLPDKRGRAAILRIHTRGIPIAPDVDLEGLAAATPGFSGA
FTSH_PELCD       PDVLDPALLRPGRFDRQVTVERPDWRAREEILKVHTRQVPIDEDVDLQIIARSTPGMCGA
FTSH_PELPD       PDVLDPALLRPGRFDRHVVIERPDWRDREKILQVHVRKITMNGRIDLGVIARGTPGMTGA
FTSH1_RHOBA      PDVLDPALLRPGRFDRHVTVGRPTMKGREEIFKVHVRDVPLGDDVDLHRLAAGTVGLTGA
FTSH2_SALRM      PDILDSALTRPGRFDRQITVDLPTKQSRHEILKIHAREKPLSDDVDLEEIARSTPGFSGA
FTSH_BACPE       ADILDPALLRPGRFDRQIQVNRPDVNGREEVLKVHARNKPLNDDVNLKTIATRTPGFSGA
FTSH_BACSU       ADILDPALLRPGRFDRQITVDRPDVIGREAVLKVHARNKPLDETVNLKSIAMRTPGFSGA
FTSH_STAHJ       PDILDPALLRPGRFDRQIQVGRPDVKGREAILHVHSKNKPLDETVDLKAISQRTPGFSGA
FTSH_STRPN       SDVLDPALLRPGRFDRKVLVGRPDVKGREAILKVHAKNKPLAEDVDLKLVAQQTPGFVGA
FTSH_STRR6       SDVLDPALLRPGRFDRKVLVGRPDVKGREAILKVHAKNKPLAEDVDLKLVAQQTPGFVGA
FTSH_LACPL       SDVLDPALLRPGRFDRKILVGRPDVKGREAILKVHAKNKPLAADVDLKEIAKQTPGFVGA
FTSH_LACPJ       SDVLDPALLRPGRFDRKILVGRPDVKGREAILKVHAKNKPLAADVDLKEIAKQTPGFVGA
FTSH_LEUMM       SDVLDPALLRSGRFDRKILVGAPDVKGREAILNVHAKNKPLADNVDLKAIAQQTPGYVGA
FTSH_OENOE       SDVLDPALLRSGRFDRKILVGAPDVKGREAILRVHAKNKPLAADVDLKVIAQQTPGFVGA
FTSH_LACLA       SDVLDPALLRPGRFDRKVLVGAPDVKGREAVLKVHAKNKPLASDVDLHNVATQTPGYVGA
FTSH2_ALKMQ      PDILDPALLRPGRFDRQVMVGAPDIKGREQILQVHAKGKPLDEDVNLKVLARRTPGFTPA
FTSH1_THEPX      PDILDPALLRPGRFDRHITVGIPDIKGREEILKIHSRNKPLAPDVSLQVLARRTPGFTGA
FTSH_CALBD       PDILDPALLRPGRFDRQIVVNVPDAKAREEILKVHARNKPLGEDVDLSQIAKITAGFTGA
FTSH_RUMCH       PDILDPALLRPGRFDRRVVVGLPDIKGREQILKVHSRGKPLADDVRLDDLARITPGFTGA
FTSH_CLONN       PDILDKALLRPGRFDRQILVGAPDAKGREEVLKVHVRNKRLSDDVDLKVLAKRTPGFVGA
FTSH_VEIPT       PDILDPALLRPGRFDRQVIVGRPDLRGREAILKVHARNKPLADDVDLKIIAKKTPGFTGA
FTSH_HALOH       PDVLDPALLRPGRFDRQVVVDKPDVKGRMGILKIHLRNKPVADDVDVEVLAKRTPGFTGA
FTSH_NATTJ       SDILDPALQRPGRFDRQITVNAPDLKGREEILKVHARDKPLEDNVDLKVVARRTPGFTGA
FTSH3_SYMTH      PDVLDPALLRPGRFDRQIVIDRPDLKGRLAIFQVHAKGKPLEPDVDLEVLAKRTPGFTGA
FTSH_MYCTU       PDILDPALLRPGRFDRQIPVSNPDLAGRRAVLRVHSKGKPMAADADLDGLAKRTVGMTGA
FTSH_MYCTA       PDILDPALLRPGRFDRQIPVSNPDLAGRRAVLRVHSKGKPMAADADLDGLAKRTVGMTGA
FTSH_MYCBO       PDILDPALLRPGRFDRQIPVSNPDLAGRRAVLRVHSKGKPMAADADLDGLAKRTVGMTGA
FTSH_MYCLE       PDILDPALLRPGRFDRQIPVSNPDLAGRRAVLRVHSKGKPIADDADLDGLAKRTVGMTGA
FTSH_RHOE4       PDILDPALLRPGRFDRQIPVGAPDLAGRRAILRVHSQGKPIDPNADLEGLAKRTVGMSGA
FTSH_CORGL       PDVLDPALLRPGRFDRQIPVTNPDLRGREQILEVHAKGKPFAPDADIKALAKRTAGMSGA
FTSH_ROTMD       PDVLDPALLRPGRFDRQIGVDAPDMQGREHILRVHAAGKPIANTVDLAQVAKRTPGFTGA
FTSH_TROWT       SDVLDSALLRPGRFDRHVAIDAPNLQGRLKILQVHARTKPVSKSVDLEVLARKTPGFTGA
FTSH_BRAFD       VDILDPALLRPGRFDRQIGVEAPDLKGRLHILGVHAKGKPLAHDVDLEAVAKRAIGMSGA
FTSH_CUTAS       PDVLDPALLRPGRFDRQIAVEAPDLDGRLKILKVHAHGKPMADDVDLASIARRTPGMTGA
FTSH1_CONWI      PDILDPALLRPGRFDRQVTVDRPDRKGRSKILEVHTRGKPLAREIDIDALAGQTPGFTGA
FTSH_RUBXD       PDILDPALLRPGRFDRQIVVDRPDLPGRIKILKVHTRGKPLGEDVDIETIARGTPGFTGA
FTSH_SLAHD       VDVLDPALLRPGRFDRQIVVDGPDVKGRVKILEVHAKNKPIGEDVDLERIAKLTSGMTGA
FTSH_PORPU       ADILDSALLRPGRFDRQVSVDVPDFRGRLAILEVHAKNKKMESKVSLETIARRTPGFSGA
FTSH_PYRYE       ADILDSALLRPGRFDRQVSVDVPDFKGRLAILEVHAKNKKMEPKVSLETIARRTPGFSGA
FTSH_GUITH       VDVLDAALLRPGRFDRQVTVDVPDVKGRLEILNVHARNKKLDLSISLELIAKRTPGFSGA
FTSH2_SYNY3      PDVLDSALMRPGRFDRQVMVDAPDYSGRKEILEVHARNKKLAPEVSIDSIARRTPGFSGA
FTSH_NOSS1       PDVLDSALLRPGRFDRQVIVDAPDLKGRLEILQVHSRNKKVDPSVSLEAIARRTPGFTGA
FTSH1_SYNY3      PDVLDLALLRPGRFDRQVTVDYPDVQGRELILAIHAQNKKLHEEVQLAAIARRTPGFTGA
FTSH_TRIEI       PDVLDVALLRPGRFDRQVTVDLPAYKGRLGILEVHARNKKLTPEISLEAIARKTPGFSGA
FTSH_CYACA       IDVLDSALLRPGRFDRQIMVSLPNINGRLAILKVHSKKKKIHKDVLLEVIARRTPGFSGA
FTSH_CYAM1       VDVLDAALLRPGRFDRQIMVSMPDVKSRIAILKVHANQKKLHPQVSLEAVARRTAGFAGA
FTSH_TRICV       ADILDAALLRPGRFDRQVTVNLPDRLGRVGILKVHARNKPLGEDVSLVQLANRTPGFSGA
FTSH_VAULI       VDVLDGALLRPGRFDRQVSINLPDIKGRLEILKVHAKNKKLDSNISLGLIAQRTPGFSGA
FTSH_HETA2       ADILDNALLRPGRFDRQVTVNPPDRAGRVAILAVHARNKKLSPAISLETIAQRTTGFGGA
FTSH_ECTSI       ADVLDSALLRPGRFDRQITVYLPNIYGRIEILKVHSRNKNIDSKTSLKFIAQRTAGFSGA
FTSH3_SYNY3      PDVLDSALMRPGRFDRQVVVDRPDYAGRREILNVHARGKTLSQDVDLDKIARRTPGFTGA
FTSH_SYNJB       PDVLDAALLRPGRFDRQVTVDRPDFQGRLEILKVHARGKTLSADVDLEKLARRTPGFTGA
FTSH1_SPHTD      PDVLDPALLRPGRFDRQVVLDRPDIAGRRAILEVHSRGKPLESDVDLEELARQTPGFSGA
FTSH1_THERP      PDVLDPALLRPGRFDRQVVLDRPDLHGRLAILKVHTRGKPLESDVDLEDLARQTPGFSGA
FTSH_CHLAD       PDVLDPALVRPGRFDRQVVLDAPDVRGRIEILKVHVKGKPLAEDVNLEILARQTPGFSGA
FTSH_PSELT       PDILDPALLRPGRFDKKVVLDTPDVRGREEILKIHARNKPIAEDVDIRVLAQRTTGFVGA
FTSH_THEMA       PDILDPALLRPGRFDKKIVVDPPDMLGRKKILEIHTRNKPLAEDVNLEIIAKRTPGFVGA
FTSH_KOSOT       PDILDHALLRPGRFDKKITVDPPDVKGRAEILKIHMRGKPVDPDVDVWLLARRTPGFVGA
FTSH2_PETMO      PDILDKALLRPGRFDKKIFLDVPDLRAREEIIKIHLRGKRIADDIDVKSLAQSTPGFVGA
FTSH3_PETMO      PDVLDKALLRPGRFDKKVVIDRPDAEGRKDILKIHFRGKKIAPDVDLEVLARATPGFVGA
FTSH1_PETMO      PDVLDKALLRPGRFDKKIMVGPPDVKGREEILKIHTRKKKIAPDVDLKLLAKRTPGFVGA
FTSH_HELPY       PEILDPALMRPGRFDRQVLVDKPDFNGRVEILKVHIKGVKLANDVNLQEVAKLTAGLAGA
FTSH_HELPJ       PEILDPALMRPGRFDRQVLVDKPDFNGRVEILKVHIKGVKLANDVNLQEVAKLTAGLAGA
FTSH_HELFC       PEILDPALLRPGRFDRQVLVDKPDFKGRVEILKVHIKPVKLANDVDLQEIAKLTAGLAGA
FTSH_SULNB       PETLDAALLRAGRFDRQVLVDKPDFEGRLAILKVHSKDVKLAPNVDLEIVAKQTAGLAGA
FTSH_ATOPD       PETLDKALLRPGRFDRRIPVELPDLKGREAVLQIHANDVKMEPGVDLSIVAKSTPGASGA
FTSH_CLOP1       PEVLDKALLRPGRFDRRIIVDRPDLIGREEILKVHSRDVKLSDDVSLEEIAKSTPGAVGA
FTSH_TREPA       PDVLDPALLRPGRFDRQVCVDRPDLKGREAILRIHAQNVKLAPEVDLKAVARITGGYSGA
FTSH_PARD8       ADILDKALLRAGRFDRQIHVELPDLNERKEIFGVHLRPIKIDESVDAEFLARQTPGFSGA
FTSH_SULMD       YDVLDDALLRSGRFDRTIFIDLPSLKERKDIMKVHLKKIKFSKSIDLDFISRQIPGFSGA
FTSH_RHOM4       PDVLDPALLRPGRFDRQILIDKPDRRERLEIFKVHTRDLILGDDVDLEVLAGQTPGFAGA
FTSH1_SALRM      PDVLDAALLRPGRFDRQISIHKPDRLERADIFRVHVADLRLDASVDPEALARQTPGFAGA
FTSH_PELLD       PDVLDPALLRPGRFDRQIMVDKPDLKGRMDTFRVHTKNMSLSPDVNLKALASQTPGFAGA
FTSH4_SYNY3      PETLDPALLRPGRFDRQVLVDRPDLAGRLKILEIYAKKIKLDKEVELKNIATRTPGFAGA
FTSH_ACAM1       PEVLDPALLRPGRFDRQIVVDRPDKMGREAILKVHVRGVKLAEDINLTKLAVRTPGFSGA
FTSH_ANAD2       PEILDPALLRPGRFDRQVLVDRPDKRGREQILRIHARNVKLGPDVDLRSVAARTPGFAGA
FTSH2_SORC5      AEILDPALLRPGRFDRRVHIDRPDLAERKEILAVHARKVALDPGADLDAVAAQTAGLVGA
FTSH_PARP8       PEILDPALLRAGRFDRQVLVDRPDKKGRAQILEVHLKKIALAPGVPVDDIAALTPGFSGA
FTSH_PSEP1       PEVLDPALLRAGRFDRQILIDRPDRKGRLAILKVHLHKIIYKNDLDCERIAEITPGLTGA
FTSH2_BDEBA      PEVLDPALLRAGRFDRQVLVDRPDRTGREQILRVHLKKIKADEALNVEHLAHLTSGFTGA
FTSH_METPP       PEILDPALLRAGRFDRQVLVDRPDRSGRRAILRVHAAKVRLAPDWDLDQVAAITVGFAGA
FTSH_RALPJ       PEILDPALLRPGRFDRHVALDRPDLKGREQILKVHVKGVVLAPEVDLTKLAGRTPGFAGA
FTSH_SYNFM       PEILDPALLRPGRFDRHVAIDKPDIRGREAILRVHVKEVKLGSEVDLKKIAGMTPGFVGA
FTSH_BURP1       PEILDPALLRPGRFDRHIAIDRPDLTGRRQILSVHVKHVKLGPDVDLGELASRTPGFVGA
FTSH_PIRSD       PETLDPALLRPGRFDRHVLVDRPDIKGREDILKVHVKNVKLDPTVDLHKVAAITPGFVGA
FTSH2_RHOBA      PETLDPALLRPGRFDRHVLVDRPDVAGREEILAVHVKNVKLDETVELKGIASITSGFVGA
FTSH_METCA       PEILDKALLRSGRFDRQIVVDKPGLEDRVSILKLHTRKMKLAADVDLRVVAQRTPGFVGA
FTSH1_METI4      PEILDRALLRPGRFDRQVVVDLPDANGREAILRVHARGKPLSENIDFKEIAQATMGFSGA
FTSH_ACIFD       PDILDPALLRPGRFDRQIVVPLPDLPERLAILQVHTRGKRLAPDVDLEVMAKGTPGMSGA
FTSH_ACIC1       PEVLDPALLRPGRFDRQVTVPLPSQADRAAILRVHCRNKRLAPDVDLDAVARATPGFSGA
FTSH1_SORC5      PEVLDPALLRPGRFDRQVIVDRPDLRGREAILAVHARRVPLASGVDLGLVARRTPGMVGA
FTSH1_SYMTH      PDVLDPAVLRPGRFDRHLTVDPPDRKGREQILAVHAREKRLSQAVALAEVARLTPGFTGA
FTSH_OPITP       PDTMDRALLRPGRFDRQVSVGLPDLRGRLAILQVHAGSVKLDPSVDLQEIAKATPGFSGA
FTSH3_SORC5      ADMLDPALLRPGRFDRKVTVPLPDVRGREEILNVHAGPIPLQGEVDLSYIARGTPGFSGA
FTSH2_SYMTH      PDVLDKALLRPGRFDRQIPVGPPDAAGREEILRVHAKGKQLDPSLDLAAVARRTPGFTGA
FTSH2_SPHTD      VDILDPALLRPGRFDRKVVVDLPDRKARRAILEVHARGKPLAENVNLDELAARTTGMTGA
FTSH3_SPHTD      SDILDPALLRPGRFDRRVELSLPDRAERAAILRVHAQDKPLAPDVDLDALAARTVGLSGA
FTSH2_CONWI      PDILDPALLRPGRFDRQITVDTPDVHGRSEILRLHGSKRPMAPDADLDEIARLTPGFSGA
FTSH_THET8       PDILDPALLRPGRFDRQIAIDAPDVKGREQILRIHARGKPLAEDVDLALLAKRTPGFVGA
FTSH_LEPBD       EDVLDPALLRAGRFDRRVTVDAPDLQGRIAILKVHSRNKKLARDVKLEDIAKITPGFVGA
FTSH_STRM9       SDVLDPALLRGGRFDRRIEVSRPDVKGRIEILKVHSRNKKLASDVKLEDIAKITPGFVGA
FTSH1_ALKMQ      LDILDDALLRPGRFDRQIEIGLPDLKARQDILQLYTQNRPIDPKVCLRGIAQQTVYFSGA
FTSH_LACP7       LDTLDEALLRPGRFDRQIEVGLPDILARKKILKLYGDKKPLGDDVDLEVLAKNTVSFSGA
                  : :* *: * ****: . :  *    *   : ::              ::        *

FTSH_MYCGE       QLENVINEATLLAVRDNRTTININDIDEAIDRVIAG-PAKKSRVISDED-RKLVAYHEAG
FTSH_MYCPN       QLENVINEATLLAVRDNRTTINMNDIDEAIDRVIAG-PAKKSRVVSDAD-RKLVAYHEAG
FTSH_MYCGH       QLENVLNEATLLAVRADRTSISLTDIDEAIDRVIAG-PAKKSRVISDFE-KNQVAHHEAG
FTSH_MYCPE       QLENVLNEATLLAVRRNKKSIYTEELDEAIDRVIAG-PAKKTRVISLEE-KRQIAFHEAG
FTSH_UREP2       QLENVLNEAALLSVRDKATSIHMNHLDEAIDRVIAG-PSRPNKVISERE-REQVSYHEAG
FTSH_MESFL       QLENVLNEAAILMVREKRDIITITEIDEAIDRVVGG-PAKKSRAMTKQD-KDIVSYHESG
FTSH_MYCPU       QLENVINEASLLSVREKTDVIISTQIDEAIDRVMAG-PAKKSRVISQEE-LKAVAYHEAG
FTSH_MYCS5       QLENVINEAVLLSIREDTKVINLYQIDEAIDRVMSG-PAKKSRTITKEE-LTMVAYHEAG
FTSH_MYCMO       QLENVINEASLLSVREDTKIITLEQFDEAIDRVMSG-PAKKSRVITKEE-LTAVAYHEAG
FTSH_MYCA5       QLENVINEASLLSVRENTNVITLPQLDEAIDRVMAG-PAKKSRTISEKE-NAAVAYHEAG
FTSH_MYCCR       QLENVINEATLLSVREKTQVITGKQIDEAIDRVISG-PAKKNRVITEDE-RTMVAYHEAG
FTSH_AYWBP       QLEGTLNEAALLAARRNATFINKKDISEALDRILIG-PTKKSKKYNDKE-KRMVAYHEAG
FTSH2_PHYMT      QLEAILNESALLATRRNVLVICNEDISEALDRVLMG-PSKKSKKYNDKE-KRMVAYHESG
FTSH3_PHYMT      QLAAVLNEASILTVRNHKDFITMTELSEALDRVLMG-PAKKSIKYDPEE-RRMVAYHEAG
FTSH1_PHYMT      QLAAVLNEASILTVRNHKDFITMTELSEALDRVLMG-PAKKSIKYDPEE-RRMVAYHEAG
FTSH_ACHLI       DIENLLNEAALLAARESRTVISMQDIDEAADRVTMG-PAKKSRKYSPNE-KKMVAYHEAG
FTSH2_THEPX      HLAAMCNEAAILAVMKNKSKIGKEEFEEALERVIAG-LKKKNPSVLEKE-RNIAAYHEAG
FTSH_AQUAE       DLENLLNEAALLAARKGKEEITMEEIEEALDRITMG-LERKGMTISPKE-KEKIAIHEAG
FTSH_HYDS0       DLENILNEAALLAARKRKDLIHMEDLEEAIDRVMMG-LERRGMAISPKE-KEKIAVHEAG
FTSH_ECOLI       DLANLVNEAALFAARGNKRVVSMVEFEKAKDKIMMG-AERRSMVMTEAQ-KESTAYHEAG
FTSH_SHIFL       DLANLVNEAALFAARGNKRVVSMVEFEKAKDKIMMG-AERRSMVMTEAQ-KESTAYHEAG
FTSH_ECO57       DLANLVNEAALFAARGNKRVVSMVEFEKAKDKIMMG-AERRSMVMTEAQ-KESTAYHEAG
FTSH_SALTI       DLANLVNEAALFAARGNKRVVSMVEFEKAKDKIMMG-AERRSMVMTEAQ-KESTAYHEAG
FTSH_SALTY       DLANLVNEAALFAARGNKRVVSMVEFEKAKDKIMMG-AERRSMVMTEAQ-KESTAYHEAG
FTSH_BUCAI       DLANLVNEAALFAARLDKRVVSMLEFERAKDKMMMG-SERRSMVMSDFQ-KESTAYHEAG
FTSH_BUCAP       DLANLVNEAALFAARFNNRVVSMIHFEKAKDKIMMG-SERRSMVMSDFQ-KESTAYHEAG
FTSH_BUCBP       DLANLVNEAALFAARNNRDVVMMSDFESAKDKITMG-SERRSMVMTEKQ-KESTAYHEAG
FTSH_PHOPR       DLANLVNEAALFAARGNKRVVSMQEFELAKDKIMMG-AERKSMVMSEDQ-KESTAYHEAG
FTSH_HAEIN       DLANLVNEAALFAARVNKRTVTMLEFEKAKDKINMG-PERRTMIMTDKQ-KESTAYHEAG
