CLUSTAL format seed alignment for MF_01460

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CPCTL_NOSS1           ----------------------------------------MSFSPQLVNLGNYLAGEFDN
Q3M4B0_TRIV2          ----------------------------------------MSFSPQLVNLGNYLAGEFDN
B2J352_NOSP7          ----------------------------------------MNFSPQLIALGEYLAGEFDN
CPXT2_MICAN           ------------------------------------------MTPELITFGRYLAGEFEN
A8YFD2_MICAE          ------------------------------------------MTPELITFGRYLAGEFEN
B7KI39_GLOC7          --------------------------------------MTNQFTPELMALGQYLAGEFEN
B4WPI1_SYNS7          -----------------------------------------MPSSPLITLASYLAGEFEN
Q31Q65_SYNE7          -------------------------------------------MDDLQYLWTLLSGEFSN
A0A0H3K495_SYNP6      -------------------------------------------MDDLQYLWTLLSGEFSN
CPCT_NOSS1            ----------------------------------------MTHSTDIATLARWMAADFSN
Q3M9Z2_TRIV2          ----------------------------------------MTHSTDIATLARWMAADFSN
D7DXH5_NOSA0          ----------------------------------------MTHSTDIATLARWMAADFSN
B4VQD5_9CYAN          ----------------------------------------MTHSTDIATLARWMAADFSN
B2J9J7_NOSP7          ----------------------------------------MTHSTDIATLARWMSADFSN
CPXT_THEEB            ----------------------------------------MTHATDVLTLGRWMAADFSN
B8HS07_CYAP4          ----------------------------------------MTSATDIATLARWMAADFSN
CPXT2_TRIEI           ----------------------------------------MTHSTDITTLARWFAADFSN
D4ZZG1_ARTPN          ----------------------------------------MTHATDILTLGRWLASDFSN
Q31Q37_SYNE7          ----------------------------------------MTHATDVLTLARWLAADFSN
A0A0H3K745_SYNP6      ----------------------------------------MTHATDVLTLARWLAADFSN
CPXT1_MICAN           ----------------------------------------MTHPTDIKTLARWMAADFSN
A8YKN3_MICAE          ----------------------------------------MTHSTDIKTLARWMAADFSN
B7KHW5_GLOC7          ----------------------------------------MTHATDIKTLARWMAADFSN
B1WWK6_CROS5          ----------------------------------------MSHATDIKTLARWMCSDFSN
B7K4H8_RIPO1          ----------------------------------------MSHSTDLSTLARWMSADFSN
CPXT_SYNY3            ----------------------------------------MSHSTDLSALARWMAADFSN
B4WGJ8_SYNS7          ----------------------------------------MTHSTDVATLTQWMAAEFSN
A8ZML5_ACAM1          ----------------------------------------MTHSTDSYTLAKWLAAEFSN
CPCT_SYNP2            ----------------------------------------MSHSTDAHTLARWMAGEFSN
CPXT2_GLOVI           -----------------------------------------MSSHNLVTLVSWLAGDFSN
CPXT2_SYNJA           --------------------------------------MESTSSPELLQMARWLAGDFSN
Q2JI96_SYNJB          --------------------------------------MDRTPSPELLQMARWLAGDFSN
CPXT3_SYNJA           ----------------------------------------MSVSPQLAQLATWMAGHFNN
Q2JMN1_SYNJB          ----------------------------------------MSVSPQLAQLATWMAGHFNN
CPET_MICDP            -------------------------------MTSSLPKIPDTVSPNLITLARWMAGDFSN
A5HIW7_9CYAN          -------------------------------MTSSLPKIPDTVSPNLITLARWMAGDFSN
B2J9J1_NOSP7          --------------------------------MTIAPSESSSNASDLLTLACWMSGDFSN
B7KLW5_GLOC7          -----------------------------------------MSNSLLLDLARCMAGDFSN
B7K6L4_RIPO1          ----------------------------------------MLKDQLMLTLAHWLAGDFSN
CPXT3_GLOVI           --------------------------------------MTTAPSEDLLTLARWMAGDFSN
B4WGJ6_SYNS7          --------------------------------MTAPMAVPNSISSDLVTLSTWMAGDFSN
CPXT1_TRIEI           --------------------------------MITSNFKTQENVSQAITLASWLAGEYSS
CPXT_PROM1            -----------------------------------------MKKKPTLEFAKIVSGVFSN
Q46H68_PROMT          -----------------------------------------MKKNPTIEFAKIVSGVFSN
A9BDV8_PROM4          --------------------------------------MDYSEETTAKSFAKIFSGHFTN
Q3AWC8_SYNS9          -----------------------------------------MKIEQQLRFARTLAGIYDN
Q0ICT6_SYNS3          -------------------------------------------MESILKFAQTISGIYDN
Q7U4R1_SYNPX          ----------------------------------------MRNYSAIADFAKTLAGTFDN
Q3AMG6_SYNSC          ----------------------------------------MDKNLALAEFAKTLAGVYDN
A5GVN6_SYNR3          ------------------------------------MKAEETHSSLILSFAKTLCGEYDN
A5GJ09_SYNPW          ---------------------------------------MSSSTNDLLRFAKTLAGHYSN
Q7V594_PROMM          ------MPIISSTNIRRLRRPANIFCLGSTQAKKLKDQQKKMRQSSLLRFAKTLAAHYSN
CPXT_SYNPY            ------------------------------------------MTATIGHFLQNLCGEYSN
Q0ICV8_SYNS3          ------------------------------------------MTATIGNFLKNLCGEYSN
CPXT_SYNPZ            -----------------------------------------MITPNVRRFLNLLCGEYSN
A5GIY9_SYNPW          -----------------------------------------MINPTIRRFLSLLCGEYSN
W0GRS9_9SYNE          -----------------------------------------MITPNIRRFLNLLCGEFSN
Q7U4P3_SYNPX          ------------------------------------------MTPTEQNFLSLLCGEYSN
Q3AMI7_SYNSC          --------------------------MGGFFIVQTAWARILKMTPTEQNFLSLLCGEYSN
Q3AUU1_SYNS9          --------------------------------------MNATITPTVRRFLTLLCGEYSN
CPXT_PAUCH            ------------------------------------------MSASLSQLVHQLSARFNN
B5IPJ8_9CYAN          --------------------------------------MVIGTASSLSRLVQLLCAGFSN
A5GVM7_SYNR3          ------------------------------------------MTNSLDRLTRWLCGSFSN
CPXT1_SYNJA           ---------------MRITLGSRNPEDRRSSFLHMTASAAATSDSDLNTFADWLEGYYSN
Q2JNQ9_SYNJB          -------------------------------------MVDEKSASDLHTLANWLEGYYSN
CPXT4_GLOVI           -------------------------------------------MSDWQTVRTWLAGTYSN
CPXT3_MICAN           MLKTS-----------------IALGFFLT--------QSLPLNPQVQGVANHLIGVMDT
A8YDV9_MICAE          MLKTS-----------------IALGFFLT--------QSLPLNPQVQGVANHLIGVMDT
B7KLF4_GLOC7          MRQQT-----------------LTIGLLVSYLLTTASAQAVPVQTHINSVVSHLVGVMDT
CPXT1_GLOVI           MLSSGQSESLNQPMRMVICCLLLSTGLLAAVPSPAEQNALPATERQVEEVVTRLTGIMTT
                                                                       .   . .   .

CPCTL_NOSS1           REQALGEPIWFVHLRLWQRPVDLFS------DDSITLFAEQANIVNLDRPYRQRILRLMP
Q3M4B0_TRIV2          REQALGEPIWFVHLRLWQRPVGLFS------DDSITLFAEQANIVNLDRPYRQRILRLMP
B2J352_NOSP7          REQAIEEPVWYVHLRMWQRPVNLFT------EDSITLFAEQASVINLDKPYRQRIMRLRQ
CPXT2_MICAN           QRQAQAEPVWYVHLRLWLRPLPLFR------EDSIALFAEQASIINLDQPYRPRLWRLTH
A8YFD2_MICAE          QRQAQAEPVWYVHLRLWLRPLPLFR------EDSIALFAEQASIINLDQPYRPRLWRLTR