FTSH_MAGMM       DLANLVNEAALIAAQLDKRVVEMEDFENAKDKVMMG-KPRRSAVISEKE-RKTTAYHEAG
FTSH_CUPMC       DLANLVNEAALFAARRSKRVVDMQDFEDAKDKIYMG-PERKSTVMREEE-RKATAYHESG
FTSH_RICCN       ELANLVNEAALIAARLGKKEVDMHDMEEAKDKVLMG-VARRSIAMSEKE-KRLTAYHEGG
FTSH_RICFE       ELANLVNEAALIAARLGKKEVDMHDMEEAKDKVLMG-VARRSIAMSEKE-KRLTAYHEGG
FTSH_RICPR       ELANLVNEAALIAARLGKKEVDMHDMEEAKDKVLMG-VVRRSIAMSEKE-KRLTAYHEGG
FTSH_RICTY       ELANLVNEAALIAARLGKKEVDMHDMEEAKDKVLMG-VVRRSIAMSEKE-KRLTAYHEGG
FTSH_RICBR       ELANLVNEATLIAARRNKKEVEMHDLEEAKDKVMMG-VERRSMIMSDEQ-KKLTAYHEGG
FTSH_NEORI       DLANLVNESALIAARRNKKVVTNEDFEYARDKILMG-MERKSLVMREEE-KLLTAYHEAG
FTSH_BARBK       DLMNLVNEAALMAASRNKKVVTMQEFEDAKDKVMMG-AERRSTAMTQEE-KELTAYHEAG
FTSH_CAUVN       DLANLVNEAALMAARKNRRMVTMQDFEQAKDKVMMG-AERRSMAMNEEE-KKLTAYHEGG
FTSH_ZYMMN       DLANIVNEAALLAARKGKRLVAMSEFEEAKDKVMMG-AERRSVIMTEEE-KRSTAYHEAG
FTSH_HALO1       DLESLVNEAALIAARRDKDRVDMEDFEDAKDKVMMG-AERRSMIISDKE-KRTTAYHEAG
FTSH_MYXXD       DLENLVNESALMAARQNKERVDLSDFEAAKDKVFMG-PERRSMIMTEKE-KKNTAVHEAG
FTSH4_SORC5      DIENLVNEAALLAARQDKDVVSMVDFEMAKDKVLMG-AERRSMVISDEE-KRTTAYHEAG
FTSH1_BDEBA      DLENLVNEAALVAARSDKKYLEMEDFEKAKDKVTMG-AERRSMVISDED-KKVTAYHEAG
FTSH_ACIC5       DLANMVNEGALSAARANRKVVTMQDFESAKDKVLMG-AERKSMLLTDEE-KRVTAYHESG
FTSH_AKKM8       QLANLVNEAALLAARKGLKEITEAELEEARDKVSWG-RERRSLAINERG-RRITAVHEAG
FTSH2_METI4      ELANLINEAALIAAKKGKDNVDQPDLEEARDKVRWG-KERRSLAMSEEE-RKTTAYHEAG
FTSH_LEPBJ       DLANLINEGALLAARKNKKRVTQEELEEARDKVMMG-PERKSFFISEKE-KEVIAYHEAG
FTSH_BORBZ       DLANLINEGALIAARNNQDEILMKDMEEARDKILMG-VAKKSMTITDRQ-KLETAYHEAG
FTSH_PELPB       DLANLVNEAALLAARHEQVLITAVNFEQARDKILMG-PERRSMFISDEQ-KKLTAYHEAG
FTSH_UNCTG       DLANLVNEAALLAARNSQNAVNMKNMEEAIDRILAG-PQRKSRLMSDKE-KNIIAYHEAG
FTSH_SYNAS       DLRNLVNEAALMAARRDQDDVRARDFLDALEKIVLG-PERP-LLLSHAD-KERIAYHEGG
FTSH_THET1       DLRNLVNEAALLAARRGKNYVDREDFFDALEKITLG-AERK-LLISEED-RRRVAYHESG
FTSH3_CONWI      DLANLVNEAALLAARRGHVKVTNSDVADALEKVVLG-AERK-VMMSDDD-RRRTAYHESG
FTSH_MARHV       DLKNLVNEAALTAARDNLVEVNNHCFEVAHDRLILG-EERD-AQLTPEE-REAVAYHECG
FTSH_NITOC       DLANLVNEAALLTGRERKKEVDMDMFNLARDKIVLG-AKRE-TILGEEE-KKLVAYHESG
FTSH_HAHCH       DLKNLINEAAIQAARENRDHVHSLDFDIARDKIIMG-AERT-LIIPPDE-KHRLAVHESG
FTSH4_SPHTD      DLANLVNEAALMAARKNKKIVERIDFDEALDKIVLG-TERA-MIMSEHD-KRVVAYHEAG
FTSH2_THERP      DLANLVNEAALVAARRGKQVVDRSDFEEALDKMLLG-TTRS-LLMSQEE-RRLVAYHEAG
FTSH_PELCD       DLENLVNEAALIAARENAQKVTMQHFEQAKDRVLMG-TERK-LVMSQQE-KRITAYHEAG
FTSH_PELPD       DLESLVNEAAILASRENAAAVTMEHLEKAKDKILMG-SERR-MIISLEE-KRITAYHEAG
FTSH1_RHOBA      DIRNMVNEAALWAARGDKKIVEMSDFDYARDKILMG-AKRE-EVLLESE-KEKTAYHEAG
FTSH2_SALRM      DLENLLNEAALLAGRHGHDAIQYSDIEQARDKVMMG-LKRDGMVLDDEE-KKLLAYHEAG
FTSH_BACPE       DLENLLNEAALVAARHDHTKISMIHIEEAIDRVIAG-PAKKSRVISPKE-KKIVAWHEAG
FTSH_BACSU       DLENLLNEAALVAARQNKKKIDARDIDEATDRVIAG-PAKKSRVISKKE-RNIVAYHEGG
FTSH_STAHJ       DLENLLNEASLIAAREGKNKIDMRDIEEATDRVIAG-PAKKSRVISDKE-RNIVAHHEAG
FTSH_STRPN       DLENVLNEAALVAARRNKSIIDASDIDEAEDRVIAG-PSKKDKTVSQKE-RELVAYHEAG
FTSH_STRR6       DLENVLNEAALVAARRNKSIIDASDIDEAEDRVIAG-PSKKDKTVSQKE-RELVAYHEAG
FTSH_LACPL       DLENLLNEAALLAARRNKKQVDAADLDEAEDRVIAG-PAKHDRVVNKHE-RETVAYHEAG
FTSH_LACPJ       DLENLLNEAALLAARRNKKQVDAADLDEAEDRVIAG-PAKHDRVVNKHE-RETVAYHEAG
FTSH_LEUMM       DLENLLNEAALLAARRNKSKVDAADIDEAEDRIFQG-PAKTNHNMSESE-RRTTAYHEAG
FTSH_OENOE       DLENLLNEAALLAARNDEKAVTAADIDEAEDRVIAG-PAKKDRKTTQDE-RETVAYHEAG
FTSH_LACLA       DLENVLNEAALVAARQNKKEINAADIDEGMDRAMAG-PAKKDRIQSMRE-REIVAYHEAG
FTSH2_ALKMQ      DIENLMNEAALLTARKNEKKIKMETVEEAITKVIAG-LEKKSRVISEKE-RKLTAYHEAG
FTSH1_THEPX      DLENLMNEAALLAARRGLKQITMAELEEAITRVIAG-PEKRSRIMSEKD-KKLVAYHEAG
FTSH_CALBD       DLENLLNEAALLAARKGKRQINMEEVQEAVAKVLMG-PEKRSRVYTEKE-KKLTAYHEAG
FTSH_RUMCH       DIENLLNEAALLTARANKKKIGNEEIKEAAFKVMMG-PEKKSRVMSEHD-KKVTAYHEAG
FTSH_CLONN       DLENLMNEAALLAVRANKKQIGMEELEEAITRVIAG-PEKKSRVIHEED-RKITAYHEAG
FTSH_VEIPT       DLSNLLNEAALLAARLNKKVITMAEVEEASEKVSMG-PERRSHIVSDKD-RKLTAYHESG
FTSH_HALOH       DMENLANEAAILAVRRRKNKITMEDFDDAIDKVIAG-PAKKSKVMSERE-RKLVAYHETG
FTSH_NATTJ       DLENLVNEAAIYAARRNKNRIGMKELEGAIDRVIAG-TEKKSRVISEFE-KKIVAYHEAG
FTSH3_SYMTH      DIANLMNEAALLAARRRKKKISMQDVEDAIDRVLAGGPEKKSRVISEKE-KRVTAYHEAG
FTSH_MYCTU       DLANVINEAALLTARENGTVITGPALEEAVDRVIGG-PRRKGRIISEQE-KKITAYHEGG
FTSH_MYCTA       DLANVINEAALLTARENGTVITGPALEEAVDRVIGG-PRRKGRIISEQE-KKITAYHEGG
FTSH_MYCBO       DLANVINEAALLTARENGTVITGPALEEAVDRVIGG-PRRKGRIISEQE-KKITAYHEGG
FTSH_MYCLE       DLANVVNEAALLTARENGLVITGPALEEAVDRVIGG-PRRKGRIISEQE-KKITAYHEGG
FTSH_RHOE4       DLANVINEAALLTARENGTVITEASLEESVDRVVGG-PRRKSRIISEHE-KKITAYHEGG
FTSH_CORGL       DLANVLNEAALLTARVGGNVITADALEEATDRVVGG-PRRSGKVISEKE-KKVTAYHEGG
FTSH_ROTMD       DLANVMNEAALLTARDNGNVIDDRAIDEAIDRVMAG-PQRSSRIMNEHE-RKVTAYHEGG
FTSH_TROWT       DLANVLNEAALLTARSNAQIIDDRALDEAVDRVMAG-PQRRSRVMTDHE-KLVTAYHEAG
FTSH_BRAFD       DLANVLNEAALLTARSGNQIIDNRALDEAIDRVSMG-PQRYSKVMTERE-RQMTAYHEGG
FTSH_CUTAS       DLANVLNEAALLTARANLPVIGNSELDEAIDRVIAG-PQKKTRLMNQHE-RLVTAYHEGG
FTSH1_CONWI      DLANLVNEAALLAARTGKREITQVELEEGIMRVIAG-PEKKTRVMSSEE-RRITAYHEMG
FTSH_RUBXD       DLANLVNEAALLAARHNKEQIEMAEMEEAIDRVIAG-PERKTRLISEKE-KEITAYHEAG
FTSH_SLAHD       DLMNLMNEAALLTARRNKDKIGMDEVNESMERLMAG-PERKTRVLNEKT-RRTIAYHESG
FTSH_PORPU       DLANLLNEAAILTARRRKSAMTMSEIDTSIDRVVAG--LEGTPLIDSKS-KRLIAYHEVG
FTSH_PYRYE       DLANLLNEAAILTARRRKNAMTMSEIDTSIDRVVAG--MEGTPLIDSKS-KRLIAYHEVG
FTSH_GUITH       DLANLLNEAAILTARRRKKQITISEIDASIDRVIAG--MEGKALVDSKT-KRLIAYHEVG
FTSH2_SYNY3      DLANLLNEAAILTARRRKSAITLLEIDDAVDRVVAG--MEGTPLVDSKS-KRLIAYHEVG
FTSH_NOSS1       DLANLLNEAAILTARRRKEAITILEIDDAVDRVVAG--MEGTPLVDSKS-KRLIAYHEVG
FTSH1_SYNY3      DLANVLNEAAIFTARRRKEAITMAEVNDAIDRVVAG--MEGTPLVDSKS-KRLIAYHEVG
FTSH_TRIEI       DLANMLNEAAILTARRRKEGITPNEIDDAIDRVTIG--LSLTPLLDGKK-KRLIAYHELG
FTSH_CYACA       DLANLLNEAAILTVRRGKVEITMKEIEDSIDKIIAG--LEGSPLADSRI-KRLIAYHEAG
FTSH_CYAM1       DLANLLNEAAILAVRRGLKQITWKEIDDAIDRVIAG--MEGTPIMDGKI-KRLIAYHETG
FTSH_TRICV       DLANLLNEAAILATRYKKSSITKNEVNEAADRIIGG--IAGAPMEDTKN-KRLIAYHEVG
FTSH_VAULI       DLANLLNESAILTARRNKFAITMSEVNTAIDRLLAG--LEGTSLTDTKN-KRLIAYHEIG
FTSH_HETA2       ELANLLNEAAIISAREEKAEIGSKEISLAIERVIAG--LEGPSIADNKN-KRLVAYHEAG
FTSH_ECTSI       DLANILNEAAILTARANLETITIKQIYTAIERIIAG--LEGVLLNDSRN-KRLVAYHEVG
FTSH3_SYNY3      DLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAG-PEKKNRVMSEKR-KTLVAYHEAG
FTSH_SYNJB       DLANLLNEAAILAARRNLTEISMDEINDAVDRVLAG-PEKKDRLMSERR-KELVAYHEAG
FTSH1_SPHTD      DLENLVNEAAILAARRNKKTIGRRELTEAIDRVIAG-PERKSRVLSERE-KLMTAYHEAG
FTSH1_THERP      DLENLVNEAAILAARRNKKTIGRRELYEAIDRVVAG-PERKSRRISERE-KLMTAYHEAG
FTSH_CHLAD       DLMNVVNEAAILAARRSKRKISMAEFQDAVERVAIGGPERRSRVMTDRQ-KLVVAYHEAG
FTSH_PSELT       DLENLVNEAALLAARNGRDKIKMEDFEEAIDRVIAG-PARKSRVISPRE-KRIVAYHEVG
FTSH_THEMA       DLENLVNEAALLAAREGRDKITMKDFEEAIDRVIAG-PARKSKLISPKE-KRIIAYHEAG
FTSH_KOSOT       DLENLVNEAAILAARRKKKIIGMKELEEAIDRVIAG-PARKSRIMNPKE-KKIVAYHELG
FTSH2_PETMO      DLENMVNEAALLAARDNRDHITNDDFQEAIERVIVG-PARKSRKITPKE-KKVITYHELG
FTSH3_PETMO      DLENLVNEAALLAARNGEKFITMKDCEEAIERVIVG-PERKTRVLSEQE-KEVVAYHELG
FTSH1_PETMO      DLENLVNEAALIASRKKKNQVEMSDFEEAIDRVLTG-PSKKYRIISDKE-KKILSYHELG
FTSH_HELPY       DLANIINEAALLAGRNNQKEVRQQHLKEAVERGIAG-LEKKSRRISPKE-KKIVAYHESG
FTSH_HELPJ       DLANIINEAALLAGRNNQKEVKQQHLKEAVERGIAG-LEKKSRRISPKE-KKIVAYHESG
FTSH_HELFC       DLANIINEAALLAGRNNQKEVKQQHLKEAVERGIAG-LEKKSRRISPKE-KKIVAYHESG
FTSH_SULNB       DLANIINEAALLAGRQNKKQIEQSDLLEAIERSFVG-LEKKNRKINETE-KKIVAYHESG
FTSH_ATOPD       DLANIINEAALRAVRFGRRRVTTEDLTESVDVVIAG-AKKKNSVLSEHE-KDVVAYHETG
FTSH_CLOP1       DLANIVNEAALRAVKHGRKFVIQEDLDEAVEVIIAG-QEKRDRILSPKE-KKIVAYHEVG
FTSH_TREPA       DLANVVNEAALLAVRSGRAQVIETDLDEAVEKTMIG-LQKKSRVIREEE-RRIIAYHETG
FTSH_PARD8       DIANVCNEAALIAARNGKKFVQKEDFMNAVDRIVGG-LEKRSKITTEEE-RKCIANHEAG
FTSH_SULMD       DISNICNEAALLAARRNKVKVETKDFIDTIYRRIGG-IEKKNILIKKNE-KKRIAYHETG
FTSH_RHOM4       EIANVCNEAALLAARKGKEAVEMEDFEQAIDRVIAG-LEKKNKIISPEE-REIVAYHEAG
FTSH1_SALRM      EIANVCNEAALLAARRGRNAVQMDDFDQALDRVMAG-LERSNKLISPEE-RRVIAHHESG
FTSH_PELLD       EIANAANEAALLASRRNKESIEMKDFEDAIERVVAG-LEKKNKVINPKE-KRIVAYHEAG
FTSH4_SYNY3      DLANLVNEAALLAARNKQDSVTEADFREAIERVVAG-LEKKSRVLSDKE-KKIVAYHEVG
FTSH_ACAM1       DLANLVNEAALLAARQSRDAVVMSDFNEAIERVVAG-LEKKSRVLNDLE-KKTVAYHEVG
FTSH_ANAD2       DLANVVNEAALLAARRNKNHVTRAEFEEAIERVVAG-LEKKSRRINERE-KEIVAFHEAG
FTSH2_SORC5      DLANIVNEAALLAARRGAEAVGHGDLEAAIERGLAG-LERRGRRLGARE-KLVVAYHEVG
FTSH_PARP8       DLANLVNEAAILATRRHAENVSLDDFTQAIERIVAG-LEKRNRLLNAHE-REVVAHHEMG
FTSH_PSEP1       DLANLVNEAAIVATRRSSQWVELQDFTAAVERLVAG-IERKGSVLRSDE-RQVVAYHEMG
FTSH2_BDEBA      DIANLINEAAMVATRRKAETVNEKDFVAAIERIVAG-LEKKSRLLNEKE-KAIVAHHEMG
FTSH_METPP       DLANLVNEAALVATRRRADAVTLADFTIAIERIVAG-IEKKHGLLGEDE-KRLVAYHELG
FTSH_RALPJ       DLANLVNEAALLAARKSKQMVEMADFDEALDRIVGG-LEKKNRVMNPKE-KETIAFHEAG
FTSH_SYNFM       DLANLVNEAALVAARRDRDEVTMADFQEAADRIIGG-LEKKNRAMNPKE-KEIVAYHEAG
FTSH_BURP1       DLANIVNEAALHAAELDKPAIDMSDFDEAIDRAMTG-MERKSRVMSERE-KITIAHHEAG
FTSH_PIRSD       DLANLVNEAALLAARAEKTAVGMNEFNEGVERVTAG-LEKKQRVMNEDE-KLRVAYHESG
FTSH2_RHOBA      DLANLVNEAALLAARNGKPAVAMEEFNEAVERVTAG-LEKKNRVMNEDE-KIRVAYHESG
FTSH_METCA       DLANAANEAAIIAVRANKAAIGMADFEAAIDRILAG-PEKKSRLLNDAE-KHRVAVHESG
FTSH1_METI4      DLANLLNEAALLAARRKSSRIEQVDLLEAMEKVIAG-PERKSRVLSEKE-RERVAYHEVG
FTSH_ACIFD       DLANLVNEAALNAVRRGATDIAMADFDSARDRIIMG-QRREATILSDEE-KERVAFHEGG
FTSH_ACIC1       ELANLVNEAAIAAARAGRRDLTAEDFRYARDRIILG-RREDSNVLLPSE-RHAVAVHEAG
FTSH1_SORC5      DLAKIVNEAALAGARRGAREIGQADFDEALDRSQLG-LRRRGQIMTAEE-RRRVAYHEAG
FTSH1_SYMTH      DLANLLNEAALLAVRAGEREIGWPQVAMALERVTSG-GPPRRVRAAAAD-RVRAAYHEAG
FTSH_OPITP       DLANLLNEGAIHAARHRRATILHSDLDEARDKINWG-RETR-RVMTVQD-KAVIAYHEAG
FTSH3_SORC5      DLANLLNEAAILAAREGADAVDPTHIDRARDRVLMG-LERK-GVLVDEDERYATAVHEAG
FTSH2_SYMTH      DLANLLNEAAILAVRRGRSHITMSEIDEAIDRVVAG-GPARKGRMIRPEEKRRVAVHEAG
FTSH2_SPHTD      DLANVINEAAILAARDRRETITNQDLLEALDRTLAG-PARNARRFSERE-RRVVAYHEAG
FTSH3_SPHTD      DLENTLNEAALLALRRGGDEITQADLEEAVDRVIAG-PSRRSRALSARE-RETIAVHEAG
FTSH2_CONWI      ELANVVNEAALLTVRGGRREISQKLLEESIDRVVAG-PAKKHLLTE-RE-RWIISIHESS
FTSH_THET8       DLENLLNEAALLAAREGRRKITMKDLEEAADRVMMG-PAKKSLVLSPRD-RRITAYHEAG
FTSH_LEPBD       DLANLLNEAAILAARRASDTIKMADLDEAVDKIGMG-LGQKGKIIKPEE-KKLLAYHEAG
FTSH_STRM9       DLENLLNEAAILAARKNSDEITMEDLDEAVDKVGMG-LGQKSKIISKRD-KDMLAYHEGG
FTSH1_ALKMQ      KLENLMNEAAIYAAREEADFITEGHIDKAFYTVVAGEEKKDRSNIQPID-RKITAYHEAG
FTSH_LACP7       MLENLLNEAAIQAANEKSSYIQSSHVDKAFYTVIAGSPLQDRSFISEKD-KSITAYHEAG
                  :    **. :         :              *                  : ** .