B7KI39_GLOC7          RQQALASPAWFVHLRLWLRPVPLFR------EDSITLFAEQASLVNLDQPYRPRLWRLRQ
B4WPI1_SYNS7          QRQAAAEPAWYVHLRLWQRPIQALSS-----EQKFTFLLEQQNVISGQPPYRQRILQITD
Q31Q65_SYNE7          QPQAIAEPVHFVQLRLWQRPLLLFG------HDRPCLFLEQANALQLDRPYRQRLLCL--
A0A0H3K495_SYNP6      QPQAIAEPVHFVQLRLWQRPLLLFG------HDRPCLFLEQANALQLDRPYRQRLLCL--
CPCT_NOSS1            QAQAFENPPFYAHIRVCMRPLPWEVLS------GVGFFVEQAYDYMLNDPYRLRVLKLMI
Q3M9Z2_TRIV2          QAQAFENPPFYAHIRVCMRPLPWEVLS------GVGFFVEQAYDYMLNDPYRLRVLKLMT
D7DXH5_NOSA0          QAQVFENPAFFAHIRVCMRPLPYLLLS------GVSLFVEQAYDYMLNDPYRLRVLKLMT
B4VQD5_9CYAN          QQQAFDNPPFYAHIRVFMRPLPASLLD------GVSFFVEQAYDYLLNAPYRLRVLKLMV
B2J9J7_NOSP7          QEQAFENPPFYAHIRVCIRPLPLELFS------GVSLFLEQAYDFMLNQPYRMRVMKLIP
CPXT_THEEB            QAQAFENPPFYAHIRVCMRPLPRGVLE------GIALYVEQAYDYLLSVPYRTRVLELMP
B8HS07_CYAP4          QEQAFENPPLYAHIRVCMRPVPAGILS------GFGFFVEQAYDFELHYPYRVRVLELVT
CPXT2_TRIEI           QQQAFDNPPLFAHIRVCMRPLPYQLLN------GLSLYLEQAYDITLNQPYRVRVLKLVP
D4ZZG1_ARTPN          QPQAFENPPFFAHIRVCMRPLPWELLN------GLSLYLEQAYDINLKQPYRVRVLKLIP
Q31Q37_SYNE7          QAQAFENPPFFAHIRVCMRPLALEVLD------GLSLYVEQAYDLDVNQPYRARVLKLVP
A0A0H3K745_SYNP6      QAQAFENPPFFAHIRVCMRPLALEVLD------GLSLYVEQAYDLDVNQPYRARVLKLVP
CPXT1_MICAN           QEQAFANPPFFAHIRVCMRPLPDELLN------GTSLFLEQAYDFMLNTPYRLRVFKLSL
A8YKN3_MICAE          QEQAFANPPFFAHIRVCMRPLPDELLK------GTSLFLEQAYDFMLNTPYRLRVFKLSV
B7KHW5_GLOC7          QEQAWANPPLYAHIRVCMRPLSHDVLG------GTSLFLEQAYDFMLNSPYRLRVLKFIV
B1WWK6_CROS5          QEQAFENPPFYAHIRVCIRPLPLSNFP------EPSLFLEQAYDYALNQPYRIRVLKLNI
B7K4H8_RIPO1          QEQAYENPPFFAHIRVCIRPLPLSVFP------EPTLFLEQAYDFMLNQPYRLRVFRFNI
CPXT_SYNY3            QAQAFENPPFYAHIRVAIRPLDQAKFG------DRLLFLEQAYDFMLQRPYRLRVLKLKV
B4WGJ8_SYNS7          QEQAFENPPFFAHIKVCMRPLPKSFQP------GVSLYLEQAYSFQLDKPYRVRVLHFIQ
A8ZML5_ACAM1          QAQAIENPPLYAHIQVSIRPLPRKLLT------GYCLYLEQAYAFMLKKPYRTRVIHILE
CPCT_SYNP2            EAQALANPPLWAHIKVCMRPLPNQFFD------GYGLYLEQAYSSDTSAPYRLRLFHIKP
CPXT2_GLOVI           REQAWDAPAFFSHIRLCMRPLPWQVFE------GYGLYSEQADDYDWAHPYRIVVLNLVE
CPXT2_SYNJA           QEQAWENPPFFASIRVAYRPLPTAVLG------GIGFYVEQAYSGHLEEPYRQAVVELTQ
Q2JI96_SYNJB          QEQAWENPPFFAQIRVAYRPLPAHVLG------GIGFYVEQAYSGHLEDPYRQAVVELTQ
CPXT3_SYNJA           LHQAIAEPVWFANIHVYQCPLPWSVFQ------GIGFYVEQLYDIYPDQPYRQRVIHLFE
Q2JMN1_SYNJB          LQQAIAEPVWFANIHVYQCPLPWSVLQ------GVGFYVEQLYDIYPEQPYRQRVIHLFD
CPET_MICDP            YQQAFENSKDYAHIHVFFRPLPFEFF------SGIGLYSEQVYDYDLWRPYRQGVHRLID
A5HIW7_9CYAN          YQQAFENSKDYAHIHVFFRPLPFEFF------SGIGLYSEQVYDYDLWRPYRQGVHRLID
B2J9J1_NOSP7          YKQSFANPQLYAHIHIFFRPLPIEFF------SAIGFYSEQAYDHDLWTPYRQGVHKLVD
B7KLW5_GLOC7          YQQSSQNPQDFAHIRIFFRPLPFDFF------GGIGFYSEQTYDYDLWTPYRQGIHRLIV
B7K6L4_RIPO1          QKQAAENPKDYPHIRVFFRPLPWDFF------EGIGFYSEQAYDYDLWSPYRQGVHRFVP
CPXT3_GLOVI           QKQALAQPQTFAHIRVFFRPLPFAFF------GTVGFYSEQTYDYDLWSPYRQGLHRLLD
B4WGJ6_SYNS7          FKQADAALTDFAHIRIFFRPLPYEFFETLGLPGGIGFYSEQVYDYDLWSPYRQGLHRVVP
CPXT1_TRIEI           IKYTLEDARTNPHIRIFFRPLPYDFF------GGIGFYSEEIYDHDPWHPHYQFVKRVIP
CPXT_PROM1            KEQALNNPKKFAHIQIHIRPLFFKTY------NCFAFYSEQRYQHDIWNPYRQSINKLS-
Q46H68_PROMT          KEQALNNPKKFAHIQIHIRPLFFKTY------NCFAFYSEQRYQHDIWNPYRQSINKLS-
A9BDV8_PROM4          KQQANKYPKDFAHINIFVRPLEFKLF------DSLSFYSEQSYDHSPWSPYRQAVQKIN-
Q3AWC8_SYNS9          YEQAQVNPKDFARINIVFRPLPWEIF------EGPGFYSEQFYDYARWNPYRQGIHRL--
Q0ICT6_SYNS3          FAQSQENPKDFARINIIFRPLPWKIF------NGPGFYSEQHYDYAPWSPYRQGIHRLIN
Q7U4R1_SYNPX          INQAQENPKDFARIKIFFRPLPWRIF------RGPGFYSEQCYDYAPWDPYRQGIHRL--
Q3AMG6_SYNSC          IEQSQKDPKDFARINIFFRPLPWHIF------EGPGFYSEQCYDYAPWDPYRQGIHRL--
A5GVN6_SYNR3          LKQSQENPKDFARINIFFRPLPWGIM------KGPGFYSEQCYDYAPWNPYRQGIHRV--
A5GJ09_SYNPW          RKQAQNNPKDFAHINIFFRPLPWEVL------NAPGFYSEQSYDHAPWSPYRQGVHRLL-
Q7V594_PROMM          KEQAQKDPIHFARINIYFRPLLWDVF------KGPGYYSEQSYDYDPWRPYRQGVHKL--
CPXT_SYNPY            QKQAFENPPLFAHIFLRYKPIEHLQPG--------SILLEQTYAVDPKHPYRLRVIRAEE
Q0ICV8_SYNS3          QKQAFDNPPLFAHIFLRYKPIEHLQPG--------SILLEQTYAVDPKHPYRLRVIRAEE
CPXT_SYNPZ            QQQAFDNPPLYAHIFLRYRSLPQLKPG--------SILLEQTYAVDPKNPYRLRMIRAEE
A5GIY9_SYNPW          QQQAFDNPPLYAHIFLRYRPLPQLTPG--------SILLEQTYAVDPNTPYRLRMIRAEE
W0GRS9_9SYNE          QQQAFDNPPLYAHIFLRYRPLIQLRPG--------SILLEQTYAVDPKHPYRLRMIRAEE
Q7U4P3_SYNPX          QQQALDNPPFFAHIFLRYRPLEHLQPG--------SILLEQSYAVDPKNPYRLRMIRAEE
Q3AMI7_SYNSC          QQQALDNPPFFAHIFLRYRPLEHLQEG--------SILLEQSYAVDPKHPYRLRMIRAEE
Q3AUU1_SYNS9          EQQAFDNPPFFAHIYLRYRPLEQLQPG--------SILLEQTYAVDPKNPYRLRMIRAEE
CPXT_PAUCH            QQQAFDNPPLYAHIVVNCRPLVHLLPG--------SLLIEQSYAMDPLKPYRIRVLRAQT
B5IPJ8_9CYAN          QQQAFDNPPLYAHILVKMRPLPQLAPG--------SLLLEQSYAINPAAPYRIRVLRAER
A5GVM7_SYNR3          QQQAFENPPLYGHIHVRYRPLGQLAPR--------SMLIEQAYAITPKEPYRIRVVRPLL
CPXT1_SYNJA           RAQAMAEPVWFVPVSLWYVRLPHLFSE------GIGFFTEQFNEHTPGRFYRSRVLQVLA
Q2JNQ9_SYNJB          RTQAMAEPVWFVPVSLWYVRLPHLFSE------GIGFFTEQFNQHTPGQFYRSRVLQVLG
CPXT4_GLOVI           RAQAMAEPVWFIPVTLWYVEVAGLFGE------GAGFFTEQVSEHTPNQPYRSRVLQLLD
CPXT3_MICAN           REQAQTNPR-IAKVQMTTCAVDFSP-----KQDSIYLYQEQAIIDRLNQPYRQRILVIQP
A8YDV9_MICAE          TQQAQTNPR-IAKVQMTTCAVDFSP-----KQDNIYLYQEQAIIDRLNQPYRQRILVIQP
B7KLF4_GLOC7          SAQVAKNPN-KANVRMTTCQVTLTG-----GNDSIYLYQEQALTKTLDKPYRQRFLEIKP
CPXT1_GLOVI           TQQAQSDAA-RPDVRMTTCSVQLEGD----KSKAIYLYQEQTMSNNLGAPYRQRLLRIAA
                                   : :    :                  *:         :   .     

CPCTL_NOSS1           APDS-ETGLYVQYYMPKN--PSALIGAGRHPDL--------LKTLTPQQLELL--PGCVL
Q3M4B0_TRIV2          APDS-ETGLYVQYYMPKN--PSALVGAGRHPEL--------LKTLTPQQLELL--PGCVL
B2J352_NOSP7          GSNS-DTSLEVQYYIPQD--PDALRGAGNNPAL--------LNTLSAKQLDLL--PGCVL
CPXT2_MICAN           SE---SGGLEVRHYMFND--LKSVQGAGKNPDI--------LRKISLEDLTFL--PTCTL
A8YFD2_MICAE          SE---SGGLEVRHYMFND--LKSVQGAGKNPDI--------LRKISLEDLTFL--PTCTL
B7KI39_GLOC7          ISGS-SVALQVEHYKFKD--IKEVQGAGRNREI--------LQQISLEQIEPLTTPGCTL
B4WPI1_SYNS7          SAE--VNQLEGQYFALKD--PSRYKGAGQDPKI--------LKGISQKDLVTLPNSGAVI
Q31Q65_SYNE7          EADF-SGQLSAQFYQFKN--AAAVLGAGQDPDR--------LRSLTPEDVQLL--ESCRL
A0A0H3K495_SYNP6      EADF-SGQLSAQFYQFKN--AAAVLGAGQDPDR--------LRSLTPEDVQLL--ESCRL
CPCT_NOSS1            V----GDRIHIENYTVKQ--EENFYGASRDLNR--------LQTLTSESLEKL--PGCNM
Q3M9Z2_TRIV2          V----GDRIHIENYIVKQ--EENFYGASRDLNR--------LKTLTSESLEKL--PGCNM