FTSH_MYCGE       HALVGLHVHSNDE-VQKITIIPR-GQAGGYTLSTPKS--GDLNLKRKSDLLAMIATAMGG
FTSH_MYCPN       HALVGLHVHSNDE-VQKITIIPR-GQAGGYTLSTPKS--GDLNLKRKSDLLAMIATAMGG
FTSH_MYCGH       HALVGLHLKGADE-VQKITIIPR-GQAGGYTLSTPKD--AELNLKKKSDLLNMIAGALGG
FTSH_MYCPE       HAIVGMYTKGSEV-VEKITIIPR-GQAAGYTLSVPEI--QELSIQKKSDLLGMVAGLLGG
FTSH_UREP2       HALIGLYSPGADV-VQKITIVAR-GRAAGYTLQTPER--NENILQNKTELISRVRTALGG
FTSH_MESFL       HALIGLKLDSASK-VQKVTIIPR-GNAGGYTIMTPK---DETVFSSKKDLFATIAGYLGG
FTSH_MYCPU       HAVVGLKVKGGNK-VQKITIIPR-GNAGGYNLMTPEE--EKYNA-SKKELLATIASYMGG
FTSH_MYCS5       HAVVGIKVPGGNK-VQKITIIPR-GNAGGYNLMMPEN--EKYNY-SKADLYATIASFMGG
FTSH_MYCMO       HAVVGTQLRKGVK-VQKITIIPR-GSAGGYNLMIPEE--EKYNS-SKSELIAMITSFMGG
FTSH_MYCA5       HAVVGIKIKGGNK-VQKITIIPR-GHAGGYNLMMPEE--EKYNR-SKAELIAIITSFMGG
FTSH_MYCCR       HAVVGIKLRSGVK-VQKITIVPR-GNTGGYNLMLPEH--EKYNS-TKSELLASIAAFMGG
FTSH_AYWBP       HAVIGIKIPFAQI-VQKITIIPR-GNAGGYNLMLPQE--ETFFS-SKKALLAQITSFLGG
FTSH2_PHYMT      HAVIGLKLPEADQ-IQKVTIIPR-GNAGGYNLTLPQE--ETFFS-SKKRLLAQITSFLGG
FTSH3_PHYMT      HAVIGIKLKHAQK-VQKITIIPR-GNAGGYNLMMPEK--ETFFS-SRKRMLAQIQSFLGG
FTSH1_PHYMT      HAVIGIKLKHAQK-VQKITIIPR-GNAGGYNLMMPEK--ETFFS-SRKRMLAQIQSFLGG
FTSH_ACHLI       HAVIGLKVNLAST-VQKVTIVPR-GRAGGYALYTPVE--EKFNY-AKSELLAMITSALGG
FTSH2_THEPX      HALIGKILN-VNT-IEKISIVPR-GEALGYVLNFPKE--DAFLL-TKTELKNKITMLLGG
FTSH_AQUAE       HALMGLVS-DDDDKVHKISIIPR-GMALGVTQQLPIE---DKHIYDKKDLYNKILVLLGG
FTSH_HYDS0       HALMGLMM-PDADPLHKVSIIPR-GMALGVTTQLPID---DKHIYDKADLLSRIHILMGG
FTSH_ECOLI       HAIIGRLV-PEHDPVHKVTIIPR-GRALGVTFFLPEG---DAISASRQKLESQISTLYGG
FTSH_SHIFL       HAIIGRLV-PEHDPVHKVTIIPR-GRALGVTFFLPEG---DAISASRQKLESQISTLYGG
FTSH_ECO57       HAIIGRLV-PEHDPVHKVTIIPR-GRALGVTFFLPEG---DAISASRQKLESQISTLYGG
FTSH_SALTI       HAIIGRLV-PEHDPVHKVTIIPR-GRALGVTFFLPEG---DAISASRQKLESQISTLYGG
FTSH_SALTY       HAIIGRLV-PEHDPVHKVTIIPR-GRALGVTFFLPEG---DAISASRQKLESQISTLYGG
FTSH_BUCAI       HVIIGRLV-PDHDPAHKVTIIPR-GRALGVTFFLPES---DTLSISRQKLESQISTLYGG
FTSH_BUCAP       HVIIGRLV-PDHDPAHKVTIIPR-GQALGITFFLPES---DILSISRQKLESQISTLYGG
FTSH_BUCBP       HVIVGRLV-PEHDPAHKVTIIPR-GRALGVTFFLPKD---DVLSINKNKLESQISTLYGG
FTSH_PHOPR       HAIIGRLV-PDHDPVYKVSIIPR-GRALGVTMYLPEK---DRISHSREFLESMLSSLYGG
FTSH_HAEIN       HAIVGYLV-PEHDPVHKVTIIPR-GRALGVTFFLPEG---DQISISQKQLESKLSTLYAG
FTSH_MAGMM       HAVVAMAL-DGADPVHKVTIIPR-GRALGLTMQLPLE---DRYTYSKVQLEQNIAILMGG
FTSH_CUPMC       HAVVAKLL-PKADPVHKVTIMPR-GWALGVTWQLPEH---DKYSKYKDNMLEEIAILFGG
FTSH_RICCN       HALVGLYC-PAASPIHKATIIPR-GNALGMVQRLPET---DEYSQNREQMESSIAVYMAG
FTSH_RICFE       HALVGLYC-PAASPLHKATIIPR-GNALGMVQRLPET---DEYSQNREQMESSIAVYMAG
FTSH_RICPR       HALVGLYC-PAASPIHKATIIPR-GNALGMVQRLPET---DEYSQNREQMESSIAVYMAG
FTSH_RICTY       HALVGLYC-PAASPIHKATIIPR-GNALGMVQRLPET---DEYSQNREQMESSIAVYMAG
FTSH_RICBR       HALVGLYC-LASDPIHKATIIPR-GRALGMVMRLPEN---DRFSMPRDKMEADIAVAMAG
FTSH_NEORI       HAVTSLKL-EASDPIHKATIIPR-GRALGLVMRLPEH---DRVSFTRAKMHADLIVAMGG
FTSH_BARBK       HAIVALNV-PVSDPVHKATIVPR-GRALGMVMQLPEG---DRYSMSYLWMVSRLAIMMGG
FTSH_CAUVN       HAIVALNV-PLADPVHKATIVPR-GRALGMVMQLPEG---DRYSMKYQQMTSRLAIMMGG
FTSH_ZYMMN       HALVSLHI-PGCDPLHKVTVIPR-GRALGVTWNLPER---DQLSINIKQMKARLALCFGG
FTSH_HALO1       HALVAKLVGAETDPVHKVSIIPR-GRALGVTQLLPTE---DRLGFTREFALNKIAILMGG
FTSH_MYXXD       HALLAKLL-PGCDPLHKVTIIPR-GQALGVTWSLPTE---DKVNGYKKQMLDQISMAMGG
FTSH4_SORC5      HALVAKLLEKFSDPVHKVTIIPR-GPALGLTQQLPKE---DRLSMSRDFAKARLSVLMGG
FTSH1_BDEBA      HTLVGKKL-VGLDPIHKVTIIPR-GMALGVTQTLPEK---ESVSLSKSKAENMIAFLFGG
FTSH_ACIC5       HAIVAAMR-KHADPLHKVTIIPR-GMALGVTMQLPEE---DKHTVTKDYLETQLAILMGG
FTSH_AKKM8       HAICLLKT-PHSEPLHRVTIVPR-GGALGMTMWLPSD---DKMHQLRSEMLDQLVVAMGG
FTSH2_METI4      HAVLNVLL-ENTDPIHKVTIIPR-GPALGVTMMLPAS---DKYNARKKEVLDDLCVAMGG
FTSH_LEPBJ       HAILGTLL-PYTEPVHKVTIIPR-GRALGLTQSLPKE---DKHILPKTYWLDQIIVAMGG
FTSH_BORBZ       HALLHYYL-EHADPLHKVTIIPR-GRALGVAFSLPRE---DRLSINKHQILDKIKICYGG
FTSH_PELPB       HVLVSIHT-KGSDPIHKVTIIPR-GRSLGLTAYLPLE---DRYTHNREYLLAMITYALGG
FTSH_UNCTG       HTLVAKFL-PSADPVHKVSIIPR-GPALGYTLQLPEE---DKYLTSKSELLDKLSILFGG
FTSH_SYNAS       HAILGLVA-HGADRVHRVTIVPR-GQALGVTYQRPDS---DRYNYTEAYLRAKIVGMLGG
FTSH_THET1       HALLGLLL-PEADPVHKVTIIPR-GQALGVTYQTPED---DRYNYTERYLRSRITAALGG
FTSH3_CONWI      HAIVGMLT-AGADPVRKVSIIPR-GQALGVTFSSPDA---DKYNYDERYLVGKIKVALGG
FTSH_MARHV       HAIMAYYM-PKADPLTKITIIPH-GMAMGVTEQTPKE---DKYNYTESYLEDRIKVMLGG
FTSH_NITOC       HALTAWLL-PEADPLHQVSIIPR-GMALGVTEQAPEE---ERHSLSRAYLLDRLGVMLGG
FTSH_HAHCH       HTLVAYYL-PNTDPLYKVSIVPH-GRSLGGTHQLPLQ---ERHTYPEEYLRDKLAVMLAG
FTSH4_SPHTD      HAVAAHFS-PGTDPLRKVSIVPR-GQSLGVTIQAPEE---DRFNYSRAYLLARLTVMMGG
FTSH2_THERP      HAVVAYFT-PGADPLRKISIVPR-GRALGVTVQAPEE---DRFNYTRNQLLGRLAVLLGG
FTSH_PELCD       HTLLARLS-PGADPIHKVSIIPR-GQALGVTQQLPVD---DRYHYSRSYLMTRIAVSLGG
FTSH_PELPD       HTLVARLL-PGTDPIHKVTIIPH-GMALGVTQQLPED---DRYHYPQSYLENRLVVAMGG
FTSH1_RHOBA      HTLTAWHL-EGSHIVHKVTIIPR-GRALGVTQYVPNE---DRLSMSKRELEHQLIVLLGG
FTSH2_SALRM      HAIVGAVL-PNADPVHKVTIVPR-GKAMGVTQQLPEK---DQYLYRHDYILDRLAVIMGG
FTSH_BACPE       HTVVGVKL-ENADMVHKVTIVPR-GMAGGYAVMLPKE---DRYFMTQPELLDKIIGLLGG
FTSH_BACSU       HTVIGLVL-DEADMVHKVTIVPR-GQAGGYAVMLPRE---DRYFQTKPELLDKIVGLLGG
FTSH_STAHJ       HTVIGMVL-DEAEVVHKVTIVPR-GQAGGYAMMLPKQ---DRFLMTEPELLDKICGLLGG
FTSH_STRPN       HTIVGLVL-SNARVVHKVTIVPR-GRAGGYMIALPKE---DQMLLSKEDMKEQLAGLMGG
FTSH_STRR6       HTIVGLVL-SNARVVHKVTIVPR-GRAGGYMIALPKE---DQMLLSKEDMKEQLAGLMGG
FTSH_LACPL       HTIVGLVL-NDARVVHKVTIVPR-GRAGGYAIMLPRE---DQMLMSKRDAKEQMAGLMGG
FTSH_LACPJ       HTIVGLVL-NDARVVHKVTIVPR-GRAGGYAIMLPRE---DQMLMSKRDAKEQMAGLMGG
FTSH_LEUMM       HALVGLVR-SEASVVRKVTIVPR-GRIGGYALMTPKN---DRYNLKYSEAKEQLAGLMGG
FTSH_OENOE       HAIVGLVL-NDAQVVRKVTIVPR-GRAGGYALMMPKD---ERYLMSEKDAKEELAGLMGG
FTSH_LACLA       HAIVGLVL-ENGSTVRKVTVVPR-GRIGGYMLALPDE---EIMQPTNFHLQDQLASLMGG
FTSH2_ALKMQ      HAVVAKLL-THTDPVHQVTIIPR-GRAGGFTMTLPTE---DKYYVTKTEMQEHIVHLLGG
FTSH1_THEPX      HAVVAKLL-PNTPPVHEVTIIPR-GRAGGYTMLLPEE---DKYYMSKSEMMDEIVHLLGG
FTSH_CALBD       HAIVRTMI-PDSEPVHEVSIIPR-GYAGGYTMYLPKE---DKFYASKSDMMREIVTLLGG
FTSH_RUMCH       HAIAIKLV-SSSQKVDRVSIIPA-GMAGGYTASRPQE---DKSYHTRSQLIEEIIIALGG
FTSH_CLONN       HAIVMKFS-PHSDPVHEISIIPR-GMAGGYTMHLPER---DTSYMSKSKLKDEMVGLLGG
FTSH_VEIPT       HAIVAHLL-PHADPVHKVTIIPR-GAAGGYTMMLPTE---EQNYKTKSQLLADIRVALGG
FTSH_HALOH       HALVGDLL-EHADRTHKISIVPR-GRAGGMRWALPKE---DKNFMSKQELLDQITVLLGG
FTSH_NATTJ       HAIVGYLL-PHTDPVHKVSIIPR-GAAGGFTLMLPEE---DRQFMTKTELLERVSTLLGG
FTSH3_SYMTH      HAVVGHML-PHMDPLHKITIIPR-GRAMGYTLFLPVE---DRYNISKSEILDRMTMALGG
FTSH_MYCTU       HTLAAWAM-PDIEPIYKVTILAR-GRTGGHAVAVPEE---DKGLRTRSEMIAQLVFAMGG
FTSH_MYCTA       HTLAAWAM-PDIEPIYKVTILAR-GRTGGHAVAVPEE---DKGLRTRSEMIAQLVFAMGG
FTSH_MYCBO       HTLAAWAM-PDIEPIYKVTILAR-GRTGGHAVAVPEE---DKGLRTRSEMIAQLVFAMGG
FTSH_MYCLE       HTLAAWAM-PDIEPIYKVTILAR-GRTGGHAVAVPEE---DKGLRTRSEMIAQLVFAMGG
FTSH_RHOE4       HTLAAWAM-PDIEPVYKVTILAR-GRTGGHAMTVPED---DKGLMTRSEMIARLVMAMGG
FTSH_CORGL       HTLSAWAL-EDIERVYKVTILAR-GRTGGHAMTAQED---DKGMYNRNELFARLVFAMGG
FTSH_ROTMD       HALVAAAL-RNSAPVTKITILPR-GRALGYTMVMPQD---DKYSTTRHELLDQMAYAMGG
FTSH_TROWT       HALTAAAM-RYSDPVTKVTILPR-SRALGYTMVMPVQ---DRYSVTRNELLDKLAYAMGG
FTSH_BRAFD       HALVAAAM-NNSAPVTKVTILPR-GRAGGYTMVVPTQ---DRNYQSRNELLDRLAYAMGG
FTSH_CUTAS       HALVAAAM-PGTDPVQKITILPR-GRALGYTMVMPDS---DKYSQTRSELLDSMAYMMGG
FTSH1_CONWI      HALVGHFL-EHADPVHKISVIGR-GQALGYTISMPQE---DKFLTTRAALGDTMAMTLGG
FTSH_RUBXD       HAIVGALL-PEADPVHKVTIIPR-GQALGVTMSLPEE---DRFMMSRAQLMAQLSYMLGG
FTSH_SLAHD       HALVGHML-ENADPVHKITIVPR-GMALGYTMSIPDE---DKFLVSRSAMLDELAVFMGG
FTSH_PORPU       HAIIGSLL-EHHDPVQKVTLIPR-GQARGLTWFTPSD---DQSLISRSQILARIVGALGG
FTSH_PYRYE       HAIIGSLL-EHHDPVQKVTLIPR-GQARGLTWFTPSD---DQSLISRSQILARIVGALGG
FTSH_GUITH       HAIIGTLL-KHHDPVQKVTLVPR-GQAKGLTWFTPSE---DQSLISRSQILARIMGALGG
FTSH2_SYNY3      HAIVGTLL-KDHDPVQKVTLIPR-GQAQGLTWFTPNE---EQGLTTKAQLMARIAGAMGG
FTSH_NOSS1       HGLVGTLL-KDHDPVQKVTLIPR-GQAQGLTWFTPNE---EQGLISRSQLKARITSTLAG
FTSH1_SYNY3      HALIGTLC-PGHDPVEKVTLIPR-GQAQGLTWFTPDE---DQSLMTRNQMIARIAGLLGG
FTSH_TRIEI       HALLMTLL-KNSDLLNKVTIIPRSGGVGGFAQPIMDEGMIDSGMYTRGWLIDRITISLGG
FTSH_CYACA       HAVAATFL-PHHDPVQKVTLIPR-RQAKGLTWFLPND---DQFLVSKSQILSKIIAALAG
FTSH_CYAM1       HALTATLL-PNHPPVQKVTLIPR-RQAKGLTWFMQDN---ERDLLSKSQLMSMIMVALGG
FTSH_TRICV       HAITGSVL-KSHDEVEKITLTPR-GGAKGLTWFTPEE---DQSLLSRSALLARIITTLGG
FTSH_VAULI       HAVIGTLL-KYHDEVQKVTLIPR-GQARGLTWFIPND---EQALISRGQLVARIIGTLGG
FTSH_HETA2       HAMVGTLL-RNHDNVQNVTLVPR-GQARGLTWFMPNE---DPSLVTRGQIVARIVGALGG
FTSH_ECTSI       HALTGTLL-KNHDDVQKVTLIPR-GRAQGLTWFTP-D---EQPLMTRGQLSSRLIGTLGG
FTSH3_SYNY3      HALVGALM-PDYDPVQKISIIPR-GRAGGLTWFTPSEDRMESGLYSRSYLQNQMAVALGG
FTSH_SYNJB       HALVGSLL-PNYDPIQKVTIIPR-GQAGGLTWFMPSDD--DMGLTTRAHLKNMMTVALGG
FTSH1_SPHTD      HALVARML-PHADPVHKVSIVAR-GMMGGYTRVLPEED---RFFWTKKQFEDQLAVFMGG
FTSH1_THERP      HALVARML-PHADPVHKVSIVAR-GMMGGYTRVLPEED---RFFWTKKQFEAQLAVFMAG
FTSH_CHLAD       HAIVGAAL-PKADKVQKVTIIPR-GQAGGYTLFLPDEDS--LNLRTVSQFKARLAVSLGG
FTSH_PSELT       HAIVSSLL-PNADPVHRISIIPRGYRALGYTLQLPAE---DRYLVTKQELLDQITGLLGG
FTSH_THEMA       HAVVSTVV-PNGEPVHRISIIPRGYKALGYTLHLPEE---DKYLVSRNELLDKLTALLGG
FTSH_KOSOT       HAIVGLAL-PNAYPVHKVTVIPRGSASLGFTESLPSE---DRYLVSRSEMLDNLAQILGG
FTSH2_PETMO      HAVLGYLL-PYADPVHKITIVPRGQAALGYTMQLPSE---DRFLITEPEIKDKIVGMLGG
FTSH3_PETMO      HAILGTIL-PNADPVHKVTIIPRGYAALGYTLQLPSE---DRYLMNKSEILDDIAVMLAG
FTSH1_PETMO      HAVLAYLL-PNTDPVYKITIIPRGAGSLGSTLQIPEK---DKYLIKKSEILDRIVVALGG
FTSH_HELPY       HAVISEMT-KGSARVNKVSIIPRGMAALGYTLNTPE---ENKYLMQKHELIAEIDVLLGG
FTSH_HELPJ       HAVISEMT-KGSTRVNKVSIIPRGMAALGYTLNTPE---ENKYLMQKHELIAEIDVLLGG
FTSH_HELFC       HAVISEMT-KGSARVNKVSIIPRGMAALGYTLNTPE---ENKYLMQKHELIAEIDVLLGG
FTSH_SULNB       HALMSELS-EGATRVTKVSIIPRGLGALGYTLHLPED--EERFLKQKHELMAEVDVLLGG
FTSH_ATOPD       HAIVGAIQ-KNDAPVTKITIVPRTSGALGFTMQVED---DERYLMSKSQAMDEIAVLCGG
FTSH_CLOP1       HALVAALL-NNTDPVHKITIVPRTMGALGYTMQLPE---EEKYLVSKEEMIDQISVMLGG
FTSH_TREPA       HALAGTFT-KGADKVHKITIIPRGTSALGYTFHIPE---DDRHIVTEQQLLAEVDVLLSG
FTSH_PARD8       HATLSWLL-EHANPLVKVTIVPRG-KALGAAWYLP----EERQITTREQLQDEMCATLGG
FTSH_SULMD       HAIISWII-EYAHSVFQITITPRG-QSLGAAWYIP----EERQITTEDQMKDEICTLLGG
FTSH_RHOM4       HAIVGWFL-RYTDPVVKVSIVPRGLAALGYAQYLP----EERYLYTKEALLDRMTMAIGG
FTSH1_SALRM      HAIVGWFL-EHTDPVVKVSVVPRGLSALGHAQHLP----KERDLYSREALMDRMTMALGG
FTSH_PELLD       HAIVSWMM-PENDPVQKISIVPRGMSALGYTMNIPL---EDRYLMTKRELFARICGLLGG
FTSH4_SYNY3      HALVGAVM-PGGGQVAKISIVPRGMAALGYTLQMPT---EDRFLLNESELRDQIATLLGG
FTSH_ACAM1       HAIVGSLM-PGAGTVEKISVIPRGIGALGYTLQLPE---EDRFLITASELRGRIATLLGG
FTSH_ANAD2       HALVSWML-PFADRVSKVSIIPRGLGALGYTLQLPL---EDRYLLTRSELRDRMAGLMGG
FTSH2_SORC5      HALTASLL-PTQDPVRKVSIVPRGPGALGYTIQQPR---EDRYLWSRQEILDRLVVLLGG
FTSH_PARP8       HALVAMTL-PGVDMVQKISIIPHGIAALGYTIQRPT---EERFLMDRAELMNRMAVLLGG
FTSH_PSEP1       HALAASSL-PAMDPVHKVSIIPRAAGSLGYTLQRPT---DDRYLISTQMLRDRLVVLMAG
FTSH2_BDEBA      HAIMACLF-PGVDKVQKISIIPRGLGALGYTMQRPT---EDRYLMTRPELLDKICVLLGG
FTSH_METPP       HALTALAL-PSTDRVQKVSIVPHGIGALGYTLQRPS---EDRHLQRRTELIDRLTVLLGG
FTSH_RALPJ       HAIVAEHR-PLADRVSKVSIIPRGVAALGYTQQTPT---EDRYLLKRSELLDRLDVLLGG
FTSH_SYNFM       HALVAMLL-PNVDPVNKVSIIPRGIAALGYTQQLPT---EDRYLMTRNELLDRLQVLLGG
FTSH_BURP1       HALIAQTR-AHSDPVKKVSIIPRGIAALGYTQQVPT---EDRYVLRKSELLDRLDVLLGG
FTSH_PIRSD       HALVAYSL-PNTDPVHKVSIIPRGLAALGYTMQRPE---GDRFLMTQSELESRIQVLLAG
FTSH2_RHOBA      HALVAAAL-PNTDPVHKVSIIPRGLAALGYMMQRPE---SERFLMTKSELESQMKVMLAG
FTSH_METCA       HALVAEIV-PTGQPVHKVSIIPRGAAALGFTLQLPV---EEKFLSTEQELKDQIAILLGG
FTSH1_METI4      HALVAFYS-EHAEPVRKISIVPRGKSALGYTLQLPT---AQKYLLSKSELLDRICVAMGG
FTSH_ACIFD       HAVLAYVL-DYSDPVHKVTILPTGMAL-GVTQQLPER---DRHLYPREYIEDTLVVRMGG
FTSH_ACIC1       HAVVAACS-ENADPVERVTILPAGRAL-GVTFQLPLA---ERHLYSESYLRDSLAVRLGG
FTSH1_SORC5      HALVALAL-PAADPVERVSIVARTIGALGVTIQVPRD---ERQLVTEQEIESRVTVMLGG
FTSH1_SYMTH      HALAGLAL-RGSDRLVRVTILPHGRGLGHTLFRDQDE---ERYLHTRRDAFDRLTELLAG
FTSH_OPITP       HALMQVLSGEDVVRVQKVTIIPRGRSL-GSTHFTPER---DLFNYSQPQLIAKLRCLMAG
FTSH3_SORC5      HVAVGLLA-PSCDPVHKVSILPRGRAL-GVTQALPEK---DRLMYRKEYLEDQICMLMGG
FTSH2_SYMTH      HALVATLT-PGADPVQKVTIIPRGRAG-GFTLTTPEE---DQMLYTRSELEARLKMLLGG
FTSH2_SPHTD      HAVVAHLL-PHADPVRKVSIVSRGRAG-GYTMIVPDE---DRGLWTRAQLSDRLAALLGG
FTSH3_SPHTD      HALVAHQL-ASADAPRRVTILGRGQMG-GATVLAPDE---DRRLWTRGQFLDRLAVLLGG
FTSH2_CONWI      HAVVTEAM-GTGATARKVSIVARGRSLGTAAHMLTDR---DQTIMEEPDLVMQLIAMLAG
FTSH_THET8       HALAAHFL-EHADGVHKVTIVPRGRALGFMMPRRE-----DMLHWSRKRLLDQIAVALAG
FTSH_LEPBD       HAIMTELT-PGADPVHKVTIIPR-GDAGGFMMPLPEE----KLVTTSRQMLAEIKVLFGG
FTSH_STRM9       HALAATLI-PGANKVHKVTIIPR-GDAGGYMMPLPEE----TLGKTRKQILAEINVLFAG
FTSH1_ALKMQ      HAVATKLL-CPQNKVTKVTIIPSTKGAGGFSMNIPPD----QMYHTKNSMVNSIKVALSG
FTSH_LACP7       HALATKLL-QPEQYISKVTIIPSVKGAGGFNLSIPKD----SLYQSKRQILCSIQILLAG
                 *               . ::                                 :    .*

FTSH_MYCGE       RAAEEEIYGNLEITTGASSDFYKATNIARAMVTQLGMS-KLGQVQYVPSQGT----LPSN
FTSH_MYCPN       RAAEEEIYGPLEITTGASSDFYKATNIARAMVTQLGMS-KLGQVQYVPSQGT----VPPG
FTSH_MYCGH       RASEELFFGKDAISTGASNDFYKATNIAKTMVTQLGMS-DLGITQFLPSEGG----INPN
FTSH_MYCPE       RASEEINFGKEFISTGAANDLYKATNIVRAMVTQFGMSPNVGLAQYYPSEGT----VNPY
FTSH_UREP2       RAAEELIYGPNEITTGAANDFYKITNIVRAMVASFGMT-DVGLTQYIATEGV----DNPY
FTSH_MESFL       RAAEEIMFGKENVTTGAHDDLDKATNIARRMVVQFGMS-SLGMTKFLTMAEE----SYGK
FTSH_MYCPU       RAAEMIIYGKENISTGASDDISRATKIARKMVTEWGMS-ALGPIKYEEDTENPFLGRDYS
FTSH_MYCS5       RAAEEIIYGDNKISTGAADDIKKATSIARRMVTQFGMS-DLGPIEYQSDEGSPFLGKALA
FTSH_MYCMO       RAAEQIIYGEKEVSTGARDDIKKATSIARKMVTEWGMS-DLGPIMYEEDTSNPFLGRDYT
FTSH_MYCA5       RVAEAIIYGKDNVSTGASDDIAKATRIARKMVTEWGLS-ELGPIKYEEDTDNPFLGRDYM
FTSH_MYCCR       RAAEEIIYGKNEISTGAANDIEKATKIARRMVTEFGMS-NLGPIQYEQDNSSPFLGRDYF
FTSH_AYWBP       RVAEELMF--DDVSNGAYNDFKHATQIAKLMVTKYGMS-DLGPVQYSGNT----------
FTSH2_PHYMT      RAAEEVVF--QDVSNGAYSDFKYATEIAKKMVTQYGMS-DLGPIQYMENN----------
FTSH3_PHYMT      RVAEELVF--DDISSGAFDDFRQATKIARLMVTKYGMS-DLGVSQDSE------------
FTSH1_PHYMT      RVAEELVF--DDISSGAFDDFRQATKIARLMVTKYGMS-DLGVSQDSE------------
FTSH_ACHLI       RVAEEIMF--DDVTTGAYDDFKRATKLARSMVTEYGMS-DLGPIQYESDSGNVFLGRDYL
FTSH2_THEPX      RASEEIIF--NEISTGAENDLKEATKIAYQMVCNYGMS-ELGNRVFDL------------
FTSH_AQUAE       RAAEEVFFGKDGITTGAENDLQRATDLAYRMVSMWGMSDKVGPIAIRRVANPFLGGMTTA
FTSH_HYDS0       RCAEEVFYGKDGITTGAENDLQRATDLAYRIVATWGMSENVGPISVRRNINPFLGG-STV
FTSH_ECOLI       RLAEEIIYGPEHVSTGASNDIKVATNLARNMVTQWGFSEKLGPLLYAEE-EGEVFLGRSV
FTSH_SHIFL       RLAEEIIYGPEHVSTGASNDIKVATNLARNMVTQWGFSEKLGPLLYAEE-EGEVFLGRSV
FTSH_ECO57       RLAEEIIYGPEHVSTGASNDIKVATNLARNMVTQWGFSEKLGPLLYAEE-EGEVFLGRSV
FTSH_SALTI       RLAEEIIYGVEHVSTGASNDIKVATNLARNMVTQWGFSEKLGPLLYAEE-EGEVFLGRSV
FTSH_SALTY       RLAEEIIYGVEHVSTGASNDIKVATNLARNMVTQWGFSEKLGPLLYAEE-EGEVFLGRSV
FTSH_BUCAI       RLAEEIIYGAKNVSTGAYNDIKIATSLAKNMVTQWGFSEKLGPLLYAEE-EGEIFLGRSV
FTSH_BUCAP       RLAEEIIYGSQNVSTGAFNDIKVATNLARNMVTQWGFSDKLGPLLYAEE-EGEVFLGRSV
FTSH_BUCBP       RLAEEIIYGVNNVSTGAHNDIKVATNLARNMVTQWGFSKKLGPLLYSEE-EGEIFLGRTV
FTSH_PHOPR       RLAEELIYGVDKVSTGASNDIERATDIARKMVTQWGFSEKMGPVLYADD-EGEVFLGRSV
FTSH_HAEIN       RLAEDLIYGEENISTGASNDIKVATNIARNMVTQWGFSEKLGPILYTED-EGEVFLGRSM
FTSH_MAGMM       RLAEELVL--NQLTTGAGNDIQRATDLARKMICSYGMSDTLGPLTYGEN-EQEIFLGREI
FTSH_CUPMC       RAAEEVFL--NAMSTGASNDFERATKIARDMVTRFGMSDSLGAMVYVDT-EQDGMFGK--
FTSH_RICCN       RVAEEIIFGRNKVTSGASSDIKGATNIARAMVTKAGLSDLIGPIFHGSS-GDDMYG---R
FTSH_RICFE       RVAEEIIFGRNKVTSGASSDIKGATNIARAMVTKAGLSDLIGPIFHGSS-SDDMYG---R
FTSH_RICPR       RVAEEIIFGRNKVTSGASSDIKGATNIARAMVTKAGLSDLIGPIFHGSN-SDDMYG---R
FTSH_RICTY       RVAEEIIFGKNKVTSGAASDIKGATNIARAMVTKAGLSDLIGPIFHGSS-SDDMYG---R
FTSH_RICBR       RVAEEIIFGKEKVTSGASSDIKMATRMAKAMVTDWGLSDKVGPVYHGSA-SEDMYTN--R
FTSH_NEORI       RAAEQVIFGDDKTTSGAASDIKQATHLARSMVTKWGMSEKVGPLLYGEQ-ND--------
FTSH_BARBK       RVAEELKFGKENITSGAASDIEQATKLARAMITRWGFSDMLGHVAYGDN-QDEIFLGHSV
FTSH_CAUVN       RVAEEIIFGKENITSGASSDIKAATDLARNMVTRWGYSDILGTVAYGDN-QDEVFLGHSV
FTSH_ZYMMN       RIAEQLVYGEDSLNTGASNDIQQATDMARAMVTEYGMSPKLGWLRYREN-QDEVFLGHSV
FTSH_HALO1       RLAEELVL--KQKTTGAGDDIDKATDLARRMVTEWGMSDVIGPLNFASGGKQEVFLGRDL
FTSH_MYXXD       RIAEELMF--NEMSSGAANDIERATETARAMVCRWGMSEKMGPLAFGKS-DGEVFLGRDF
FTSH4_SORC5      RVAEEIVF--GQFTTGAGNDIKQASNLARRMVTEFGMSDVIGPISYGAD-EESVFLGRDF
FTSH1_BDEBA      RAAEELIF--KDITTGAGNDIERATEIARRMVCEWGMS-KLGPLAYETR-DNPVFMGMGY
FTSH_ACIC5       RIAEEIFL--HQMTTGAGNDIERATEMARKMVCEYGMS-RLGPLTYGKK-EEQIFLGREI
FTSH_AKKM8       RCAEQIVF--GDVTSGATGDIKSATNLARRMVCEFGMSEKLGLIEYGEH-QGEVYIARDL
FTSH2_METI4      RVAEEVFL--GDISSGASGDIRQATWYARKMVCEWGMSEKLGMVHYADD-SSMVFLGREL
FTSH_LEPBJ       FIAEEFKF--GVTSTGSSNDIQQASNIARKMVCEWGMSEKLGTVNYSGD-QTNVFIGRDM
FTSH_BORBZ       YASEQINL--GVTTAGVQNDLMQATSLAKKMVTEWGMGEEVGPIFLVDD-EAPIFLPKEF
FTSH_PELPB       RVAEELVF--QECSTGAANDIEKATDIARRMVRQWGMSESLGPINYGDS-HKEVFLGKDY
FTSH_UNCTG       RVAEELVF--SEITTGAQNDISKATGIAMRMVTEFGMSDKIGPMALQRP-NEEVFLGRDI
FTSH_SYNAS       RAAEEIVY--GTRTTGAESDIEQATGLAHRMVTRWGMSERLGLIQLAPR-ENPYLGGPAG
FTSH_THET1       RAAEELVF--GTVTTGAENDLKQVTEIARQMVTRWGMSKEVGLVYLSPD-GQEDFLGPNP
FTSH3_CONWI      RVAEEIVF--GDLTTGAESDIQQLTGIARQMVGRWGMSRAIGPIAVLPS-EGNGPLLPGV
FTSH_MARHV       RSAEKIIY--GEVSTGAQNDLKEATKLLRRMVGQWGMSEKIGPLGLGIG-EEHVFLGREM
FTSH_NITOC       RISEKITF--GDVTSGAESDLKQATQLARRMVCQWGMSDKIGAAAFSRS-EEHVFLGREL
FTSH_HAHCH       RIAERELL--GSVSTGADDDIHQATGLARAMVSRWGMSKEVGPVDLRDS-EEHPFLGREM
FTSH4_SPHTD      RAAEKLVF--NEMTTGAQNDLKEATLLARRMVGLWGMSDEVGPVYLGMG-EQHVFLGREI
FTSH2_THERP      RAAEQLVF--HEVTTGAQNDLKEATQLARRMVGLWGMSEELGPIYLGLG-EQHVFLGREI
FTSH_PELCD       RAAEKAIF--EEYSTGAQNDLKQATDLAEKMVCQWGMSERVGPMSINRG-EEHPFLGRKL
FTSH_PELPD       RVAERLAF--GEVSSGAQGDLKQVTSLAEKMVCQWGMSEKVGGMTFSRG-EEHPFLGMKL
FTSH1_RHOBA      RAAEKIIY--TETCVGAENDLERATSIARRMVTHWGMSPKIGPVSYKTS-DEDPFLGREI
FTSH2_SALRM      RAAEELIF--DTATSGAENDLKQVRKMARKMVLDWGMGDQFKHISLGED-QGNVFLGDEI
FTSH_BACPE       RVAEEVTFG--EVSTGAHNDFQRATGIARKMVTEYGMSEKLGPMQFISGSGGQVFLGRDI
FTSH_BACSU       RVAEEIIFG--EVSTGAHNDFQRATNIARRMVTEFGMSEKLGPLQFGQSQGGQVFLGRDF
FTSH_STAHJ       RVSEDINFH--EVSTGASNDFERATQIARSMVTEYGMSKKLGPLQFSSSGGGQVFLGKDM
FTSH_STRPN       RVAEEIIFN--VQTTGASNDFEQATQMARAMVTEYGMSEKLGPVQYE--GNHAMLGAQSP
FTSH_STRR6       RVAEEIIFN--VQTTGASNDFEQATQMARAMVTEYGMSEKLGPVQYE--GNHAMLGAQSP
FTSH_LACPL       RAAEEIIFG--AQSSGASNDFEQATQIARAMVTQYGMSEKLGPVELE--NANQQAAYQQG
FTSH_LACPJ       RAAEEIIFG--AQSSGASNDFEQATQIARAMVTQYGMSEKLGPVELE--NANQQAAYQQG
FTSH_LEUMM       RASEIFMFN--EASSGASNDFQQATGLARQMVTAFGMSDKLGMVQLE--GNASVGYADQA
FTSH_OENOE       RAAEILINH--VASSGASNDFQQATQIAREMVTQYGMSDKLGMVQLE--GSSNVFVGDPN
FTSH_LACLA       RLGEEIVFG--VATPGASNDIEKATHIARSMVTEYGMSKKLGMVSYE--GDHQVFIGRDY
FTSH2_ALKMQ      RVAEKLVLH--DISTGASNDLQRVSSIARAMVTQYGMSDKLGSMTFGDGDS-EVFLGRDF
FTSH1_THEPX      RVAESLVLN--DISTGAQNDIERATNIARKMVTEYGMSERLGPMTFGTKSE-EVFLGRDL
FTSH_CALBD       RVAEKLVLE--DVSTGAASDIKRATKIARDMVTKYGMSDKLGPMTFGTEQE-EVFLGRDL
FTSH_RUMCH       RAAEEITMD--EVSTGASSDLKKVNQIARNMVTKYGMSEKLGNMIFGNDND-EVFIGRDL
FTSH_CLONN       RVAEQIIIG--DISTGASNDIQRVSNIARKMVMEYGMSEKLGTITFGSDHD-EVFIGREI
FTSH_VEIPT       RIAEALILD--EISTGASGDLQSVTNTARAMVTRWGMSDELGPIVFGEQQE-QIFLGKNL