D7DXH5_NOSA0          A----GNKIHIENYTVKD--EKDFYGASRDLER--------LHKLTSDHLEKL--SGCNM
B4VQD5_9CYAN          V----GDHIEIENYTVKE--PEKFYGASRDLNR--------LQTLTTDQLDKL--PGCNM
B2J9J7_NOSP7          A----ENHIAIEHYTVKE--EQKFYGASREPER--------LKDLSVDQLEKM--SGCNM
CPXT_THEEB            A----NDHIVIKNYVLKD--EKRFFGAARDRQR--------LQAMTADDLELL--CGCNM
B8HS07_CYAP4          V----DGHIEIKNYSLKD--DKAFFGAARNPER--------LSQLSPDQLVLL--PGCNM
CPXT2_TRIEI           S----ENHIEIENYIIDQ--EAEFYGASRDPQR--------LKNLKTEYIKKL--PGCTF
D4ZZG1_ARTPN          V----DDHIEIENYEIDG--QEEFYGASREVDR--------LKALKREQLNKR--CGCTF
Q31Q37_SYNE7          A----GDHIEIENFRVID--GEDLFGASRDRDR--------LAKLTRDRLEKL--PGCTF
A0A0H3K745_SYNP6      A----GDHIEIENFRVID--GEDLFGASRDRDR--------LAKLTRDRLEKL--PGCTL
CPXT1_MICAN           V----DDHIELENFKVKE--EANFFGASREPQR--------LKNLTLDLLEPM--LGCDM
A8YKN3_MICAE          V----DDHIELENFKVKE--EANFFGASREPQR--------LKNLSLELLEPM--PGCDM
B7KHW5_GLOC7          V----DDRIELENYKVKE--QEQFFGAARDPKR--------LQTLTIDHLEKL--PGCDM
B1WWK6_CROS5          V----EERIELENYKLKD--KETFLGASREPEK--------LKKLTPNDIELM--QGCDM
B7K4H8_RIPO1          I----DGRIELENYKVQE--EASFFGASRDLEK--------LRKLTPDHLEKM--PGCDM
CPXT_SYNY3            V----EDHIEIENFKVKD--EEKFYGAARDLGK--------LAQLTPADLEPM--HGCDM
B4WGJ8_SYNS7          R----EDDVLLENYKVKD--EEKFYGAARDLEK--------LATLSVDDLEPM--MGCDI
A8ZML5_ACAM1          H----KDSILIENYELHK--KELFLGGTRDPLI--------LNKISTEHLIKK--EGCDM
CPCT_SYNP2            V----DDHMELVHYKPKDDAKTKYMGAARNPAM--------MQHFDMADLDPM--PGCDM
CPXT2_GLOVI           Q---PDGIIECRNYALKD--TAPYLGAAREAERA------RLHRLTPEQLEPL--PGCTF
CPXT2_SYNJA           V----GDGIVIRNYRPLQ--PQRWRGCARGR-------AEQLSQLSAADLAYL--PGCDV
Q2JI96_SYNJB          A----SAGIVIRNYRPLE--PQRWRGCARER-------ADQLSQLQAADLAYL--EGCDV
CPXT3_SYNJA           T----PDGIRIQNYALGS--PEAYKCAGRDL--------GKLASLAAAELELL--PGCAV
Q2JMN1_SYNJB          T----PDGIRIQNYALTA--PDSYRCAGRELLLSNAYAKGKLAGLTAAELELL--PGCVT
CPET_MICDP            ---K-GDEIYIENYSLKQ--ALYYAGAARDLNI--------LKTITPNCIERR--YHCSM
A5HIW7_9CYAN          ---K-GDEIYIENYSLKQ--ALYYAGAARDLNI--------LKTITPNCIERR--YHCSM
B2J9J1_NOSP7          ---C-SDRIYIENYSLKD--QMLYAGAARELDI--------LKTITPDCIERR--YNCSM
B7KLW5_GLOC7          ---Q-NEQIYIENYGLKN--AYLYAGAGHNLDI--------LKTLKPDCIERR--YNCSM
B7K6L4_RIPO1          ---Q-EKQIYVENYGLKD--GILYAGAGREQDI--------LKTLTPDCIERR--YNCSM
CPXT3_GLOVI           ---R-EGGIYIENYGLQD--AGLYAGAGHDPEI--------LATIPTDCLQPR--RGCAM
B4WGJ6_SYNS7          ---K-EDHIYIENYGFQD--GVPYAGAGHNADI--------LKTIPASCALRR--KGCSM
CPXT1_TRIEI           ---Q-GDSVRVENYALKD--PDLHTGAGQDLEI--------LATLTPDNIELR--KGCAM
CPXT_PROM1            --QE-EEIFIFSNYKIED--KERFTGGALDISL--------LDKISKYKLYKK--PGCSM
Q46H68_PROMT          --QK-EEIFIFSNYKIED--KERFTGGALDISL--------LDNISKYKLYKK--PGCSM
A9BDV8_PROM4          --IK-KGLIILETYNLKN--HKRVAGAGFNLEL--------INYINRDDLIPR--FGCEM
Q3AWC8_SYNS9          -KTK-DDTFVVENFDFAN--KDRLAGSGSNPEL--------LESLEKTSLKSR--CGCAM
Q0ICT6_SYNS3          HREL-SNTFIMENFGCAN--PMRIAGAGRTPEL--------LDSLKKENLKKR--CGCAM
Q7U4R1_SYNPX          -VLD-QNLFVMENFAFDN--PRRLAGAGRNPEL--------LDDLHSESLKRR--CGCAM
Q3AMG6_SYNSC          -TTH-EDTFVVENYGFTN--PRRLAGAGRDPQI--------MNAINSTTLKER--CGCAM
A5GVN6_SYNR3          -AYN-AGVFKVENFSYGA--FDRLAGAGRHPEL--------LESLKSDHLKPR--CGCSM
A5GJ09_SYNPW          -PAE-GDHFIVENFGFGD--PIRLAGAGQRPEL--------LNSLNTDSLKPR--CGCGM
Q7V594_PROMM          -LAN-KEAFILENYSLQE--PKRLAGAGFYPDL--------LNHLCADTLLPR--RGCSM
CPXT_SYNPY            ---LTSGIIKLWNHTFKE--PDRFSSATFDQDC--------REKIREEDLILL--DHCHY
Q0ICV8_SYNS3          ---VTSGIIKLWNHTFKA--PENFSSATFDDEQ--------RKTIKEEDLILL--DHCHY
CPXT_SYNPZ            ---QPSGAIKLWNHTFQD--PARFAGATFDPAL--------RRSIQTPDLISL--DQCHY
A5GIY9_SYNPW          ---QPSGAIKLWNHTFRE--PSRFAGATFNPEL--------RHSIQATDLINL--EQCHY
W0GRS9_9SYNE          ---QASGAIKLWNHIFRD--PERFAGATFDPQL--------RLAIQERDLISL--NQCHY
Q7U4P3_SYNPX          ---QSPGIIKLWNHTFHE--PSRFAKATFDKEC--------RQTIQDSDLICL--DQCHY
Q3AMI7_SYNSC          ---QSPGIIKLWNHTFRE--PSRFSGATFDKYC--------RQTIQKSDLICL--DQCHY
Q3AUU1_SYNS9          ---RGPGVIKLWNHTFRD--PKRFASATKDDVC--------RREIEDSDLICL--DQCHY
CPXT_PAUCH            ---RDE-KLIIFSYSLSD--EQKYWGSVYEPER--------MLKIEEKDLQAI--EGCNY
B5IPJ8_9CYAN          ---QGD-GLVIHNQALAD--DQRFWGAVENDEL--------RSRISAADLRPL--EGCAY
A5GVM7_SYNR3          ---CPEQGLKVMNYTLAE--PQRFIGAIDDADL--------RAEIREDDLTHL--EGCNY
CPXT1_SYNJA           ------DPLRIENYKLRD--QAAWAGASQDLQR--------LAQLSLSDLQHL--PGCRI
Q2JNQ9_SYNJB          ------DPLRIENYKLRD--QAAWAGASQDPQR--------LAQLSLADLEHL--PGCRI
CPXT4_GLOVI           ------NPLRLENYRLKD--QKVWAGAAKDPER--------LGRLRADDCEQL--PGCTL
CPXT3_MICAN           S----ADNSTVESKAYKLNNAPNFINFCNKDLT----------ERELNVSDLA-ESVCTV
A8YDV9_MICAE          S----PDNSTVESKAYKLNNAANFINFCNKNLT----------ERKLNVSNLADESVCTV
B7KLF4_GLOC7          T----LEPETVESKSYKPLQAERLIGFCNKPLS----------ERVLNVSELG-EPVCSV
CPXT1_GLOVI           S----ADGRAVESAGFKFVEAKPLAGLCAKPAA----------ERLIAPMALDGDPTCTV
                                                                               .  

CPCTL_NOSS1           SVSQQTVA-PNSYQFTASPLPNTCCTFSY-LENTVQVSLGFAVTETE----LHTYDKGID
Q3M4B0_TRIV2          SVSQKTVA-PNSYQFTASPLPDTCCTFSY-LGNTVQVSLGFAVTETE----LHTYDKGID
B2J352_NOSP7          TVTHEALA-GDRYKFTATPQPETRCSFTY-LGNSIYVSLGFETTAAE----FHSYDKGID
CPXT2_MICAN           AVKVNTLA-DNQYQFIAQPQPEQRCQFTY-EGTTYQVALGFEVTSHS----LKTYDKGLD
A8YFD2_MICAE          AVKVHTLA-DHQYQFIAQPQPEQRCQFTY-EGTTYQVSLGFEVTSHS----LKTYDKGLD
B7KI39_GLOC7          KVEINPIAVKDQYHFKAFSESESPCEFTY-EGQDFQVALGFEVNSQE----LKTYDKGID
B4WPI1_SYNS7          CYQALSNGGREGYQFESALRDNQLCSFSY-GGQTKYVYLGFDVIPQDNTILLKVYDKGID
Q31Q65_SYNE7          AVEQTSRG-----GYNAQLPAGCRCRFWT-DGIERQVSLGFEVWSESDRVNFHSFDRGID
A0A0H3K495_SYNP6      AVEQTSRG-----GYNAQLPAGCRCRFWT-DGIERQVSLGFEVWSESDRVNFHSFDRGID
CPCT_NOSS1            IVEWTGN------SFKGTVEPGKGCIVVR-KGQKTYLDSEFEINEEK----FISLDRGRD
Q3M9Z2_TRIV2          IVEWTGN------SFKGTVEPGKGCIVVR-KGQKTYLDSEFEINEEK----FISLDRGRD
D7DXH5_NOSA0          IVEWAGS------HFKGTVEPGKGCIVVR-NRQTTYLDSDFEIDGEK----FISRDRGRN
B4VQD5_9CYAN          IVEWTGK------SFQGHVEPGKACKVFR-KGKETYLDSTFEIDENQ----FISLDRGRD
B2J9J7_NOSP7          IVEWTGK------SFKGRVEPGKGCIVVR-DGKNTYLDNEFEIDAKE----FFSLDRGRD
CPXT_THEEB            LTYWTGH------SFRGEVEPGKACKVVR-KGRETYLDSTFEIDGDR----FISHDRGRD
B8HS07_CYAP4          IVEWTGQ------SFKGKVEPGKGCMVVR-KGRETYLDSEFEIDDQQ----FISHDRGRD
CPXT2_TRIEI           ITKWTGK------SFKGEVEPGKGCTVVR-EGKSTYLKSYFEINEHK----FISHDTGYD