FTSH_HALOH       RASESIFLE--DISTGAQNDLERATKLARAMVTEYGMSEKLGPLTLGHKHDEQIFLGRDI
FTSH_NATTJ       RVAEELKLK--EISTGAQNDLERATTIVRQMIMEYGMSENLGPITLGQKQG-QVFLGRDI
FTSH3_SYMTH      RAAEEITFG--EITSGAQDDIERTTQWARRMVTEWGMSEKLGPLTYGMKQD-EVFLARDM
FTSH_MYCTU       RAAEELVFR--EPTTGAVSDIEQATKIARSMVTEFGMSSKLGAVKYGSEHG-DPFLGRTM
FTSH_MYCTA       RAAEELVFR--EPTTGAVSDIEQATKIARSMVTEFGMSSKLGAVKYGSEHG-DPFLGRTM
FTSH_MYCBO       RAAEELVFR--EPTTGAVSDIEQATKIARSMVTEFGMSSKLGAVKYGSEHG-DPFLGRTM
FTSH_MYCLE       RAAEELVFR--EPTTGAVSDIEKATKIARSMVTEFGMSSKLGAVRYGSEHG-DPFLGRTM
FTSH_RHOE4       RAAEELVFH--EPTTGASSDIDMATKIARAMVTEYGMSAKLGAVRYGQEGG-DPFLGRSM
FTSH_CORGL       RSAEELVFG--EPTTGASADIEMATKIARSMVTEYGMSPAVGMVKYGQEQG-DPFSGRGG
FTSH_ROTMD       RAAEEIVFH--DPSTGASNDIQKATDTARKMVTDYGMSAVIGSVKLGGEDT-EPFLGGGG
FTSH_TROWT       RAAEELVFH--DPTTGASNDIEKATSIARKMVTEFGLSKDLGAVKFGNAHN-ETLMGVGQ
FTSH_BRAFD       YAVEESIFH--DVTTGPSSDLQNATKIARTMVMQLGMSGTVGQVALSGEQD-EVFVGMQQ
FTSH_CUTAS       RAAEELIFH--DPSTGASNDIEKATKVARALVTQYGLSARVGTVQLGSGDT-EPFLGMTA
FTSH1_CONWI      RAAEEIIFG--EITTGASNDLEKVTGTAKQMVMRFGMSEKLGPRVFGHDQS-QPFLGREF
FTSH_RUBXD       RAAERVVFE--EITTGASNDIERATKVARQMVTRYGMSEKLGLIALGQHDG-QVFMGRDL
FTSH_SLAHD       RVAEEIFCG--DITTGASNDLERATKTARKMVVSYGMSEALGQQTFGQPNH-EVFLGRDY
FTSH_PORPU       RAAEEIIFGDAEVTTGASNDLQQVTSMARQMVTRFGMSK-IGPLSLESQGS-DPFLGRGM
FTSH_PYRYE       RAAEEIIFGDAEVTTGASNDLQQVTSMARQMVTRFGMSK-IGPLSLESQGG-DPFLGRGM
FTSH_GUITH       RAAEEVVFGLPEVTTGAGNDLQQVTSMARQMVTRFGMSN-IGPLSLESQNS-DPFLGRTM
FTSH2_SYNY3      RAAEEEVFGDDEVTTGAGGDLQQVTEMARQMVTRFGMSN-LGPISLESSGG-EVFLGGGL
FTSH_NOSS1       RAAEEIVFGKPEVTTGAGDDLQKVTSMARQMVTKFGMSE-LGPLSLENQSG-EVFLGRDW
FTSH1_SYNY3      RVAEEVIFGDDEVTTGAGNDIEKITYLARQMVTKLGMSS-LGLVALEEEGD-RNFSGGDW
FTSH_TRIEI       RAAEEEIFGLAEVTVGAANDIRSVASLAREMVTRYGMSD-LGPLALENPNG-EVFLGRGW
FTSH_CYACA       RAMEEIVFGLPEVTIGAANDIKQVTFMARQMVTKFGMSK-VGPICLENSSS-EVFIGRDL
FTSH_CYAM1       RAAEEAVFGNAEVTTGASNDLQQVTNLARQMVTRFGMSS-LGPLCLETGNE-EIFLGRDM
FTSH_TRICV       RAAEQVIFGEPEVTTGASSDLQQVTNLARQMVTRFGMSN-IGPLALEDESTGQVFLGGNM
FTSH_VAULI       RAAEEVVFGSSEITTGASNDLQQITNLTRQMVTRLGMST-VGPISL-DANVEQVFIGRGI
FTSH_HETA2       RAAEQSVFGSTEITTGASGDLAQVTDLAKQMILRFGMSG-IGPVSLSKPGGSFLFVGRGV
FTSH_ECTSI       RAAEKVIFGKMEITSGASNDFFKVNSLARQMVTRFGMSS-LTPMAM-ELPKPTIFFGRSV
FTSH3_SYNY3      RIAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQGG-GVFLGRDI
FTSH_SYNJB       RVAEEVVYGESEITTGAASDLQQVARIARNMVTRFGMSDRLGNVALGRQYA-NIFLGREI
FTSH1_SPHTD      HVAEELVF--QEISTGAANDIERATNLARRMVTEYGMSKTLGPLAFGRKEE-LVFLGREI
FTSH1_THERP      LVAEELVF--QEVSTGAANDIERATTLARRMVTEFGMSERLGPLAFGRKEE-LVFLGREI
FTSH_CHLAD       RVAEEIVFGNEEVTTGASGDLVQVTRIARAMVTRYGMSQRLGPIVFGEKEE-LIFLGREI
FTSH_PSELT       RAAEELIFQ--EVTTGAASDIERATELARRMVCQFGMSDKLGPLSWGKTEQ-EIFLGKEL
FTSH_THEMA       RAAEEVVFG--DVTSGAANDIERATEIARNMVCQLGMSEELGPLAWGKEEQ-EVFLGKEI
FTSH_KOSOT       RAAEEIVFG--EITTGAANDLERATQMARTMVCQLGMSDRLGPIAWGKEEG-EVFLGREL
FTSH2_PETMO      RAAEEIVFN--EITTGAGNDLKRATELVREMVAQLGMSEKIGPIAWGEEEG-EIFLGREI
FTSH3_PETMO      RAAEEIIFD--EITSGAENDLKRATEMARRMVESFGMSEKIGPVAWASESE-ETFLAREL
FTSH1_PETMO      RASEKLVFN--FATTGAKDDLRKATDYAKSMIYRLGMSKRMGPVYWEGEEE-EIFLGSEL
FTSH_HELPY       RAAEDVFLE--EISTGASNDLERATDIIKGMVSYYGMSSVSGLMVLEKQRNAFLGGGYGS
FTSH_HELPJ       RAAEEVFLE--EISTGASNDLERATDIIKGMVSYYGMSSVSGLMVLEKQRNAFLGGGYGS
FTSH_HELFC       RAAEDVFLQ--EISTGASNDLERATDIIKGMVSYYGMSDVSGLMVLEKQRNSFLGGGFGS
FTSH_SULNB       RAAEDVFIG--EISTGAGNDLDRATAILKDMVSVYGMTDVAGLMVLSRSQNSFLGAGAVS
FTSH_ATOPD       RAAEELIFG--EMTNGASNDIERATAIARAMVTQYGMSDKLGMVTLSQQQSRYLG-GGS-
FTSH_CLOP1       RAAEEVVFN--SITTGASNDIERATQSARNMITIYGMSERFDMMALEAMSNRYLD-GRP-
FTSH_TREPA       RAAEFVAFG--EVSTGAGNDISRATDIVRKMITDYGMSEKFQNVALTRRGTGYLA-EPQL
FTSH_PARD8       RAAEELVLG--KISTGASNDLERVTKQAYAMVVYFGMSDKLPNLNYYD-STG--Q-DWGF
FTSH_SULMD       RAAEYLIFN--NKSTGALNDLERITKQAQSMVKFFGLSS-LGNISYFD-STG--RNDFSL
FTSH_RHOM4       RVAEELVFG--RISTGAQNDLERITRMAYAMVVDYGMSERVGYVSFNL-SGQ-YGEQAFF
FTSH1_SALRM      RGAEEIVFG--RATTGAKDDLERVTETAYAMVVDYGMSDRIGPLSYNR-AER-RADGPLF
FTSH_PELLD       RIAEESVFG--EISTGAQNDLEKITGIAYNMVMVYGMSDKIGNLSYYE-SNNPYYGAPGV
FTSH4_SYNY3      RAAEEIVFD--SITTGAANDLQRATDLAEQMVTTYGMSKVLGPLAYDKGQQNNFLGQGM-
FTSH_ACAM1       RSAEELIFG--VVSTGASDDIQKATDLAERYVTLYGMSDELGPIAYEKAQQQ--FLEGV-
FTSH_ANAD2       RVAEEEVFG--EPSTGASNDLQHATAVARMMVRDYGMSPALGPVSLGDQNGPSFLGV---
FTSH2_SORC5      RVAEEEAVG--DLSTGAQDDLLNATELARRMVRELGMGQGLGLSALEPRRPLSFLGEAQG
FTSH_PARP8       RAAERLIFA--DVSTGAADDLAKASAIARSMVVRFGMDPTLGQVAYEPET-TSALGLPN-
FTSH_PSEP1       RAAEHLVFG--QVSTGAADDLGRATDIARQLVTRFGMSPVLGQAVLERQQ-AGYLGDSL-
FTSH2_BDEBA      RVAEELIFG--EVSTGASDDLVRVTNIAEALVTRYGMSEVLGNIVFEQPT-GNFLEVP--
FTSH_METPP       RAAEELVFG--EPSTGAADDLARATGMARDMVLRFGMDEGLGPVAYADAP-ASPLVGLP-
FTSH_RALPJ       RIAEQLIFG--DVSTGAQNDLQRATDMARQMITQFGMSDQLGLATYENMPNPLFAGTG--
FTSH_SYNFM       RVSEEIIFG--DVSTGAQNDLQRATDIARSMVMEYGMSERLGPLTYTRDPRSAHLDLG--
FTSH_BURP1       RVAEEIVFG--DVSTGAENDLERATEMARHMVARYGMSERIGLATFG-DADTQGLSPL--
FTSH_PIRSD       TIAEEIIFT--DISTGAQNDLERATDIARRMCMEFGMSRLGRVNYRESNRSAFLASGG--
FTSH2_RHOBA      TLAEEMIFQ--DISTGAQNDLERCTETARSMVMDYGMSRLGRINLRRNTRSPFLAGSG--
FTSH_METCA       RTAEELVFG--ESSSGAQNDLEKASEIARTMVCSLGMSKVLGPLTYGRRQQLAYLSVE--
FTSH1_METI4      RAAEELIYG--DITTGAENDLEVATTIARQMVCLYGMGEKSGLAHYVPPQ--PLLGGLD-
FTSH_ACIFD       RVAELLVYG--DLSTGAANDLQGNTELARRMVREWGMSERLGPMAWGSQNVVFL-GEDLL
FTSH_ACIC1       RAAELEILG--EASTGAVNDLSSATELALRMVREYGLSPRLGPVSYPVGGSMYLPGGQEL
FTSH1_SORC5      RAAEELALG--QVSSGAHDDLGRATALVREMVTRLGMSRRLGLAALARTVGAPM-LGVLQ
FTSH1_SYMTH      RAAEALVLG--EVSAGAADDLERATGLAREMVTRWGMDADIGPLRLEHAVEG--------
FTSH_OPITP       RVAEEIALG--SITSGASGDIQEATKTARQMVLEWGMSP-LGFMALSRPD-GDE------
FTSH3_SORC5      RAAEMVVLG--TMTAGASDDIQRASTIAWKMVAELGMSH-LGPICVG----DGH------
FTSH2_SYMTH      LAAEEVLLG--ERSTGAQDDLRRATQVAREMISRYGMGQSVGLMAVPDTDWPGV------
FTSH2_SPHTD      LAAEELIFG--DITTGSSNDLEQTTAIATSMVQRYGMGKRFGLLSTG--AGSDL------
FTSH3_SPHTD      YAAEEYRYG--EVTTGSSGDLSQASALAQAMVTTYGMGKSLRGRAFD--ANG--------
FTSH2_CONWI      AAGERIEFG--HLSTGVHDDLHEATSLARSMVTSFGMSDELGPVTIGEKSGEVFLGASLQ
FTSH_THET8       RAAEEIVFD--DVTTGAENDFRQATELARRMITEWGMHPEFGPVAYAVRE-DTYLGGY--
FTSH_LEPBD       RAAEEIGLE--DVSTGAYSDIKRATKVARAYVESVGMSKKLGPINFENSDDEYSFTP---
FTSH_STRM9       RAGEELMMD--DIATGAYSDIKRATELAKLLISSVGMSE-LGPINYEHSDNGFMLSS---
FTSH1_ALKMQ      RIIEEIVFGPDFVTTGASNDIQKATEILGAMIKQFGMNDEVGMINYDVLFG---------
FTSH_LACP7       RVAEELIFGEEEITTGASNDIQKASAMLVDYLNKYGMDDEMGLFSTVVL-----------
                    *           *   *:              *                        

FTSH_MYCGE       -------VKLYSEQTAKDIDNEINFIIEEQYKKAKTIIKSNRKELELLVEALLIAETILK
FTSH_MYCPN       -------TKLFSEQTAKDIDFEINAIIEEQYKKARTIIKTNRKELELLVEALLIAETILK
FTSH_MYCGH       -------ARYYSENTAQRIDEAIAKILEEQYQVAYNIIKDNQNELKLIVEALLIQETIVK
FTSH_MYCPE       Q------SKNFSESTSQLIDKEIERIFKERYEYAYKIIKEHNKEVELIVESLLLLETIVK
FTSH_UREP2       -------RNSYSEQTALAIDIEIEKIIQREYKIVKEMINEHREELELIVQTLLELETILK
FTSH_MESFL       M------EGTYSDETAARIDAEISKILEESYKIALKIIKENMETLELLAESLRVLETITA
FTSH_MYCPU       -------KGTFGSKMAHEIDLEIRKIISASEEIAIKAIEQNLELLELIKDSLLENETIVA
FTSH_MYCS5       S------NSSLSNQVNHEIELEIRKIIFTAKEQATKIIKQNIELLELIKESLLKKETIVG
FTSH_MYCMO       K------NQLFSDHIAREIDTEVRKIILTAEQKAIEVIQENREMLELIKEALLENETIVD
FTSH_MYCA5       K------NASFSAQVGQEIDQEIRKIILAAEANAHKIISENRELLELIKDALIINETIVA
FTSH_MYCCR       K------NASFSSQVGHEIDIEIREIISSSYKLAIATIQEHRLLLELIKDTLLEKETIVF
FTSH_AYWBP       F------QNDFSDPKGLEIDQQIQKIIANCYQQAKQIIQENQDLLDTIAKYLLEIETLNK
FTSH2_PHYMT      F------YKNFSDSKAVEIDKEIQKIIDYCYQNAKKIITENRDLLDLISKYLLEIETITQ
FTSH3_PHYMT      ----------FSDKK--LIDTAIKKIIDNCYARTKHLMLENKTLLDQIAHLLLEQETITQ
FTSH1_PHYMT      ----------FSDKK--LIDTAIKKIIDNCYARTKHLMLENKTLLDQIAHLLLEQETITQ
FTSH_ACHLI       K------DKNFSDAVALEIDREVRAIITECYEHARKVINENKNLLDNIAKYLIAVETLTK
FTSH2_THEPX      ----------HMLKSTEIVDKEIDKIINSCYILAKKILLENKHKVIAIAEKLLEKESITK
FTSH_AQUAE       VD--------TSPDLLREIDEEVKRIITEQYEKAKAIVEEYKEPLKAVVKKLLEKETITC
FTSH_HYDS0       TE--------GSPDLLKEIDKEVQKLLASAYEETKRVIAENKEALSSVVKRLIEKETIDC
FTSH_ECOLI       ----AKAK-HMSDETARIIDQEVKALIERNYNRARQLLTDNMDILHAMKDALMKYETIDA
FTSH_SHIFL       ----AKAK-HMSDETARIIDQEVKALIERNYNRARQLLTDNMDILHAMKDALMKYETIDA
FTSH_ECO57       ----AKAK-HMSDETARIIDQEVKALIERNYNRARQLLTDNMDILHAMKDALMKYETIDA
FTSH_SALTI       ----AKAK-HMSDETARIIDQEVKALIERNYNRARQILTDNMDILHAMKDALMKYETIDA
FTSH_SALTY       ----AKAK-HMSDETARIIDQEVKALIERNYNRARQILTDNMDILHAMKDALMKYETIDA
FTSH_BUCAI       ----AKAK-HMSDETARIIDEEVKLLIEINYSRARNILNENIDILHAMKEALIKYETIDA
FTSH_BUCAP       ----AKAK-HMSDETARIIDEEVKLLIEVNYNRARKILNENLDILHAMKDALIKYETIDS
FTSH_BUCBP       ----TKSK-HMSDETARIIDEEVKLLVEKNYNRAKKILEENLDILHAMKDALIKYETINS
FTSH_PHOPR       ----TQTK-HMSDDTARAIDMEIRALIDRNYERAREILAQNMDIMHAMKDALMKYETIDA
FTSH_HAEIN       ----AKAK-HMSDETAHSIDEEVRAIVNRNYARAREILIDNMDILHAMKDALVKYETIEE
FTSH_MAGMM       ----TQHK-SVSEETARRIDAEVFDIVDRNYKRAKQILTDKMEVLHTMAQALLERETIDA
FTSH_CUPMC       ----LSSK-TVSEATQQKVDAEIRRIIDDQYALAKRLLEENRDKVEAMTNALMEWETIDA
FTSH_RICCN       ----QPNN-ETSEATAELIDAEVKRIITQGYEFAKDILTKHIDQLHTLANALIEYETLSG
FTSH_RICFE       ----QPSN-ETSEATAELIDAEVKKIITQGYEFAKDILTKHIDQLHTLANALIEYETLSG
FTSH_RICPR       ----QSSN-EISEATAELIDAEVKRIITQGYEFAKDILTKHIDQLHTLANALIEYETLSG
FTSH_RICTY       ----QQSN-EISEATAKLIDAEVKKIITQGYEFAKDILTKHIDQLHTLANALIEYETLSG
FTSH_RICBR       ----NSSS-DRSESTSELIDEEVKKIVTTGYDLAKDILTKHLDQLHILAKALIEYETLSG
FTSH_NEORI       ----PNNH-ILSIEMSNLIDSEVKQLITDALKEATKILNENIESLHRIAKALLEYETLTG
FTSH_BARBK       ----ARTQ-NISEETARMIDAEVRRLIDDAYKTATKILKTQNKQWLALAQGLLEYETLTG
FTSH_CAUVN       ----ARTQ-NVSEETARLIDSEVKRLVQYGLDEARRILTDKIDDLHTLGKALLEYETLSG
FTSH_ZYMMN       ----SRSQ-NISEDTAKIIDQEVRVLVEEGESRARQVLTEHIDELHRLANALIEYETLSG
FTSH_HALO1       ----PQAE-AYSQETAQRIDGEIRRIVTDQYERARRMLEENRDALERVARGLLEYETLDG
FTSH_MYXXD       ----NSSK-DYSEDTARQIDAEVRNIVVGCYERGKNLLTENIEALRRVSDALVEYETLDA
FTSH4_SORC5      ----TSRRRDYSETIANQIDDEVRRFILDAHAEARQLLTDNREILERLATALLERETLDA
FTSH1_BDEBA      ----GNKSKEYSDAKAQEIDTEVEKIIKHGYDISIQILRDHQDALERLTQALLEYETIDG
FTSH_ACIC5       ----AQHR-DFSEETARQIDAEVRSLVDEAYRASYQLLNDNQPIMHKMAAALLERETIDA
FTSH_AKKM8       ----GTRSRNYSESTAELIDSEVRFLVDSAYERAMAILTENRDKLDILTEALMEFETLEG
FTSH2_METI4      ----GT-SRGYSEATARAIDHEVQHFIQAAYEKAKRIILEHKDKVEALAQALLEYETLNA
FTSH_LEPBJ       ----GHSSKYYSEEFAAMIDKEVREIIQTCLNKGRDLVRKNASKFEGLAKALLAKETISH
FTSH_BORBZ       ----SKAK-AYSENTADKVDREVKRILEECLKEASDILLKHKDQLVKLAKELVLKETLTD
FTSH_PELPB       ----SHIR-EYSEETALQIDVEVRNIIMGCMENAKTVLSEQLAVLHRLAGILIEKESLNA
FTSH_UNCTG       ----SRDA-RHSGKTSELIDEEVKNIIYSSKSRASKIIKDNVSILNKIVSYLLERENLSG
FTSH_SYNAS       ----YGSARPFSDGTAEAIDAEVIRIIAESHEEAKRLLRAYRKQLDVLAEALVAQETLDE
FTSH_THET1       -----ITSREYSESLATVIDRETRRIIDECYAEALSLLNRERQRLDNLAEALLREESLDE
FTSH3_CONWI      --------AETSESTQRLVDEEVRRIVDSAHAEVTRLLREHRANLDSLVAGLLDQETLDE
FTSH_MARHV       -----GAPREYSEKLAEMIDSEIQSQLLAFEAFTVSFLTEHRQELDALARAVMKRETLSA
FTSH_NITOC       -----SQPRDFSEQTAQIIDDEIRRILSEVERKTENLLQENRAKLDALAKALIEAETLNL
FTSH_HAHCH       -----AQPHHHSEFSAEIIDKAVRELLVAAETTAADLISTHREKLDRLVALLERSETLHK
FTSH4_SPHTD      -----MQDRDVAEATLERADEAVQRLLREAMERAEQLLRKYRDKLDALAEALIAEETIGQ
FTSH2_THERP      -----VQDHSIGTSTLDRADQAVQRLLNEAMERAERILREHREELDRLADLLIAEETVGP
FTSH_PELCD       -----ASDNAFSQHMAWIIDQEIEKVVKAGEQAADEIIANHLPVLKKLADALLEEEVLDR
FTSH_PELPD       -----AEEKTFSEAMAWRIDQEIAAFITRAEQRAGDLLSANRERLDLLAQALQDEETLDG
FTSH1_RHOBA      -----HQQRQFSEHTQELIDEEVARILMEADQKAEQLLREHRGQLETITRELLDREELNE
FTSH2_SALRM      -----AKGREYSDDTAREVDEEIRRISEDAFQRAVDTLNEHHEAFDQLADMLIEQEEVSG
FTSH_BACPE       ----QNE-QNYSDAIAHEIDLEVQRIIKECYARCKQILLENKDSLDLVAKTLLDMETLDA
FTSH_BACSU       ----NNE-QNYSDQIAYEIDQEIQRIIKECYERAKQILTENRDKLELIAQTLLKVETLDA
FTSH_STAHJ       ----QGE-PNYSGQIAYEIDKEVQRIIKEQYERCKQILLDHEKELKLIAKTLLTEETLVA
FTSH_STRPN       ----Q---KSISEQTAYEIDEEVRSLLNEARNKAAEIIQSNRETHKLIAEALLKYETLDS
FTSH_STRR6       ----Q---KSISEQTAYEIDEEVRSLLNEARNKAAEIIQSNRETHKLIAEALLKYETLDS
FTSH_LACPL       ----MGA-SAFSQHTAQLIDDEVRRLSQEAHQTATDIIESHREQHKLIAEALLKYETLDE
FTSH_LACPJ       ----MGA-SAFSQHTAQLIDDEVRRLSQEAHQTATDIIESHREQHKLIAEALLKYETLDE
FTSH_LEUMM       ----G-N-RAYSEETARLIDEEVRRLAREAFDDAIAILRDNKDKLTAIAEALLEVETLDE
FTSH_OENOE       ----NPN-PPYSQKTSELIDEEVRRLTNEAYKRAVDIIKSHPKQHKAIAEALLKYETLDE
FTSH_LACLA       ----GQT-KTYSEATAVMIDDEVRRILGEAYDRAKEAIETHREQHKAIAEALLKYETLDA
FTSH2_ALKMQ      ----TSK-HNYSEEVAAEIDQEIRKFVEEAYMLTEKLLTENMDKLHVIAQALLKLETLDA
FTSH1_THEPX      ----GRT-RNYSEEVAAEIDREIKRIIEEAYKRAESLLKENIDKLHRVAKALIEKEKLNG
FTSH_CALBD       ----ALA-RNYSEEVAAEIDREIKSIIEEAYKKAEEILKQNIDKLHKVANALLEKEKLTG
FTSH_RUMCH       ----AQA-RNYSDELAAIIDNEVKSIIDNAYQKTVSLLRENIVRLNKLAEVLLEKEKVEG
FTSH_CLONN       ----GKS-KNYSEEVAFEIDNEVKALVDEAYKKAEKILTEHIDKLHAVAKVLLDKEKVTG
FTSH_VEIPT       ----GHE-RNYSEEIAAKIDSEIHRIVEEAYKDVTKLLSDNEKFLHDMANALLEEETIDA
FTSH_HALOH       ----SRQ-RNYSEEIAAEIDKEVSSIIEYCYQRAEKILQENTAKVERIVRELLDRETLDA
FTSH_NATTJ       ----ARD-KDYSENIAYAIDKEIRNMVDSSYQEARETLEENIDKLEKIAQALMERETLVA
FTSH3_SYMTH      ----TRL-RNYSEEVAGLIDEEVRKFVHMAYQRAIDILTEHRDALEKVSEVLLEKETLEG
FTSH_MYCTU       ----GTQ-PDYSHEVAREIDEEVRKLIEAAHTEAWEILTEYRDVLDTLAGELLEKETLHR
FTSH_MYCTA       ----GTQ-PDYSHEVAREIDEEVRKLIEAAHTEAWEILTEYRDVLDTLAGELLEKETLHR
FTSH_MYCBO       ----GTQ-PDYSHEVAREIDEEVRKLIEAAHTEAWEILTEYRDVLDTLAGELLEKETLHR
FTSH_MYCLE       ----GTQ-ADYSHEVARDIDDEVRKLIEAAHTEAWEILTEYRDVLDTLAGELLEKETLHR
FTSH_RHOE4       ----GVQ-SDYSHEIAREIDEEVRNLIEAAHTEAWAILNEYRDALDLIATELLERETLTR
FTSH_CORGL       ----GGN-LDHSQEVAATIDTEVQFLLDKAHEVSYSILAEYRDHLDRLAEKLLEKETLRR
FTSH_ROTMD       ----ASA-RNYSDATAAKVDAEIRALLEQAHDEAFQILLENRDILDRLAFALLEKETLLE
FTSH_TROWT       ----MTA-RDYSEVTAERIDVQVRALIQNAHDEAWEVISNNRNLLDDLALNLLEKETLNQ
FTSH_BRAFD       ----GQA-PRFSAETASLVDQEVRTLLDNALDEAWSVIVENRHVLDRLVEELLEKETLNE
FTSH_CUTAS       ----GQQ-RDYSDETAKIIDDEVRELLENAHQEAFDCLDANREVLDELVRQLFARETLSK
FTSH1_CONWI      ----SSQ-ADYSDEIAREIDDEIRRIVETAHQSAKDILTEHRESLVYISEILIKRETIEK
FTSH_RUBXD       ----HAQ-PDYSDEIAFQIDKEIRRLVDEAYDTAEDLLVRNRRLLEKLASDLIEYETVDA
FTSH_SLAHD       ----GNT-QDYSPETAQRIDEEVARLMKEAHDTAYEILSARQEQMHTMAKVLLERETVDG
FTSH_PORPU       ----GGG-SEYSDEVATNIDKQVREIVSECYKEAKKIVKDNRVVMDRLVDLLIEKETIEG
FTSH_PYRYE       ----GGG-SEYSDEVATNIDKQVREIVSECYAQAKHIIIDNRVVIDRLVDLLIEKETIEG
FTSH_GUITH       ----GSS-SQYSEDIASRIDMQVRAIIQHCHTETVQIIKDNRVVIDKLVDLLIEKETIDG
FTSH2_SYNY3      ----MNR-SEYSEEVATRIDAQVRQLAEQGHQMARKIVQEQREVVDRLVDLLIEKETIDG
FTSH_NOSS1       ----MNK-SDYSEEIAAKIDSQVREIINTCYQTSKELLQTNRVVMERLVDLLTEQETIEG
FTSH1_SYNY3      ----GKR-SEYSEDIAARIDREIQAIVTAAHQRATRIIEENRNLMDLLVDALIDQETIEG
FTSH_TRIEI       ----QSQQPEYSEEVAIKIDHQIRTMVFHCYEKARKIIRENRVLMDRLVDLLIEKETIEG
FTSH_CYACA       ----MGR-HELSEEMVAKVDLEVRSILKDCYIQARTILSQNRKLIDRVVNELVEKETIEA
FTSH_CYAM1       ----RLM-PEVSEEVIAQIDAQVRGMIEACYEKVLELMQANRVVMDRIVEELMEKETLDG
FTSH_TRICV       ----ASG-SEYAENIADRIDDEVRKIITYCYEKAIEIVLDNRVVIDLIVEKLLDKETMDG
FTSH_VAULI       ----KNN-NEFSASVANKIDDQVKIIIKHCYDQAVNIIKQNRFLIDQLVNTLIQEETISG
FTSH_HETA2       ----RPS-NEYSEALAIKIDEQIRTITELCYNEAVEIMDLNRISLDLAVTGLIQDEVLTG
FTSH_ECTSI       ----QTR-PDCFLDIADKIDLQIIEMVEDGFEKACITLERNRLLLDQLATLLTQIETIDG
FTSH3_SYNY3      ----ASD-RDFSDETAAAIDEEVSQLVDQAYQRAKQVLVENRGILDQLAEILVEKETVDS
FTSH_SYNJB       ----AAE-RDFSEETAALIDEEVRRLVNEAYQRATYLIRENRALLDRIARRLVEAETIDG
FTSH1_SPHTD      ----NEQ-RNYSDEVAYMIDQEIRSLIDTAYKRAHEILSQHMDKLEAIAMLLMEAETIDG
FTSH1_THERP      ----AEQ-RNYSDQVAYEIDQEVRRLIDQAYQTAKQILLDHMDKLEKIATLLVEKETLDG
FTSH_CHLAD       ----SEQ-RNYGDEVARQIDEEVHAIVSEAYETAQQILLQNRAVLDDMANALIEYETLDG
FTSH_PSELT       ----TRM-RNYSEEVASEIDEEVRKIVTESYDRAKEILTKYHKQLDELVELLLEREVLEG
FTSH_THEMA       ----TRL-RNYSEEVASKIDEEVKKIVTNCYERAKEIIRKYRKQLDNIVEILLEKETIEG
FTSH_KOSOT       ----TRM-RNYSEEIASEIDNEVKKIVIEAHERARKLVEKFRDKLDKAAEYLIEKETITG
FTSH2_PETMO      ----TRM-KNFSQETAKEIDSEIKNFILSSYEKAKNLLSENRKRLDLLAIYLYNKENISG
FTSH3_PETMO      ----FRE-KNYSDETAKELDSEVKQIINKSYEKAKSVLLENKEKLQFIAQYLLKKETISG
FTSH1_PETMO      ----TKQ-RNYSEETAKELDVEVKKIINSMYDKALELLKQNRERLDLLASYIFKNETIYG
FTSH_HELPY       -------SREFSEKTAEEMDLFIKNLLEERYKHVKQTLSDYREAIEIMVKELFDKEVITG
FTSH_HELPJ       -------SREFSEKTAEEMDLFIKNLLEERYQHVKQTLSDYREAIEIMVKELFDKEVITG
FTSH_HELFC       -------GREFSEKMAEEMDSFIKNLLEERYVHVKQTLSDYKDAIEVMVNELFEKEVITG
FTSH_SULNB       -------T-DYSDKTAEAMDSYIKSTLNERYGYVKETLQNYYGAIDNMAKELLGTEVIEG
FTSH_ATOPD       -------SLTCSEATAEEIDAEVRRIVEEGHQRALQTLKENRFKLHEIAHYLQKKETITG
FTSH_CLOP1       -------VRNCSETTAAIADEEVLQVIKKAHEKSIKILIENRELLDEITGVLLDKETIMG
FTSH_TREPA       -------AREYSECTQQYVDEEVARVLAERYRAVVALLTEKKELLEYIATRLLERETIER
FTSH_PARD8       -------TKPYSEETAKLIDTEVQKIINEQYDRAKRILSENKEGHSKLAQVLLDREVIYS
FTSH_SULMD       -------EKAYSEKTSEIIDKEINKIIKEQYKRALEILKKNYDKLIFLAEKLFKKEVLFK
FTSH_RHOM4       -------DKPYSEETARLIDEEVRRIINEVRERARRILEEKRDKLEALARRLLEKEVLGP
FTSH1_SALRM      -------EKPYSDAMAAAIDEEVADIVREARARANDLLREKRPLLDEMAERLLREEVLGV
FTSH_PELLD       -------EKKFGGETARLIDEEVKAIVESAADTVRTMLKEHRSKLEALARELLTKEMLQY
FTSH4_SYNY3      ----GNPRRMVSDDTAKEIDLEVKEIVEQGHNQALAILEHNRDLLEAIAEKILEKEVIEG
FTSH_ACAM1       ----PNPRRTVGPQVVEAIDQAVKDVVDGAHHMALSILSINQDMLQLTASHLLEKEVLES
FTSH_ANAD2       ---KGFETRSYSDHTALAVDREVQALVEEAQDRARTVVREHRERLEALAARLLTIEVVEE
FTSH2_SORC5      AMPSGAGPRECSDATARAIDAEVARILADAEARARALIQGHRPTLERVAARLYEVETLSG
FTSH_PARP8       --GSEWRPRQYGEQTAAAIDAAVRELIETASACAFSILQANRGLLESAARDLLAKETMSG
FTSH_PSEP1       --LRQER-KDYSEQTAREIDLAVRGLLEEAYGRARALLEQRRDDLDAGARLLLAKETITP
FTSH2_BDEBA      --GAGYRSRTYSEKSATEIDQEIRQIVAACALRTRESLAANLSILKKGAAQLLEKETLSE
FTSH_METPP       --AMPTLSERASPATAERIDAAVQALLGHARQRATEILRDNREMLDRTAAALMAQETLDE
FTSH_RALPJ       --LMQRERNEYSESTAQMIDAEVRKLLAEASHRVQATLEGQRTKLDALAQLLLEKEVVDR
FTSH_SYNFM       --LGSRER-DYSEMIAQEIDEEITRIVEDAHEKVRATLKRERGCLEKLAKILLEKESIDG
FTSH_BURP1       --VWQRGGERCSESTATRIDDEIQRLLAEAHDRVSRTLKERRGALERIAGYLLEHEVVDH
FTSH_PIRSD       --SGEERVRSVSEQTLREIDQEVRRIIDESIEKVRHILDVRRGALVSLTNRLMEVESVDS
FTSH2_RHOBA      --GGE-YQIMHSDEMAKMIDKEVSRIVDDMLVHTREILEQRRDVLEAVTQRLLEVEAIDS
FTSH_METCA       ----GAEERNFSEETARLIDNEVRKLIEEGLQRVREILTHHRVTLDRLAALLREKEVVSG
FTSH1_METI4      ----TSYLKECSDETARIIDLEIEKILEENYQRALSILRHHHVELKEVTKYLLQKETLNA
FTSH_ACIFD       ------HSAEYSDRTARLVDEEVERILREQEERATELLRQHLPGLIAVAHALLERETISG
FTSH_ACIC1       ------TPRPYAEATQQRIDQEVADLLRDAEERARDIIRRNRQAVDELASLLLEQESVDG
FTSH1_SORC5      ------EERTCSEATAREVDEEVRERLGEMYLKAKQLLVDRREGLEAVAEALVLKETLRG
FTSH1_SYMTH      ------------EESLRRADGAMRALVAAAERAARALLEARRSGLERLAAALLERERLEG
FTSH_OPITP       --------PLASPQTFHEAERHVRALLDENYAATTRALTTHRAALDAIADELIRCETILG
FTSH3_SORC5      --------PSRSPALLDRVDETARALTEAQLSRAIEIVRSRRGEIEALVKALLEKETLGM
FTSH2_SYMTH      --------QNLSQESAAAIEREVQALLDRLYREVRSLIETNRDRLVALVVELSDRETLDG
FTSH2_SPHTD      --------QQLSPQSAYTAEQEALELVQQAHQVALDVLRAHADDLERVAQRLLEVETIDG
FTSH3_SPHTD      ---------PVSDETSRAIDEEVSALVSEALELASRTIANAAHLLDALVAALLAEETLDE
FTSH2_CONWI      ------DLGAVGPKTLDLIDDAVERLVKDAELVARAILRINIDAVHETAHALLEHETLSG
FTSH_THET8       ------DVRQYSEETAKRIDEAVRRLIEEQYQRVKALLLEKREVLERVAETLLERETLTA
FTSH_LEPBD       ---------NKSDETVREIDLEIRKILTEEYFNTLNTLQDNWEKLEQVVELLLKKETITG
FTSH_STRM9       ---------DLSNETAREIDLEVRKLLKFKYEETLNLLRDNKETLEKIATLLKEKETVTG
FTSH1_ALKMQ      ----------RQGACDQRVMELTKLNMKRLYDETKVLLEKSLNIVEAVAEDLLIKETLKE
FTSH_LACP7       -----------EDQYDTDFLNKCRNQMHALYDTTKKLMTENKKLLIEITNELLEKESLKG
                                                      :             :   * :  

FTSH_MYCGE       SDIDFIHKNTKLPPEILLQKQEQ-------------------------------------
FTSH_MYCPN       SDIDYIHEHTKLPPEILAQKQEQ-------------------------------------
FTSH_MYCGH       NDIDYIHEHLKLPEAIIKLKEEQLKEK---------------------------------
FTSH_MYCPE       PQIDFIHKYKQLPKEALEKKKELEEKKKA-------------------------------
FTSH_UREP2       PQIDYIHQYKQLPPEVIANKNKR-------------------------------------
FTSH_MESFL       EQIEYINVNKKLPEEVLEQKNRM-------------------------------------
FTSH_MYCPU       EEIEYIEKNMKLPPNNEKIKPDGESKKVNI------------------------------
FTSH_MYCS5       EEIEYIAKHMKLPP--EKIE----------------------------------------
FTSH_MYCMO       EEIQYIAKNLKLPSMRTKAKSE--------------------------------------
FTSH_MYCA5       EEIEYIAKNMKLPPAITKTKEDLHEEYSD-------------------------------
FTSH_MYCCR       EEIQQLEQTLKPLPKSTEIEEK---QKVNT------------------------------
FTSH_AYWBP       RDIDEIVATGKIAWWEKEKEETNAPTQTTS------------------------------
FTSH2_PHYMT      KDLEEILNTGIIEWWEKDK-----------------------------------------
FTSH3_PHYMT      AEIEQLVVNTKK------------------------------------------------
FTSH1_PHYMT      AEIEQLVVNTKK------------------------------------------------
FTSH_ACHLI       TDIDEIAATGQLQWWDNRE-----------------------------------------
FTSH2_THEPX      EELETLWEEENTLCV---------------------------------------------
FTSH_AQUAE       EEFVEVFKLYGIELKDKCK-----------------------------------------
FTSH_HYDS0       KEFVEILSLHGVEVKNACK-----------------------------------------
FTSH_ECOLI       PQIDDLMARR-DVRPP--------------------------------------------
FTSH_SHIFL       PQIDDLMARR-DVRPP--------------------------------------------
FTSH_ECO57       PQIDDLMARR-DVRPP--------------------------------------------
FTSH_SALTI       PQIDDLMARR-EVRPP--------------------------------------------
FTSH_SALTY       PQIDDLMARR-EVRPP--------------------------------------------
FTSH_BUCAI       FQIDDLMKRR-EVRQP--------------------------------------------
FTSH_BUCAP       LQIDDLMERR-EVRKP--------------------------------------------
FTSH_BUCBP       RQIDDLMKRK-SIQSS--------------------------------------------
FTSH_PHOPR       AQIDDLMARKSEIRAP--------------------------------------------
FTSH_HAEIN       EQIKQLMNRE-PVTPP--------------------------------------------
FTSH_MAGMM       DEVIKLMAGEPAETAL--------------------------------------------
FTSH_CUPMC       EQVNDIMAGR-PPRPP--------------------------------------------
FTSH_RICCN       QQIKNLLSGRALD-----------------------------------------------
FTSH_RICFE       QQIKNLLSGRALD-----------------------------------------------
FTSH_RICPR       QQIKNLLSGRALD-----------------------------------------------
FTSH_RICTY       QQIKNLLSGRALD-----------------------------------------------
FTSH_RICBR       QQIKNLLSSRQLD-----------------------------------------------
FTSH_NEORI       QELSDLLEGKPFL-----------------------------------------------
FTSH_BARBK       TEINEVIAGKPPSRTQGSDTAPLRTSSVPKIGAKNSKGASKSGDAEETEPSVGTKATAAS
FTSH_CAUVN       EEIADILKGIPP------------------------------------------------
FTSH_ZYMMN       EEAKRAIAG---------------------------------------------------
FTSH_HALO1       NDIDTLCQGGRLSRPA--------------------------------------------
FTSH_MYXXD       EDVNILLQGGQLTRER--------------------------------------------
FTSH4_SORC5      EEVDAIVGGRELPQRQ--------------------------------------------
FTSH1_BDEBA      HEVDMLVNGAAVAEIE--------------------------------------------
FTSH_ACIC5       NDIRMIIEGKDLPPLK--------------------------------------------
FTSH_AKKM8       SQVMDILEYGEMKNPPARVTPPPMPSEVE-------------------------------
FTSH2_METI4      DQVTEIVKTGKMTNPPSKNSSP--------------------------------------
FTSH_LEPBJ       EELMTIVHPAN-------------------------------------------------
FTSH_BORBZ       KEVRELLG----------------------------------------------------
FTSH_PELPB       REIQEITG----------------------------------------------------
FTSH_UNCTG       EDIDKIIKGEELA-----------------------------------------------
FTSH_SYNAS       QEILRITGLPPAPA----------------------------------------------
FTSH_THET1       QQIREIVGL---------------------------------------------------
FTSH3_CONWI      ADAYEAAGLEHMRPERVEPPAPRPSRRDGGRSVAAGPVPHGLE-----------------
FTSH_MARHV       GEITEVLEEARSRE----------------------------------------------
FTSH_NITOC       VEVEKIFKNVKELP----------------------------------------------
FTSH_HAHCH       AQIDECLQTGAS------------------------------------------------
FTSH4_SPHTD      EKITEILGAPPVPS----------------------------------------------
FTSH2_THERP      EKIREVLGEQPVAA----------------------------------------------
FTSH_PELCD       TRVDEVLRETGIEV----------------------------------------------
FTSH_PELPD       SRVDEIIGSLNTAQ----------------------------------------------
FTSH1_RHOBA      AELTELIGPSIHKR----------------------------------------------
FTSH2_SALRM      KDVLNLVNGDTDEIGHMPTTNGAAAS----------------------------------
FTSH_BACPE       EQIKSLVHEGKLP-----------------------------------------------
FTSH_BACSU       EQIKHLIDHGTLP-----------------------------------------------
FTSH_STAHJ       EQIRSLFYDGVLP-----------------------------------------------
FTSH_STRPN       TQIKALYETGKMP-----------------------------------------------
FTSH_STRR6       TQIKALYETGKMP-----------------------------------------------
FTSH_LACPL       KQILSLFKTGKMP-----------------------------------------------
FTSH_LACPJ       KQILSLFKTGKMP-----------------------------------------------
FTSH_LEUMM       KQIKDIYLTGTFT-----------------------------------------------
FTSH_OENOE       AQIRSLFETGEIP-----------------------------------------------
FTSH_LACLA       KQIMSLFKTGKMP-----------------------------------------------
FTSH2_ALKMQ      DAFEMIFTGEIVIGK---------------------------------------------
FTSH1_THEPX      EEFEKVFNGE--------------------------------------------------
FTSH_CALBD       EEFRKL------------------------------------------------------
FTSH_RUMCH       AEFEEIFENA--------------------------------------------------
FTSH_CLONN       EEFNAIVEGR--------------------------------------------------
FTSH_VEIPT       KAVDNLYKYGTTK-----------------------------------------------
FTSH_HALOH       EQLQKLIKGE--------------------------------------------------
FTSH_NATTJ       KEIKMLMEGKDLP-----------------------------------------------
FTSH3_SYMTH      KELQDLLEQLLPP-----------------------------------------------
FTSH_MYCTU       PELESIFADVEKRPRL--------------------------------------------
FTSH_MYCTA       PELESIFADVEKRPRL--------------------------------------------
FTSH_MYCBO       PELESIFADVEKRPRL--------------------------------------------
FTSH_MYCLE       PELEGIFASVEKRPRL--------------------------------------------
FTSH_RHOE4       KDLEKILAGVEKRPRI--------------------------------------------
FTSH_CORGL       PDLEALFDDIVPRKVA--------------------------------------------
FTSH_ROTMD       NEIAEIFKDVRKRPER--------------------------------------------
FTSH_TROWT       DEIAEIFKGVRKLPER--------------------------------------------
FTSH_BRAFD       RELAQIFRDVKKQPPR--------------------------------------------
FTSH_CUTAS       AEVADIFKPLKRWPER--------------------------------------------
FTSH1_CONWI      DQFEALVDGRTEE-----------------------------------------------
FTSH_RUBXD       EHLRRLV-----------------------------------------------------
FTSH_SLAHD       EECQALLNNTW-------------------------------------------------
FTSH_PORPU       NEFRHIVKEYTAIPE---------------------------------------------
FTSH_PYRYE       NEFRDIVKEYTAIPE---------------------------------------------
FTSH_GUITH       DEFRQIVGDFTSLPE---------------------------------------------
FTSH2_SYNY3      EEFRQIVAEYAEVPV---------------------------------------------
FTSH_NOSS1       DLFRKIVSE-SQNPV---------------------------------------------
FTSH1_SYNY3      EHFRQLVESYQQSQK---------------------------------------------
FTSH_TRIEI       DEFRRIVSEYTELPK---------------------------------------------
FTSH_CYACA       KEFMRIVEERV-------------------------------------------------
FTSH_CYAM1       KEFRQLVSQAARLTA---------------------------------------------
FTSH_TRICV       DEFRELLSTYTILPN---------------------------------------------
FTSH_VAULI       NDFREQINNYTKLPK---------------------------------------------
FTSH_HETA2       VSFEKVVADFSKLPT---------------------------------------------
FTSH_ECTSI       KEFEQFVSTYTGLPK---------------------------------------------
FTSH3_SYNY3      EELQTLLA----------------------------------------------------
FTSH_SYNJB       EELQAIID----------------------------------------------------
FTSH1_SPHTD      HELEALFDEPRPRPQL--------------------------------------------
FTSH1_THERP      HEIEALFDEPRPRPEL--------------------------------------------
FTSH_CHLAD       EQLEELIRRVKP------------------------------------------------
FTSH_PSELT       EELRKILKTE--------------------------------------------------
FTSH_THEMA       DELRRILSEE--------------------------------------------------
FTSH_KOSOT       KELAEIVGLAESGNYY--------------------------------------------
FTSH2_PETMO      KEFKKMMEMDIEELND--------------------------------------------
FTSH3_PETMO      QELRDLLQKDTDDLKE--------------------------------------------
FTSH1_PETMO      EEFKKLMSKDLEELKE--------------------------------------------
FTSH_HELPY       ERVREIIS--------------------------EYEVAN--------------------
FTSH_HELPJ       ERVREIIS--------------------------EYEAAN--------------------
FTSH_HELFC       ERVREIIS--------------------------EYEVSH--------------------
FTSH_SULNB       KTVRRIIE--------------------------EYEQEK--------------------
FTSH_ATOPD       EEFMNILK-------------------------RENTFA---------------------
FTSH_CLOP1       DEFMEIVYGK-----YPEKREADEKAKKEIQSLREQALAKRKEKEEAIKKAREEALRLEE
FTSH_TREPA       DEFEEVIR-------------------------CEHDLE---------------------
FTSH_PARD8       EDVEHIFGKRAWISR--------------SQEI---------------------------
FTSH_SULMD       EDFASILD----------------------------------------------------
FTSH_RHOM4       RDLVEILGPRPYGDY--------------PSPN---------------------------
FTSH1_SALRM      EALVALLGSPPHGEY--------------AWLK---------------------------
FTSH_PELLD       CQIEEILGKRPGGQE--------------EDSG---------------------------
FTSH4_SYNY3      EELHHL------------------------------------------------------
FTSH_ACAM1       QELHSL------------------------------------------------------
FTSH_ANAD2       DEITRLWGPKVVRPGTIEGRG---------------------------------------
FTSH2_SORC5      DEL---------------------------------------------------------
FTSH_PARP8       EELQAL------------------------------------------------------
FTSH_PSEP1       EEFPAL------------------------------------------------------
FTSH2_BDEBA      PEIELL------------------------------------------------------
FTSH_METPP       EALLAL------------------------------------------------------
FTSH_RALPJ       QDLDMFLSAKVTPMP---------------------------------------------
FTSH_SYNFM       EELKQFCQEVKSHI----------------------------------------------
FTSH_BURP1       DKLVRLVNDEPTPEPGARDPGGD-------------------------------------
FTSH_PIRSD       DELKRIIDET-SPGP---------------------------------------------
FTSH2_RHOBA      DELMRLIQEN-SRGP---------------------------------------------
FTSH_METCA       EDVKAV------------------------------------------------------
FTSH1_METI4      EEFKSI------------------------------------------------------
FTSH_ACIFD       EEVGRLVDEAAGHPIHPDGKRVLPIAKL--------------------------------
FTSH_ACIC1       AVVYQLVGRPVPTPEEHREAAARHVRR---------------------------------
FTSH1_SORC5      EELEEIAAVSTRRK----------------------------------------------
FTSH1_SYMTH      PEVEALLELTPGEKPY--------------------------------------------
FTSH_OPITP       NDVRRIAAQHP-------------------------------------------------
FTSH3_SORC5      DEIQACFPADRRP-----------------------------------------------
FTSH2_SYMTH      DDVRRILSA---------------------------------------------------
FTSH2_SPHTD      EELETLISPPRQLPVRRPVEQALPTPLHRAPIREGRRKGSAHRVGRAI------------
FTSH3_SPHTD      ARLAAILGP---------------------------------------------------
FTSH2_CONWI      VALEAVLSTVTTVEPEHFP-----------------------------------------
FTSH_THET8       EEFQRVVEGLPLEAPEEAR-----------------------------------------
FTSH_LEPBD       DEVRRIIAGEKAEDILK-------------------------------------------
FTSH_STRM9       SEIRALVSGSSVNEVL--------------------------------------------
FTSH1_ALKMQ      DEINEIFSGFQSM-----------------------------------------------
FTSH_LACP7       EDIDRICLKEAV------------------------------------------------
                                                                             

FTSH_MYCGE       --------------------------------------QAKQKLNK---SEVK-------
FTSH_MYCPN       --------------------------------------QAKQKAEA---KEAKLNKKTEK
FTSH_MYCGH       -------------------------------------AAAEKEEQA---EKAKLDHQSDS
FTSH_MYCPE       ---------------------------------EDLIRKAKKESEASSKEEKEMDVEKKV
FTSH_UREP2       --------------------------------------EASQKQANSSVEEAKVVDDEES
FTSH_MESFL       ---------------------------------------AKE-------DEKIKKGEIID
FTSH_MYCPU       --------------------------EDLINQVNESQEKDKQKNAQIKEDLSKMDKKDNL
FTSH_MYCS5       -----------------------------------------------EKDLSKNSEDNNL
FTSH_MYCMO       ---------------------------------NVNQIRNVDELVKEVKDQTLIIKDKND
FTSH_MYCA5       --------------------------QDFDNLFNEVSGKKIISEDKYVDDLNKEIKQLEE
FTSH_MYCCR       --------------------------KDILEELMGSDFANNQEKSYENEDQNQNSLEAIN
FTSH_AYWBP       --------------------------QMSSNNETTNTDKTPLNDELEITTNLDNQESNES
FTSH2_PHYMT      -----------------------------------------------LKKNLQKSEKEDC
FTSH3_PHYMT      ------------------------------------------------------------
FTSH1_PHYMT      ------------------------------------------------------------
FTSH_ACHLI       -----------------------------------------------VEEDSKKSE----
FTSH2_THEPX      ------------------------------------------------------------
FTSH_AQUAE       -----------------------------------------------KEELFDKDRKSEE
FTSH_HYDS0       -----------------------------------------------QEESLEK---KEN
FTSH_ECOLI       -------------------------------------------AGWEEPGASNNSGDNGS
FTSH_SHIFL       -------------------------------------------AGWEEPGASNNSGDNGS
FTSH_ECO57       -------------------------------------------AGWEEPGASNNAGDNGS
FTSH_SALTI       -------------------------------------------AGWEDPNGTNNSDSNGT
FTSH_SALTY       -------------------------------------------AGWEDPNGTNNSDSNGT
FTSH_BUCAI       -------------------------------------------KGWIETDTNK-------
FTSH_BUCAP       -------------------------------------------KGWLEVDQKKDI-----
FTSH_BUCBP       -------------------------------------------NICTDDDNN--------
FTSH_PHOPR       -------------------------------------------KGWGDTDDVMKSSPTTS
FTSH_HAEIN       -------------------------------------------SGWGEPKTQQAAYANST
FTSH_MAGMM       -------------------------------------------KPLKKKDERANKPTPTV
FTSH_CUPMC       -------------------------------------------RGAQGPNSGGNTPPGGS
FTSH_RICCN       --------------------------------------------SEEENKFPFND-SSTI
FTSH_RICFE       --------------------------------------------SEEENKFPFND-SPTI
FTSH_RICPR       --------------------------------------------SEEENKFPFND-SHTI
FTSH_RICTY       --------------------------------------------SEEENKFPFND-AHTI
FTSH_RICBR       --------------------------------------------SEEENNFPFGAASSTI
FTSH_NEORI       --------------------------------------------KKTADDKKVVS-KSSL
FTSH_BARBK       SAKKVVKNASAKSAEKKASGTQVKAATPAATSIKATSAKVASAKAETENVASAQAATENV
FTSH_CAUVN       -------------------------------------------KREEEEAATAVIAPSLV
FTSH_ZYMMN       -----------------------------------------------EKITTIEVKPQVT
FTSH_HALO1       --------------------------------------------VVSKPSADAESSVDED
FTSH_MYXXD       --------------------------------------------PPPRVNAPPKATEKKD
FTSH4_SORC5      --------------------------------------------RVVIPSYSDRDRAAKE
FTSH1_BDEBA      --------------------------------------------KYRNAKKDSNAAIMNA
FTSH_ACIC5       --------------------------------------------PSGGSGTATTDDVQQV
FTSH_AKKM8       -------------------------------------------EQPGKDDSGHNEKKEAE
FTSH2_METI4      -------------------------------------------VSNGGEASSTKSPARQE
FTSH_LEPBJ       ------------------------------------------------EEGAKKKPEKTV
FTSH_BORBZ       ----------------------------------------------FEANKDEYDLFSSD
FTSH_PELPB       ----------------------------------------------PGQG----------
FTSH_UNCTG       --------------------------------------------PLSESSSVDEETKKKS
FTSH_SYNAS       ----------------------------------------LDAGKLPVPDGGDKNAEPSV
FTSH_THET1       ---------------------------------------------------GEKQPEPA-
FTSH3_CONWI      ----------------------------------------APERPAQIAAPGADEPEPPT
FTSH_MARHV       ------------------------------------------------TA----------
FTSH_NITOC       ------------------------------------------------QEGHNEAVATGA
FTSH_HAHCH       ------------------------------------------------------------
FTSH4_SPHTD      ------------------------------------------------AAPAAAADSV--
FTSH2_THERP      ------------------------------------------------GDD---------
FTSH_PELCD       ------------------------------------------------QDDPAAHPDGDH
FTSH_PELPD       ------------------------------------------------APPP--------
FTSH1_RHOBA      ------------------------------------------------LGDEEGKVEQIM
FTSH2_SALRM      -------------------------------------------EENGSADDHEPDEATVI
FTSH_BACPE       ---------------------------------------------DDHHLNAHLEKEKAS
FTSH_BACSU       ---------------------------------------------ERNFSDDEKN-----
FTSH_STAHJ       ---------------------------------------------EVDYDAARVVKDEDS
FTSH_STRPN       ---------------------------------------------EAVEEES----HALS
FTSH_STRR6       ---------------------------------------------EAVEEES----HALS
FTSH_LACPL       ---------------------------------------------EKDSNEFPS-EKAAT
FTSH_LACPJ       ---------------------------------------------EKDSNEFPS-EKAAT
FTSH_LEUMM       ---------------------------------------------RKDIQDDTELAKAKS
FTSH_OENOE       ---------------------------------------------SDLVKDSQRPARPLS
FTSH_LACLA       ---------------------------------------------DEAAAAEVP--EPKT
FTSH2_ALKMQ      ---------------------------------------------DDQLEDIQPKLNVVK