D4ZZG1_ARTPN          ITHWTGK------GFKGVVEPGKGCMVER-KGKLTYLDSSFEIDGDR----FISHDRGMD
Q31Q37_SYNE7          ITHWTGN------GFKGVVEPGKGCIVER-KGQATYLESEFEIDDEK----MISLDRGRH
A0A0H3K745_SYNP6      ITHWTGN------GFKGVVEPGKGCIVER-KGQATYLESEFEIDDEK----MISLDRGRH
CPXT1_MICAN           NVTWTGN------SFKGVVKPGKQCLVFR-KDRMTYLDNSFEISERG----LISVDRGLD
A8YKN3_MICAE          NVTWTGN------SFKGVVKPGKQCLVFR-KDKMTYLDNSFEISEQG----LISVDRGLD
B7KHW5_GLOC7          TVEWTGH------SFKGQVKPGKQCIVIR-KDKETYLDNSFEIDEHK----LISIDRGFD
B1WWK6_CROS5          FVDWTGT------SFKGMVKPGRNCRIVR-NGKETYLDNSFEINDHQ----LISLDRGYD
B7K4H8_RIPO1          FVDWTGN------SFKGVVKPGKNCIVVR-NERETYLDNSFEIDEHK----LISVDRGLD
CPXT_SYNY3            IVEWTGT------SFKGEVQPGRQCRVMR-DGKETYLENSFEVSETG----LISLDRGYD
B4WGJ8_SYNS7          FVEWTGD------SFRGKVEPGKKCSVIR-KGATTYLDNEFIVTESH----MTSYDRGRD
A8ZML5_ACAM1          NVEWTGH------SFVGTVVPGKSCKVVR-NGKTTYLDNSFEVDQNK----FISIDRGRD
CPCT_SYNP2            IVTWSGT------SFKGTVQAGKGCRVVR-YNKESYLDNSFEITDNA----LISIDRGRD
CPXT2_GLOVI           LFKREGS------LFRGRVRPGKGCRVFR-KGRDTYLDGEATVSADY----YKSIDRGRD
CPXT2_SYNJA           QVKRQGS------LFVGVTEPGCRCCVVR-NGQTTYLQTTLHLSENE----FCSHDRGMD
Q2JI96_SYNJB          HVKRQGS------LFVGVTEPGCRCCVVR-NGQATYLQTTLHLSESE----FCSHDRGMD
CPXT3_SYNJA           QVEWTGS------CYRGRSVPGKGCIVER-KGRTTYLYSEFEIGADY----FHSLDQGRD
Q2JMN1_SYNJB          QVEWTGS------CYRGRSLPGKGCIVER-KGRTTYLYSEFEIGADY----FHSLDQGRD
CPET_MICDP            IFKREGD------KFIGGVEPGNLCLIEK-NGCQTYLDSYVEITETT----WVSLDKGMD
A5HIW7_9CYAN          IFKREGD------KFIGGVEPGNLCLIEK-NGCQTYLDSYVEITETT----WVSLDKGMD
B2J9J1_NOSP7          VFMREGE------MFRGSVEPGNQCLINR-NGCQTYLVSDVEITEHT----WISLDKGMD
B7KLW5_GLOC7          IFSKEQN------LWRGNVE-GNQCLIER-NGRQTYLVSEVELTENT----WVSLDRGMD
B7K6L4_RIPO1          IFEQEGN------LFRGKVE-GNSCFITR-NGCQTYLVSEVELTQNT----FASLDRGLD
CPXT3_GLOVI           VFRREGD------CFRGSVEPGNHCLIPR-DGYWTYLVSEVELTEST----WVSLDRGMD
B4WGJ6_SYNS7          VFHREGE------MFVGGVEAGNNCRIPR-KGRWTYLVSRVELTDST----WVSLDQGMD
CPXT1_TRIEI           IFKRQGD------TFVGGVEPGHKCLIPRGDGSMTYLVSEVKVTQKT----WTSRDTGYD
CPXT_PROM1            YFKETNPG-----NFLGTIESGCKCFIEY-GSDKTYVKSKVTVNKNI----LISEDSGYA
Q46H68_PROMT          YFKEKKPG-----NFLGTIESGCKCYIEY-GSDKTYVKSKVTVNKNI----LISEDSGYA
A9BDV8_PROM4          HFIEPKKG-----HYRGSLRPGKTCFINR-EGQETYLLSKVEINKKK----WVSIDEGYD
Q3AWC8_SYNS9          HFKEESDG-----KYIGLVEPGKKCLVPR-NGTLTYLVSEVEVDAKT----WISRDRGFD
Q0ICT6_SYNS3          HFETKADR-----KYIGSVEPGKKCMIPR-DGQLTYLVSEVEVTQDS----WTSRDRGYD
Q7U4R1_SYNPX          HFRSISPG-----HYVGNVEPGKSCLIPR-DGKLTYLVSEVEVNQTS----WISRDRGFD
Q3AMG6_SYNSC          HFHRKEKG-----HYIGKVEPGKNCLVPR-DGKLTYLVSEVEVDQEN----WISRDRGFD
A5GVN6_SYNR3          HFTHVADG-----HYRGEVEPGKQCLVPR-DGKLTYLVSEVEVNQTD----WISRDRGFD
A5GJ09_SYNPW          HFREIDAG-----HYRGGVEPGKNCLVPR-DGHLTYLVSEVEMNATD----WISRDRGFD
Q7V594_PROMM          HFKEVKPN-----QYQGQVEPGNNCLVPR-NNTMTYLVSEVEFDEKI----WISRDRGFD
CPXT_SYNPY            QVRQLDD------GFHGELEPGCRCIVRR-DGKETYLVSSFHLQGDE----LSTLDRGHD
Q0ICV8_SYNS3          QVRQLDN------GFFGELEPGCRCIVHR-NGKETYLVSSFHLEGDE----LTTLDRGHD
CPXT_SYNPZ            QVVEQSD------GYHGAMEPGCQCIVRR-DGKDTVLVSSFHLQGES----LQTLDRGHD
A5GIY9_SYNPW          QVLEQED------GYHGAMEPGCQCIVRR-NGKDTVLVSSFHLQGES----LQTLDRGHD