FTSH1_THEPX      -----------------------------------------------DIEGVQFA-----
FTSH_CALBD       -----------------------------------------------VFEDAQPQLV---
FTSH_RUMCH       -----------------------------------------------VLEGSSQ------
FTSH_CLONN       -----------------------------------------------PLEELNKKENAID
FTSH_VEIPT       -----------------------------------------------EPEAEEPK-----
FTSH_HALOH       -----------------------------------------------PLDD---------
FTSH_NATTJ       -----------------------------------------------PIEESEDTETLDF
FTSH3_SYMTH      -----------------------------------------------RPKP---------
FTSH_MYCTU       -------------------------------------------TMFDDFGGRIP--SDKP
FTSH_MYCTA       -------------------------------------------TMFDDFGGRIP--SDKP
FTSH_MYCBO       -------------------------------------------TMFDDFGGRIP--SDKP
FTSH_MYCLE       -------------------------------------------TMFDDFGGRIP--SDKP
FTSH_RHOE4       -------------------------------------------TAFNDFGGRTP--SDRP
FTSH_CORGL       -------------------------------------------EVFPDESTRFPRQENRE
FTSH_ROTMD       -------------------------------------------EHWYSKPTRER--TDIP
FTSH_TROWT       -------------------------------------------HVWQSAPNREP--SNKP
FTSH_BRAFD       -------------------------------------------EVWISSTERPS--LAAP
FTSH_CUTAS       -------------------------------------------GAFTGSDKRVP--SSIP
FTSH1_CONWI      -------------------------------------------EVFGAEASPPPDVPLPP
FTSH_RUBXD       -------------------------------------------EEYAVDEHPS-------
FTSH_SLAHD       -------------------------------------------DEFLAKKQAEAAAKAAD
FTSH_PORPU       -------------------------------------------------KNYYISQF---
FTSH_PYRYE       -------------------------------------------------KNYYISQF---
FTSH_GUITH       -------------------------------------------------KIDYKSQLKST
FTSH2_SYNY3      -------------------------------------------------KEQLIPQL---
FTSH_NOSS1       -------------------------------------------------VDEQLSMVNSQ
FTSH1_SYNY3      -------------------------------------------------QPALAGK----
FTSH_TRIEI       -------------------------------------------------KQKSLINLEKK
FTSH_CYACA       ------------------------------------------------------------
FTSH_CYAM1       -------------------------------------------------VN---------
FTSH_TRICV       -------------------------------------------------KNIPYVSKFN-
FTSH_VAULI       -------------------------------------------------KLSTLSEKNNV
FTSH_HETA2       -------------------------------------------------NKIYESKFPKK
FTSH_ECTSI       -------------------------------------------------KPQLKIVKAKE
FTSH3_SYNY3      ------------------------------------------------NNNAKLALLV--
FTSH_SYNJB       ------------------------------------------------NSEVVMLPPEEE
FTSH1_SPHTD      -------------------------------------------VGPPVTRPAALAHKTEE
FTSH1_THERP      -------------------------------------------VGPPLTRPAALIATPET
FTSH_CHLAD       -------------------------------------------LTLDFSKSGSTTPNGRT
FTSH_PSELT       ----------------------------------------------LGEEMVNHDKLRAA
FTSH_THEMA       ----------------------------------------------FEKVVE--------
FTSH_KOSOT       -------------------------------------------RDPLAETKGSKRKVSAV
FTSH2_PETMO      -------------------------------------------YV--LKDKDVKETNLFV
FTSH3_PETMO      -------------------------------------------YVENLGVSSTQEEAKVV
FTSH1_PETMO      -------------------------------------------YIGGEKEINEFLKIDVV
FTSH_HELPY       -----------------------------------------------NLESRLIPLEEQA
FTSH_HELPJ       -----------------------------------------------NLESRLIPLEEQA
FTSH_HELFC       -----------------------------------------------NLQTRLVPLEEHA
FTSH_SULNB       -----------------------------------------------GMPSRLAHKDKVA
FTSH_ATOPD       -------------------------------------------------PVDKNINDEGS
FTSH_CLOP1       EQRKQDELKAMIEAQEEAAKLA---------RANNEANNDALDSSKENEEVKSNVNDGAT
FTSH_TREPA       -----------------------------------------------GLKKRLSQQQEGA
FTSH_PARD8       ---------------------------------------LELQEKANGKNKENADKEAEA
FTSH_SULMD       ------------------------------------------------------------
FTSH_RHOM4       ---------------------------------------GKDVEELKDLQKGEPTSSSAV
FTSH1_SALRM      ---------------------------------------EGD---------GTSRNSASA
FTSH_PELLD       ---------------------------------------EVDCSK-KSAENGMVAHEPET
FTSH4_SYNY3      -------------------------------------------LGQVQAPGTLVV-----
FTSH_ACAM1       -------------------------------------------LSQPQFPPDMDEWLQTG
FTSH_ANAD2       -----------------------------------------HEESPPETPNRPVAASADA
FTSH2_SORC5      ---------------------------------------------------REMVASGEA
FTSH_PARP8       -------------------------------------------LSQLGGGAASASVLRDG
FTSH_PSEP1       -------------------------------------------QPQANEPATYVLVDATK
FTSH2_BDEBA      -------------------------------------------MRDLVVKNAAPQRERDL
FTSH_METPP       -------------------------------------------TAGLRAAGRPAAIRQVA
FTSH_RALPJ       -------------------------------------------------PPKPVANIEES
FTSH_SYNFM       --------------------------------------------------ARDPVQVEGG
FTSH_BURP1       ---------------------------------------AAKRSGIGAAPAKPPAEVGSA
FTSH_PIRSD       ------------------------------------------LVVPGTLPANTMRSTTEP
FTSH2_RHOBA      ------------------------------------------WLVPGTVTEKPKAKIVPR
FTSH_METCA       --------------------------------------------------IREAAS----
FTSH1_METI4      -------------------------------------------LENLKEQRKEAPSYSST
FTSH_ACIFD       -------------------------------------PEYAELEQFTVTNGNNHAASHDD
FTSH_ACIC1       -------------------------------------PGIAAATGASMAGGSEPRTAASS
FTSH1_SORC5      -----------------------------------------------IAVGPPSAA----
FTSH1_SYMTH      -----------------------------------------------IIVANSRGDEGNQ
FTSH_OPITP       ----------------------------------------------------PSALAG--
FTSH3_SORC5      ---------------------------------------------------RPEDQAA--
FTSH2_SYMTH      ------------------------------------------------------------
FTSH2_SPHTD      -------------------------------------GLVASFTRDAVESLRAAKPQIDR
FTSH3_SPHTD      ---------------------------------------------------RPARPAMN-
FTSH2_CONWI      -----------------------------------------------ELRERERGSARDR
FTSH_THET8       -----------------------------------------------EEREPPRVVPKVK
FTSH_LEPBD       ---------------------------------------------GTEVKEESIQKGSEG
FTSH_STRM9       -----------------------------------------------ELDDEQLEKYY--
FTSH1_ALKMQ      ------------------------------------------------------------
FTSH_LACP7       ------------------------------------------------------------
                                                                             

FTSH_MYCGE       ---PESETNS--------------------------------------------------
FTSH_MYCPN       DTEKDSETNS--------------------------------------------------
FTSH_MYCGH       AQPQEEPTASTASSN---------------------------------------------
FTSH_MYCPE       QKPSASSTEPTSKPKKAPSKESSSDKKK--------------------------------
FTSH_UREP2       IKDKEKDQKSN-------------------------------------------------
FTSH_MESFL       IKVEDLDID---------------------------------------------------
FTSH_MYCPU       TKAKDKGEEETLAEKAE-------------------------------------------
FTSH_MYCS5       DSLIEKTSKKE-------------------------------------------------
FTSH_MYCMO       KKIKDSENNIKTDESLDIK-----------------------------------------
FTSH_MYCA5       KIEANKSSSKSTVNEEKSKDEKNN------------------------------------
FTSH_MYCCR       YNIDDQDDDKNDSESKIDSSKEQ-------------------------------------
FTSH_AYWBP       NPNNNEKASPEVLSTDSEQT----------------------------------------
FTSH2_PHYMT      NK----------------------------------------------------------
FTSH3_PHYMT      ------------------------------------------------------------
FTSH1_PHYMT      ------------------------------------------------------------
FTSH_ACHLI       ------------------------------------------------------------
FTSH2_THEPX      ------------------------------------------------------------
FTSH_AQUAE       NKELKSEEVKEEVV----------------------------------------------
FTSH_HYDS0       NVEPKIDKNVVNV-----------------------------------------------
FTSH_ECOLI       PKAPRPVDEPRTPNPGNTMSEQLGDK----------------------------------
FTSH_SHIFL       PKAPRPVDEPRTPNPGNTMSEQLGDK----------------------------------
FTSH_ECO57       PKAPRPVDEPRTPNPGNTMSEQLGDK----------------------------------
FTSH_SALTI       PQAPRPVDEPRTPNPGNTMSEQLGDK----------------------------------
FTSH_SALTY       PQAPRPVDEPRTPNPGNTMSEQLGDK----------------------------------
FTSH_BUCAI       ------------------------------------------------------------
FTSH_BUCAP       ------------------------------------------------------------
FTSH_BUCBP       ------------------------------------------------------------
FTSH_PHOPR       ESAPEAKTESAPEAKAEANVETEEKPVAADSEELKPKAEQAPKEDDKPQA----------
FTSH_HAEIN       TNDTKPESAVENTDDFNV------------------------------------------
FTSH_MAGMM       ADDGEQGDQTAKDAVAGSVTQAEDDVEGSTRTATEASTQEVVSKDTPEGDDKDR------
FTSH_CUPMC       PVAPTNAPATARADETV-------------------------------------------
FTSH_RICCN       KIDKEKSPEKTKTTKAKKENYAS-------------------------------------
FTSH_RICFE       KIDKEKSPEKAKKAKKESTNI---------------------------------------
FTSH_RICPR       KIDKENLHEKVKSTKDKKENIIS-------------------------------------
FTSH_RICTY       KIDKEKLHEKTKTTKAQKENIAS-------------------------------------
FTSH_RICBR       KIAEEKDLKKAKPIKAKKEDKS--------------------------------------
FTSH_NEORI       DVEDDTVDKETLEKLESDLDTGDKE-----------------------------------
FTSH_BARBK       AMVKAATANVAKKSVESAQADDAEKKRLEEHNKSAHNKKGNLTAGAASNTEDEK------
FTSH_CAUVN       PLSPGAGASVTA------------------------------------------------
FTSH_ZYMMN       IPLSGGASGVPKSPPFNGWGNAAPQGA---------------------------------
FTSH_HALO1       EREARPALFPPLGKSGTDPEPEPA------------------------------------
FTSH_MYXXD       KRKILDAL---EGLPAMEPKKA--------------------------------------
FTSH4_SORC5      KRRAASIF----GTPKPAPST---------------------------------------
FTSH1_BDEBA      AEKKGSGD----PVGNTGPVTI--------------------------------------
FTSH_ACIC5       LKPSSDRG--AGGLPEGSPSPA--------------------------------------
FTSH_AKKM8       ETRADGAEERKMEEELEQAERAPFSYNPVDEFGKDGGEKK--------------------
FTSH2_METI4      ETTKDGG-------LLPGLEGAPA------------------------------------
FTSH_LEPBJ       KSKKQNG-----------IKANPAYNE---------------------------------
FTSH_BORBZ       STTKEVKGEDVKG-----------------------------------------------
FTSH_PELPB       ALPNPVTA----------------------------------------------------
FTSH_UNCTG       TVEKKVINEKVIIS----------------------------------------------
FTSH_SYNAS       SLPGVAGPS---------------------------------------------------
FTSH_THET1       ------------------------------------------------------------
FTSH3_CONWI      NGSGELGGSVRAGDA---------------------------------------------
FTSH_MARHV       ------------------------------------------------------------
FTSH_NITOC       G-----------------------------------------------------------
FTSH_HAHCH       ------------------------------------------------------------
FTSH4_SPHTD      ------------------------------------------------------------
FTSH2_THERP      ------------------------------------------------------------
FTSH_PELCD       VLQGELAGGAVEG-----------------------------------------------
FTSH_PELPD       ------------------------------------------------------------
FTSH1_RHOBA      APEGAAERTSNASARRED------------------------------------------
FTSH2_SALRM      EEDGESGEGRASGSADASGS----------------------------------------
FTSH_BACPE       ------------------------------ESDVKVNINSKKEETPQVEAEQPQEPNTDE
FTSH_BACSU       -------------------------------DDVKVNILTKTE-----------------
FTSH_STAHJ       DYSEGKYGKSYDDIREEQLEEGKEDMREDRKEDNDMNRERRHRQRDDRDNQTGHDQLRDG
FTSH_STRPN       YD---------EVKSKMN-------------DEK--------------------------
FTSH_STRR6       YD---------EVKSKMN-------------DEK--------------------------
FTSH_LACPL       FE---------ESKRELERREAEKHAQNQSADDKQADSADTTTNVSVAEPSFPSESDASS
FTSH_LACPJ       FE---------ESKRELERREAEKHAQNQSADDKQADSADTTTNVSVAEPSFPSESDASS
FTSH_LEUMM       FE---------EAKAAA--------------DAKDSQAEQRFEKQDEEKSSDDHSESKNE
FTSH_OENOE       YE---------ESKAALKK--------NGAVDNKEAEDELKRTKMIRKMKMIPSRVPIQL
FTSH_LACLA       FE---------ESLKDAN-------------ANVDDFSNINIYNGDEKTDSKPEENKEKS
FTSH2_ALKMQ      AK----------------------KRAAEAAEEAEVAKEDAKKQDVKVSLKKQEKEELIE
FTSH1_THEPX      ------------------------------------------------------------
FTSH_CALBD       ------------------------------------------------------------
FTSH_RUMCH       --------------------------------TPQLEG----------------------
FTSH_CLONN       LE----------------------KHDNVEEVHDDVEGVHDDVEGVNIKDTSEDNIETTD
FTSH_VEIPT       --------------------------------VASEADSSIVPEGVDAKKTTSTVADLSE
FTSH_HALOH       --------------------------------------DSIDNSTDENENR-------EH
FTSH_NATTJ       LV----------------------DEQQDTKSESDNEQQSQENQADNNQNDSTTEFDDEQ
FTSH3_SYMTH      --------------------------------------EPLKPRMVGGGTS---------
FTSH_MYCTU       PIKTPGELAIERGEPWPQPVPEPAFKAAIAQATQ---AAEAARSDAGQTGHGANGSPAGT
FTSH_MYCTA       PIKTPGELAIERGEPWPQPVPEPAFKAAIAQATQ---AAEAARSDAGQTGHGANGSPAGT
FTSH_MYCBO       PIKTPGELAIERGEPWPQPVPEPAFKAAIAQATQ---AAEAARSDAGQTGHGANGSPAGT
FTSH_MYCLE       PIKTPGELAIERGEPWPQPVPEPAFKAAIARASQ---AAEASHQAAQSDTDGPPGQGANG
FTSH_RHOE4       PVKTPRELAIERGETWPEPAAAPVLVKAGAPNSG---VPNGGVPNNGGLPNNGNQGPSNG
FTSH_CORGL       PVKTPVELALERGEEPPKKFSILEASRATRERRRKELEAQGKLPVQPASSAGVAPAAGAA
FTSH_ROTMD       PVKAPSELAKEAEKSEEAPAEAPTVPVAPAAPAQQVPVAPTQPLPPQAPLTDPDADPTVA
FTSH_TROWT       PVKYSA--------------------------------------------MGPDSEVTAK
FTSH_BRAFD       SVGGTTTATGTESHDAGEP-------------------------------LQPNPPELPH
FTSH_CUTAS       PVKPPQIAGVDEDAPEVGAPR-------------------------RGVIAPPTPEPGGD
FTSH1_CONWI      ATERGRD----------------------------------------------TPRPLPR
FTSH_RUBXD       ---RGR-------------------------------------------------PAMSV
FTSH_SLAHD       QAEQPQV----------------------------------------------EAEPVAQ
FTSH_PORPU       ------------------------------------------------------------
FTSH_PYRYE       ------------------------------------------------------------
FTSH_GUITH       ------------------------------------------------------------
FTSH2_SYNY3      ------------------------------------------------------------
FTSH_NOSS1       ------------------------------------------------------------
FTSH1_SYNY3      ------------------------------------------------------------
FTSH_TRIEI       I-----------------------------------------------------------
FTSH_CYACA       ------------------------------------------------------------
FTSH_CYAM1       ------------------------------------------------------------
FTSH_TRICV       ------------------------------------------------------------
FTSH_VAULI       NPKITESFVVF-------------------------------------------------
FTSH_HETA2       ------------------------------------------------------------
FTSH_ECTSI       NKNKVKAPV---------------------------------------------------
FTSH3_SYNY3      ------------------------------------------------------------
FTSH_SYNJB       PEPLTLPMAVNAGA----------------------------------------------
FTSH1_SPHTD      ADRGGERSPHPQPHPSPTMRPQPAS-----------------------------------
FTSH1_THERP      A-RPDSPSEARPAAPVPHIKPQPAS-----------------------------------
FTSH_CHLAD       EDRPAQPDAPQMGLGGPS--PLPA------------------------------------
FTSH_PSELT       AGSEQDS-----------------------------------------------------
FTSH_THEMA       ------------------------------------------------------------
FTSH_KOSOT       STNEEAKEGNEDEKN---------------------------------------------
FTSH2_PETMO      SYA---------------------------------------------------------
FTSH3_PETMO      NYEYLSRENNLIERKGI-------------------------------------------
FTSH1_PETMO      NHVNYQPV----------------------------------------------------
FTSH_HELPY       S-----------------------------------------------------------
FTSH_HELPJ       S-----------------------------------------------------------
FTSH_HELFC       S-----------------------------------------------------------
FTSH_SULNB       KNKAEADKKEEALKKEISEESDNNKEA---------------------------------
FTSH_ATOPD       STPSEE------------------------------------------------------
FTSH_CLOP1       EEKKDDSSTNNKVDGE--------------------------------------------
FTSH_TREPA       SAPAQGQSPPS-------------------------------------------------
FTSH_PARD8       DATTENVTDTPTEENKTGKIA---------------------------------------
FTSH_SULMD       ------------------------------------------------------------
FTSH_RHOM4       EAPAPQTERPESSSAP--------------------------------------------
FTSH1_SALRM      EGASPSSQG---------------------------------------------------
FTSH_PELLD       TADAESTEKVGLSATELAELEAAAERLRQSRNVSDN------------------------
FTSH4_SYNY3      ------------------------------------------------------------
FTSH_ACAM1       KLPQGKELIQTTLNSHQLIGIN--------------------------------------
FTSH_ANAD2       SAGFGRSGPQPPQALARHAGGDPDPES---------------------------------
FTSH2_SORC5      ------------------------------------------------------------
FTSH_PARP8       GDGAADAGQDRSGEHRALTVEGGEAQ----------------------------------
FTSH_PSEP1       ------------------------------------------------------------
FTSH2_BDEBA      SV----------------------------------------------------------
FTSH_METPP       ------------------------------------------------------------
FTSH_RALPJ       TATGKPDQKTQGT-----------------------------------------------
FTSH_SYNFM       AA----------------------------------------------------------
FTSH_BURP1       ELRDPARKADNADHSVPQ------------------------------------------
FTSH_PIRSD       VITAPATERSG-------------------------------------------------
FTSH2_RHOBA      EETESQQSNRS-------------------------------------------------
FTSH_METCA       ------------------------------------------------------------
FTSH1_METI4      L-----------------------------------------------------------
FTSH_ACIFD       TDPVS-------------------------------------------------------
FTSH_ACIC1       DDLL--------------------------------------------------------
FTSH1_SORC5      ------------------------------------------------------------
FTSH1_SYMTH      ------------------------------------------------------------
FTSH_OPITP       ------------------------------------------------------------
FTSH3_SORC5      ------------------------------------------------------------
FTSH2_SYMTH      ------------------------------------------------------------
FTSH2_SPHTD      T-----------------------------------------------------------
FTSH3_SPHTD      ------------------------------------------------------------
FTSH2_CONWI      DA----------------------------------------------------------
FTSH_THET8       PGGALGGA----------------------------------------------------
FTSH_LEPBD       IVQTSENSIEESQENKTVEAEVHDSNLKSDTEKLAEAVREITGETGGVLEPTEKNDFDKD
FTSH_STRM9       ------------------------------------------------------------
FTSH1_ALKMQ      ------------------------------------------------------------
FTSH_LACP7       ------------------------------------------------------------
                                                                             

FTSH_MYCGE       ------------------------------------------------------------
FTSH_MYCPN       ------------------------------------------------------------
FTSH_MYCGH       ------------------------------------------------------------
FTSH_MYCPE       ------------------------------------------------------------
FTSH_UREP2       ------------------------------------------------------------
FTSH_MESFL       ------------------------------------------------------------
FTSH_MYCPU       ------------------------------------------------------------
FTSH_MYCS5       ------------------------------------------------------------
FTSH_MYCMO       ------------------------------------------------------------
FTSH_MYCA5       ------------------------------------------------------------
FTSH_MYCCR       ------------------------------------------------------------
FTSH_AYWBP       ------------------------------------------------------------
FTSH2_PHYMT      ------------------------------------------------------------
FTSH3_PHYMT      ------------------------------------------------------------
FTSH1_PHYMT      ------------------------------------------------------------
FTSH_ACHLI       ------------------------------------------------------------
FTSH2_THEPX      ------------------------------------------------------------
FTSH_AQUAE       ------------------------------------------------------------
FTSH_HYDS0       ------------------------------------------------------------
FTSH_ECOLI       ------------------------------------------------------------
FTSH_SHIFL       ------------------------------------------------------------
FTSH_ECO57       ------------------------------------------------------------
FTSH_SALTI       ------------------------------------------------------------
FTSH_SALTY       ------------------------------------------------------------
FTSH_BUCAI       ------------------------------------------------------------
FTSH_BUCAP       ------------------------------------------------------------
FTSH_BUCBP       ------------------------------------------------------------
FTSH_PHOPR       ------------------------------------------------------------
FTSH_HAEIN       ------------------------------------------------------------
FTSH_MAGMM       ------------------------------------------------------------
FTSH_CUPMC       ------------------------------------------------------------
FTSH_RICCN       ------------------------------------------------------------
FTSH_RICFE       ------------------------------------------------------------
FTSH_RICPR       ------------------------------------------------------------
FTSH_RICTY       ------------------------------------------------------------
FTSH_RICBR       ------------------------------------------------------------
FTSH_NEORI       ------------------------------------------------------------
FTSH_BARBK       ------------------------------------------------------------
FTSH_CAUVN       ------------------------------------------------------------
FTSH_ZYMMN       ------------------------------------------------------------
FTSH_HALO1       ------------------------------------------------------------
FTSH_MYXXD       ------------------------------------------------------------
FTSH4_SORC5      ------------------------------------------------------------
FTSH1_BDEBA      ------------------------------------------------------------
FTSH_ACIC5       ------------------------------------------------------------
FTSH_AKKM8       ------------------------------------------------------------
FTSH2_METI4      ------------------------------------------------------------
FTSH_LEPBJ       ------------------------------------------------------------
FTSH_BORBZ       ------------------------------------------------------------
FTSH_PELPB       ------------------------------------------------------------
FTSH_UNCTG       ------------------------------------------------------------
FTSH_SYNAS       ------------------------------------------------------------
FTSH_THET1       ------------------------------------------------------------
FTSH3_CONWI      ------------------------------------------------------------
FTSH_MARHV       ------------------------------------------------------------
FTSH_NITOC       ------------------------------------------------------------
FTSH_HAHCH       ------------------------------------------------------------
FTSH4_SPHTD      ------------------------------------------------------------
FTSH2_THERP      ------------------------------------------------------------
FTSH_PELCD       ------------------------------------------------------------
FTSH_PELPD       ------------------------------------------------------------
FTSH1_RHOBA      ------------------------------------------------------------
FTSH2_SALRM      ------------------------------------------------------------
FTSH_BACPE       PIEKDPSVEDNRSFEDDTNKKE--------------------------------------
FTSH_BACSU       --EK----------KDDTKE----------------------------------------
FTSH_STAHJ       SNGDNDQHRGHSNNEEDTGHEQSPNIDKPYNPNDPNNPSNR-------------------
FTSH_STRPN       ------------------------------------------------------------
FTSH_STRR6       ------------------------------------------------------------
FTSH_LACPL       EVSADSSVNSTANSATESATDSDVATSATGLPNAESATPSSQDDTNSQA-----------
FTSH_LACPJ       EVSADSSVNSTANSATESATDSDVATSATGLPNAESATPSSQDDTNSQA-----------
FTSH_LEUMM       DTDSTDKSETDDNNTENK------------------------------------------
FTSH_OENOE       QKRRQPRRLQLLDAVNNKFD----------------------------------------
FTSH_LACLA       EDETAE------------------------------------------------------
FTSH2_ALKMQ      VSSDKEEEKDNQDDQDNEENRKEE------------------------------------
FTSH1_THEPX      ------------------------------------------------------------
FTSH_CALBD       ------------------------------------------------------------
FTSH_RUMCH       ------------------------------------------------------------
FTSH_CLONN       AFANNTDLEEDKKEI---------------------------------------------
FTSH_VEIPT       ASSNEIK-----------------------------------------------------
FTSH_HALOH       ENNDK-------------------------------------------------------
FTSH_NATTJ       QTNDDNRPEDDEDNEEDKNKGNNDFNLKIDYNKEDKDNKDKDK-----------------
FTSH3_SYMTH      QVAPAF------------------------------------------------------
FTSH_MYCTU       HR------SGDRQ--YGSTQPDYGAPAGWHAPGWPPRSS---------HRPSYS---GEP
FTSH_MYCTA       HR------SGDRQ--YGSTQPDYGAPAGWHAPGWPPRSS---------HRPSYS---GEP
FTSH_MYCBO       HR------SGDRQ--YGSTQPDYGAPAGWHAPGWPPRSS---------HRPSYS---GEP
FTSH_MYCLE       SH------AGDRQRQHGPTQPDYGAPPGWHAPGWPPQQPPDY-WYPPEQQPSQSPYWPQP
FTSH_RHOE4       YAQPSYPQPSAPQQTPQPGTPDYGAPAGWSAPGWPPRENPSP-TYPGQQSGGYTG-GQNP
FTSH_CORGL       AGSYGTPPPADWSVPGSAGKHRSRAEEQPAEQGFPAQTPAQAPEQSPDSSGGRPNPYATP
FTSH_ROTMD       MP--------------TQQYPNYPAPPEHRP-----------------ENGTPN---QNG
FTSH_TROWT       SP--------------KRTSNRRRLPSARRP-----------------RKDSET---QE-
FTSH_BRAFD       PG--------------GEGPQIPGAPHGGEP-----------------GGGGYG---YDG
FTSH_CUTAS       LP--------------GDNPGEWEPPSDWQPPSV--------------GGGKSP---EPP
FTSH1_CONWI      PG-------------LAGGAAEMHFPERPELA----------------------------
FTSH_RUBXD       NG-------------HRG------------------------------------------
FTSH_SLAHD       VA-------------TPAAPVAPAVPEAPQPPAAPQQ-----------------------
FTSH_PORPU       ------------------------------------------------------------
FTSH_PYRYE       ------------------------------------------------------------
FTSH_GUITH       ------------------------------------------------------------
FTSH2_SYNY3      ------------------------------------------------------------
FTSH_NOSS1       ------------------------------------------------------------
FTSH1_SYNY3      ------------------------------------------------------------
FTSH_TRIEI       ------------------------------------------------------------
FTSH_CYACA       ------------------------------------------------------------
FTSH_CYAM1       ------------------------------------------------------------
FTSH_TRICV       ------------------------------------------------------------
FTSH_VAULI       ------------------------------------------------------------
FTSH_HETA2       ------------------------------------------------------------
FTSH_ECTSI       ------------------------------------------------------------
FTSH3_SYNY3      ------------------------------------------------------------
FTSH_SYNJB       ------------------------------------------------------------
FTSH1_SPHTD      ------------------------------------------------------------
FTSH1_THERP      ------------------------------------------------------------
FTSH_CHLAD       ------------------------------------------------------------
FTSH_PSELT       ------------------------------------------------------------
FTSH_THEMA       ------------------------------------------------------------
FTSH_KOSOT       ------------------------------------------------------------
FTSH2_PETMO      ------------------------------------------------------------
FTSH3_PETMO      ------------------------------------------------------------
FTSH1_PETMO      ------------------------------------------------------------
FTSH_HELPY       ------------------------------------------------------------
FTSH_HELPJ       ------------------------------------------------------------
FTSH_HELFC       ------------------------------------------------------------
FTSH_SULNB       ------------------------------------------------------------
FTSH_ATOPD       ------------------------------------------------------------
FTSH_CLOP1       ------------------------------------------------------------
FTSH_TREPA       ------------------------------------------------------------
FTSH_PARD8       ------------------------------------------------------------
FTSH_SULMD       ------------------------------------------------------------
FTSH_RHOM4       ------------------------------------------------------------
FTSH1_SALRM      ------------------------------------------------------------
FTSH_PELLD       ------------------------------------------------------------
FTSH4_SYNY3      ------------------------------------------------------------
FTSH_ACAM1       ------------------------------------------------------------
FTSH_ANAD2       ------------------------------------------------------------
FTSH2_SORC5      ------------------------------------------------------------
FTSH_PARP8       ------------------------------------------------------------
FTSH_PSEP1       ------------------------------------------------------------
FTSH2_BDEBA      ------------------------------------------------------------
FTSH_METPP       ------------------------------------------------------------
FTSH_RALPJ       ------------------------------------------------------------
FTSH_SYNFM       ------------------------------------------------------------
FTSH_BURP1       ------------------------------------------------------------
FTSH_PIRSD       ------------------------------------------------------------
FTSH2_RHOBA      ------------------------------------------------------------
FTSH_METCA       ------------------------------------------------------------
FTSH1_METI4      ------------------------------------------------------------
FTSH_ACIFD       ------------------------------------------------------------
FTSH_ACIC1       ------------------------------------------------------------
FTSH1_SORC5      ------------------------------------------------------------
FTSH1_SYMTH      ------------------------------------------------------------
FTSH_OPITP       ------------------------------------------------------------
FTSH3_SORC5      ------------------------------------------------------------
FTSH2_SYMTH      ------------------------------------------------------------
FTSH2_SPHTD      ------------------------------------------------------------
FTSH3_SPHTD      ------------------------------------------------------------
FTSH2_CONWI      ------------------------------------------------------------
FTSH_THET8       ------------------------------------------------------------
FTSH_LEPBD       SDDNEKNDDDNENSDDSSKNDSDSDDENENSDNKSEKNKKRKSNFKLPSFME--------
FTSH_STRM9       ------------------------------------------------------------
FTSH1_ALKMQ      ------------------------------------------------------------
FTSH_LACP7       ------------------------------------------------------------
                                                                             

FTSH_MYCGE       ------------------------------------------------------------
FTSH_MYCPN       ------------------------------------------------------------
FTSH_MYCGH       ------------------------------------------------------------
FTSH_MYCPE       ------------------------------------------------------------
FTSH_UREP2       ------------------------------------------------------------
FTSH_MESFL       ------------------------------------------------------------
FTSH_MYCPU       ------------------------------------------------------------
FTSH_MYCS5       ------------------------------------------------------------
FTSH_MYCMO       ------------------------------------------------------------
FTSH_MYCA5       ------------------------------------------------------------
FTSH_MYCCR       ------------------------------------------------------------
FTSH_AYWBP       ------------------------------------------------------------
FTSH2_PHYMT      ------------------------------------------------------------
FTSH3_PHYMT      ------------------------------------------------------------
FTSH1_PHYMT      ------------------------------------------------------------
FTSH_ACHLI       ------------------------------------------------------------
FTSH2_THEPX      ------------------------------------------------------------
FTSH_AQUAE       ------------------------------------------------------------
FTSH_HYDS0       ------------------------------------------------------------
FTSH_ECOLI       ------------------------------------------------------------
FTSH_SHIFL       ------------------------------------------------------------
FTSH_ECO57       ------------------------------------------------------------
FTSH_SALTI       ------------------------------------------------------------
FTSH_SALTY       ------------------------------------------------------------
FTSH_BUCAI       ------------------------------------------------------------
FTSH_BUCAP       ------------------------------------------------------------
FTSH_BUCBP       ------------------------------------------------------------
FTSH_PHOPR       ------------------------------------------------------------
FTSH_HAEIN       ------------------------------------------------------------
FTSH_MAGMM       ------------------------------------------------------------
FTSH_CUPMC       ------------------------------------------------------------
FTSH_RICCN       ------------------------------------------------------------
FTSH_RICFE       ------------------------------------------------------------
FTSH_RICPR       ------------------------------------------------------------
FTSH_RICTY       ------------------------------------------------------------
FTSH_RICBR       ------------------------------------------------------------
FTSH_NEORI       ------------------------------------------------------------
FTSH_BARBK       ------------------------------------------------------------
FTSH_CAUVN       ------------------------------------------------------------
FTSH_ZYMMN       ------------------------------------------------------------
FTSH_HALO1       ------------------------------------------------------------
FTSH_MYXXD       ------------------------------------------------------------
FTSH4_SORC5      ------------------------------------------------------------
FTSH1_BDEBA      ------------------------------------------------------------
FTSH_ACIC5       ------------------------------------------------------------
FTSH_AKKM8       ------------------------------------------------------------
FTSH2_METI4      ------------------------------------------------------------
FTSH_LEPBJ       ------------------------------------------------------------
FTSH_BORBZ       ------------------------------------------------------------
FTSH_PELPB       ------------------------------------------------------------
FTSH_UNCTG       ------------------------------------------------------------
FTSH_SYNAS       ------------------------------------------------------------
FTSH_THET1       ------------------------------------------------------------
FTSH3_CONWI      ------------------------------------------------------------
FTSH_MARHV       ------------------------------------------------------------
FTSH_NITOC       ------------------------------------------------------------
FTSH_HAHCH       ------------------------------------------------------------
FTSH4_SPHTD      ------------------------------------------------------------
FTSH2_THERP      ------------------------------------------------------------
FTSH_PELCD       ------------------------------------------------------------
FTSH_PELPD       ------------------------------------------------------------
FTSH1_RHOBA      ------------------------------------------------------------
FTSH2_SALRM      ------------------------------------------------------------
FTSH_BACPE       ------------------------------------------------------------
FTSH_BACSU       ------------------------------------------------------------
FTSH_STAHJ       ------------------------------------------------------------
FTSH_STRPN       ------------------------------------------------------------
FTSH_STRR6       ------------------------------------------------------------
FTSH_LACPL       ------------------------------------------------------------
FTSH_LACPJ       ------------------------------------------------------------
FTSH_LEUMM       ------------------------------------------------------------
FTSH_OENOE       ------------------------------------------------------------
FTSH_LACLA       ------------------------------------------------------------
FTSH2_ALKMQ      ------------------------------------------------------------
FTSH1_THEPX      ------------------------------------------------------------
FTSH_CALBD       ------------------------------------------------------------
FTSH_RUMCH       ------------------------------------------------------------
FTSH_CLONN       ------------------------------------------------------------
FTSH_VEIPT       ------------------------------------------------------------
FTSH_HALOH       ------------------------------------------------------------
FTSH_NATTJ       ------------------------------------------------------------
FTSH3_SYMTH      ------------------------------------------------------------
FTSH_MYCTU       APTYPGQ--------------------PYPT-----------GQADPGS--DESSAEQDD
FTSH_MYCTA       APTYPGQ--------------------PYPT-----------GQADPGS--DESSAEQDD
FTSH_MYCBO       APTYPGQ--------------------PYPT-----------GQADPGS--DESSAEQDD
FTSH_MYCLE       APSYPGQA-----------------PPPYPSYPPCPS-YPPPGQSAPDA--GKPPAQLDE
FTSH_RHOE4       TPPNQSQGQYGQPQHGQPQPDQGQYGQPHPGQQAYPE-QPHPGRRYPAQ--PDYPVQYPD
FTSH_CORGL       TASGEHPGMKAYGFGDSELMDQSTGAEHTPGNVSQESPTEMIGFRLPDHERSDYPEKAQK
FTSH_ROTMD       AENERG------------------------------------------------------
FTSH_TROWT       ------------------------------------------------------------
FTSH_BRAFD       SAGTDGT-----------------------------------GR----------------
FTSH_CUTAS       SPTHPGE-----------------------------------GPQPPSNGNPWGPPRS--
FTSH1_CONWI      ------------------------------------------------------------
FTSH_RUBXD       ------------------------------------------------------------
FTSH_SLAHD       ------------------------------------------------------------
FTSH_PORPU       ------------------------------------------------------------
FTSH_PYRYE       ------------------------------------------------------------
FTSH_GUITH       ------------------------------------------------------------
FTSH2_SYNY3      ------------------------------------------------------------
FTSH_NOSS1       ------------------------------------------------------------
FTSH1_SYNY3      ------------------------------------------------------------
FTSH_TRIEI       ------------------------------------------------------------
FTSH_CYACA       ------------------------------------------------------------
FTSH_CYAM1       ------------------------------------------------------------
FTSH_TRICV       ------------------------------------------------------------
FTSH_VAULI       ------------------------------------------------------------
FTSH_HETA2       ------------------------------------------------------------
FTSH_ECTSI       ------------------------------------------------------------
FTSH3_SYNY3      ------------------------------------------------------------
FTSH_SYNJB       ------------------------------------------------------------
FTSH1_SPHTD      ------------------------------------------------------------
FTSH1_THERP      ------------------------------------------------------------
FTSH_CHLAD       ------------------------------------------------------------
FTSH_PSELT       ------------------------------------------------------------
FTSH_THEMA       ------------------------------------------------------------
FTSH_KOSOT       ------------------------------------------------------------
FTSH2_PETMO      ------------------------------------------------------------
FTSH3_PETMO      ------------------------------------------------------------
FTSH1_PETMO      ------------------------------------------------------------
FTSH_HELPY       ------------------------------------------------------------
FTSH_HELPJ       ------------------------------------------------------------
FTSH_HELFC       ------------------------------------------------------------
FTSH_SULNB       ------------------------------------------------------------
FTSH_ATOPD       ------------------------------------------------------------
FTSH_CLOP1       ------------------------------------------------------------
FTSH_TREPA       ------------------------------------------------------------
FTSH_PARD8       ------------------------------------------------------------
FTSH_SULMD       ------------------------------------------------------------
FTSH_RHOM4       ------------------------------------------------------------
FTSH1_SALRM      ------------------------------------------------------------
FTSH_PELLD       ------------------------------------------------------------
FTSH4_SYNY3      ------------------------------------------------------------
FTSH_ACAM1       ------------------------------------------------------------
FTSH_ANAD2       ------------------------------------------------------------
FTSH2_SORC5      ------------------------------------------------------------
FTSH_PARP8       ------------------------------------------------------------
FTSH_PSEP1       ------------------------------------------------------------
FTSH2_BDEBA      ------------------------------------------------------------
FTSH_METPP       ------------------------------------------------------------
FTSH_RALPJ       ------------------------------------------------------------
FTSH_SYNFM       ------------------------------------------------------------
FTSH_BURP1       ------------------------------------------------------------
FTSH_PIRSD       ------------------------------------------------------------
FTSH2_RHOBA      ------------------------------------------------------------
FTSH_METCA       ------------------------------------------------------------
FTSH1_METI4      ------------------------------------------------------------
FTSH_ACIFD       ------------------------------------------------------------
FTSH_ACIC1       ------------------------------------------------------------
FTSH1_SORC5      ------------------------------------------------------------
FTSH1_SYMTH      ------------------------------------------------------------
FTSH_OPITP       ------------------------------------------------------------
FTSH3_SORC5      ------------------------------------------------------------
FTSH2_SYMTH      ------------------------------------------------------------
FTSH2_SPHTD      ------------------------------------------------------------
FTSH3_SPHTD      ------------------------------------------------------------
FTSH2_CONWI      ------------------------------------------------------------
FTSH_THET8       ------------------------------------------------------------
FTSH_LEPBD       ------------------------------------------------------------
FTSH_STRM9       ------------------------------------------------------------
FTSH1_ALKMQ      ------------------------------------------------------------
FTSH_LACP7       ------------------------------------------------------------
                                                                             

FTSH_MYCGE       ------------------------------------------------------
FTSH_MYCPN       ------------------------------------------------------
FTSH_MYCGH       ------------------------------------------------------
FTSH_MYCPE       ------------------------------------------------------
FTSH_UREP2       ------------------------------------------------------
FTSH_MESFL       ------------------------------------------------------
FTSH_MYCPU       ------------------------------------------------------
FTSH_MYCS5       ------------------------------------------------------
FTSH_MYCMO       ------------------------------------------------------
FTSH_MYCA5       ------------------------------------------------------
FTSH_MYCCR       ------------------------------------------------------
FTSH_AYWBP       ------------------------------------------------------
FTSH2_PHYMT      ------------------------------------------------------
FTSH3_PHYMT      ------------------------------------------------------
FTSH1_PHYMT      ------------------------------------------------------
FTSH_ACHLI       ------------------------------------------------------
FTSH2_THEPX      ------------------------------------------------------
FTSH_AQUAE       ------------------------------------------------------
FTSH_HYDS0       ------------------------------------------------------
FTSH_ECOLI       ------------------------------------------------------
FTSH_SHIFL       ------------------------------------------------------
FTSH_ECO57       ------------------------------------------------------
FTSH_SALTI       ------------------------------------------------------
FTSH_SALTY       ------------------------------------------------------
FTSH_BUCAI       ------------------------------------------------------
FTSH_BUCAP       ------------------------------------------------------
FTSH_BUCBP       ------------------------------------------------------
FTSH_PHOPR       ------------------------------------------------------
FTSH_HAEIN       ------------------------------------------------------
FTSH_MAGMM       ------------------------------------------------------
FTSH_CUPMC       ------------------------------------------------------
FTSH_RICCN       ------------------------------------------------------
FTSH_RICFE       ------------------------------------------------------
FTSH_RICPR       ------------------------------------------------------
FTSH_RICTY       ------------------------------------------------------
FTSH_RICBR       ------------------------------------------------------
FTSH_NEORI       ------------------------------------------------------
FTSH_BARBK       ------------------------------------------------------
FTSH_CAUVN       ------------------------------------------------------
FTSH_ZYMMN       ------------------------------------------------------
FTSH_HALO1       ------------------------------------------------------
FTSH_MYXXD       ------------------------------------------------------
FTSH4_SORC5      ------------------------------------------------------
FTSH1_BDEBA      ------------------------------------------------------
FTSH_ACIC5       ------------------------------------------------------
FTSH_AKKM8       ------------------------------------------------------
FTSH2_METI4      ------------------------------------------------------
FTSH_LEPBJ       ------------------------------------------------------
FTSH_BORBZ       ------------------------------------------------------
FTSH_PELPB       ------------------------------------------------------
FTSH_UNCTG       ------------------------------------------------------
FTSH_SYNAS       ------------------------------------------------------
FTSH_THET1       ------------------------------------------------------
FTSH3_CONWI      ------------------------------------------------------
FTSH_MARHV       ------------------------------------------------------
FTSH_NITOC       ------------------------------------------------------
FTSH_HAHCH       ------------------------------------------------------
FTSH4_SPHTD      ------------------------------------------------------
FTSH2_THERP      ------------------------------------------------------
FTSH_PELCD       ------------------------------------------------------
FTSH_PELPD       ------------------------------------------------------
FTSH1_RHOBA      ------------------------------------------------------
FTSH2_SALRM      ------------------------------------------------------
FTSH_BACPE       ------------------------------------------------------
FTSH_BACSU       ------------------------------------------------------
FTSH_STAHJ       ------------------------------------------------------
FTSH_STRPN       ------------------------------------------------------
FTSH_STRR6       ------------------------------------------------------
FTSH_LACPL       ------------------------------------------------------
FTSH_LACPJ       ------------------------------------------------------
FTSH_LEUMM       ------------------------------------------------------
FTSH_OENOE       ------------------------------------------------------
FTSH_LACLA       ------------------------------------------------------
FTSH2_ALKMQ      ------------------------------------------------------
FTSH1_THEPX      ------------------------------------------------------
FTSH_CALBD       ------------------------------------------------------
FTSH_RUMCH       ------------------------------------------------------
FTSH_CLONN       ------------------------------------------------------
FTSH_VEIPT       ------------------------------------------------------
FTSH_HALOH       ------------------------------------------------------
FTSH_NATTJ       ------------------------------------------------------
FTSH3_SYMTH      ------------------------------------------------------
FTSH_MYCTU       E-----------------------VSRTKP-AHG--------------------
FTSH_MYCTA       E-----------------------VSRTKP-AHG--------------------
FTSH_MYCBO       E-----------------------VSRTKP-AHG--------------------
FTSH_MYCLE       G-----------------------VSPSNPPAHG--------------------
FTSH_RHOE4       GGPFADPNRGNPSGENQWQSPTPEQPQTPPPHHSAEDDGPSTARWDGPDGSR--
FTSH_CORGL       E-----------SVLDASETTEMPVVPDQPIDGDSGKSAEGTQENPENEGDNRG
FTSH_ROTMD       ------------------------------------------------------
FTSH_TROWT       ------------------------------------------------------
FTSH_BRAFD       ------------------------------------------------------
FTSH_CUTAS       ------------------------------------------------------
FTSH1_CONWI      ------------------------------------------------------
FTSH_RUBXD       ------------------------------------------------------
FTSH_SLAHD       ------------------------------------------------------
FTSH_PORPU       ------------------------------------------------------
FTSH_PYRYE       ------------------------------------------------------
FTSH_GUITH       ------------------------------------------------------
FTSH2_SYNY3      ------------------------------------------------------
FTSH_NOSS1       ------------------------------------------------------
FTSH1_SYNY3      ------------------------------------------------------
FTSH_TRIEI       ------------------------------------------------------
FTSH_CYACA       ------------------------------------------------------
FTSH_CYAM1       ------------------------------------------------------
FTSH_TRICV       ------------------------------------------------------
FTSH_VAULI       ------------------------------------------------------
FTSH_HETA2       ------------------------------------------------------
FTSH_ECTSI       ------------------------------------------------------
FTSH3_SYNY3      ------------------------------------------------------
FTSH_SYNJB       ------------------------------------------------------
FTSH1_SPHTD      ------------------------------------------------------
FTSH1_THERP      ------------------------------------------------------
FTSH_CHLAD       ------------------------------------------------------
FTSH_PSELT       ------------------------------------------------------
FTSH_THEMA       ------------------------------------------------------
FTSH_KOSOT       ------------------------------------------------------
FTSH2_PETMO      ------------------------------------------------------
FTSH3_PETMO      ------------------------------------------------------
FTSH1_PETMO      ------------------------------------------------------
FTSH_HELPY       ------------------------------------------------------
FTSH_HELPJ       ------------------------------------------------------
FTSH_HELFC       ------------------------------------------------------
FTSH_SULNB       ------------------------------------------------------
FTSH_ATOPD       ------------------------------------------------------
FTSH_CLOP1       ------------------------------------------------------
FTSH_TREPA       ------------------------------------------------------
FTSH_PARD8       ------------------------------------------------------
FTSH_SULMD       ------------------------------------------------------
FTSH_RHOM4       ------------------------------------------------------
FTSH1_SALRM      ------------------------------------------------------
FTSH_PELLD       ------------------------------------------------------
FTSH4_SYNY3      ------------------------------------------------------
FTSH_ACAM1       ------------------------------------------------------
FTSH_ANAD2       ------------------------------------------------------
FTSH2_SORC5      ------------------------------------------------------
FTSH_PARP8       ------------------------------------------------------
FTSH_PSEP1       ------------------------------------------------------
FTSH2_BDEBA      ------------------------------------------------------
FTSH_METPP       ------------------------------------------------------
FTSH_RALPJ       ------------------------------------------------------
FTSH_SYNFM       ------------------------------------------------------
FTSH_BURP1       ------------------------------------------------------
FTSH_PIRSD       ------------------------------------------------------
FTSH2_RHOBA      ------------------------------------------------------
FTSH_METCA       ------------------------------------------------------
FTSH1_METI4      ------------------------------------------------------
FTSH_ACIFD       ------------------------------------------------------
FTSH_ACIC1       ------------------------------------------------------
FTSH1_SORC5      ------------------------------------------------------
FTSH1_SYMTH      ------------------------------------------------------
FTSH_OPITP       ------------------------------------------------------
FTSH3_SORC5      ------------------------------------------------------
FTSH2_SYMTH      ------------------------------------------------------
FTSH2_SPHTD      ------------------------------------------------------
FTSH3_SPHTD      ------------------------------------------------------
FTSH2_CONWI      ------------------------------------------------------
FTSH_THET8       ------------------------------------------------------
FTSH_LEPBD       ------------------------------------------------------
FTSH_STRM9       ------------------------------------------------------
FTSH1_ALKMQ      ------------------------------------------------------
FTSH_LACP7       ------------------------------------------------------