W0GRS9_9SYNE          QVLEQPD------GYHGAIEPGCKCIVQR-NGEDTVLVSSFHLEGDS----LSTLDRGHD
Q7U4P3_SYNPX          QVEHKSD------GYHGSIEPGCRCMVTR-NGQETVLASTFHLQEDS----LKTLDRGHD
Q3AMI7_SYNSC          QVEYKSG------GYYGSIEPGCRCMVTR-NGQETVLASTFHLQEDT----LKTLDRGHD
Q3AUU1_SYNS9          QVTEKEG------GYYGELEPGCRCMVQR-DGRDTLLQSSFRLKGEC----LETLDRGHD
CPXT_PAUCH            IVRKKNS------NFIGEVEPGCRCLVDR-KGVTTYIVSKFELTNKGE---MRTLDRGHN
B5IPJ8_9CYAN          VVREHAD------GFIGEVEPGCRCLVER-KGQSTYLVSRLELDALG----MRTIDTGHD
A5GVM7_SYNR3          LVRDQGD------HFSGSVEPGCRCKVRR-KGRDSYLVSEFVLRNGT----METIDRGHD
CPXT1_SYNJA           LVEKRAD------CYHGQMLPGGGCRLNP--GDSTYIHIEFDLTAQE----FITWDRGFD
Q2JNQ9_SYNJB          LVEKRPD------CYHGEMLPGGECRLNP--GDSTYIHIEFDLTPSE----FITWDRGFD
CPXT4_GLOVI           YLERRGE------TFTGKMQPGGGCRLFP--GDASYVEIEFELGERL----FFTLDRGFE
CPXT3_MICAN           FLQPIAG------GYRGETPPQGCPTNAR---GAVKITNTIILHSQG----MDTSDRGYD
A8YDV9_MICAE          FLKPIAG------GYRGETPPQGCPTNAR---GAVKITNTIILHSQG----MDTSDRGYD
B7KLF4_GLOC7          FLKPSNN------GYLGETQPEGCPANVR---GAVTITNTILLHSEG----MDTWDKGYD
CPXT1_GLOVI           RLVQAGD------KYMGTTPEGGCQSNVR---GAARITNEITLYKEG----MDTRDRGFD
                                    : .                   :                  * *  

CPCTL_NOSS1           QETGKATWGAIVGPYRYTKREQY--------------------
Q3M4B0_TRIV2          QETGKATWGAIVGPYRYTKREQY--------------------
B2J352_NOSP7          PETGKATWGAIMGPYRYTKRNQYSIR-----------------
CPXT2_MICAN           PGTGKGIWGALLGPYQYEKKRDFSAELDV--------------
A8YFD2_MICAE          PGTGKGIWGALLGPYQYEKKRDFSAELEV--------------
B7KI39_GLOC7          PNTGRAIWGALMGAYCYQKQVDFSGEINLF-------------
B4WPI1_SYNS7          PDTGRGLWGALMGPFQLTKQASFDLWLYR--------------
Q31Q65_SYNE7          PETGRSLWGALMGPYEFTKVADYAVTG----------------
A0A0H3K495_SYNP6      PETGRSLWGALMGPYEFTKVADYAVTG----------------
CPCT_NOSS1            LETDAHIWGSVAGPFYFVRLHNFADEVKISAE-----------
Q3M9Z2_TRIV2          LETDAHIWGSVAGPFYFVRLRNFADEVKISAE-----------
D7DXH5_NOSA0          PETDDHIWGSVAGPFYFVRWDNFADEVKLSP------------
B4VQD5_9CYAN          PVTDEHIWGSIAGPFYFVRRASFADEVTV--------------
B2J9J7_NOSP7          LDTDERLWGSIAGPFHFVRWANFADEVKAN-------------
CPXT_THEEB            PETDEHVWGSVAGPFHFVRWQSFADEVMA--------------
B8HS07_CYAP4          PETDEHIWGSLAGPFYFVRRASFADEVKL--------------
CPXT2_TRIEI           PETDQQVWGAIAGPFEFVRWASFADEVI---------------
D4ZZG1_ARTPN          PETDEHIWGAVAGPFEFVRWASFADEVKLGE------------
Q31Q37_SYNE7          PETDEQVWGSVAGPFHFLRWHSFADEVPTP-------------
A0A0H3K745_SYNP6      PETDEQVWGSVAGPFHFLRWHSFADEVPTP-------------
CPXT1_MICAN           PETDQLVWGSIAGPFEFVRRTSFAEEV----------------
A8YKN3_MICAE          TETDQLVWGSIAGPFEFVRRSSFAEEV----------------
B7KHW5_GLOC7          PVTDELVWGSIAGAFHFTRRASFADEVI---------------
B1WWK6_CROS5          PITNELVWGSVAGAFHFKPRQSFANEVEF--------------
B7K4H8_RIPO1          PKTDELVWGSVAGPFHFQRKTSFAHEVEF--------------
CPXT_SYNY3            PETNERVWGSVAGAFHFVRWQSFADEVSF--------------
B4WGJ8_SYNS7          PETDELVWGSVAGPFEFDKVARFAHEVQI--------------
A8ZML5_ACAM1          PETDELIWGSIAGPFHFSRIKSFENELIAT-------------
CPCT_SYNP2            PVTNEILWGSLAGAFEFEKINNFSGEVQPH-------------
CPXT2_GLOVI           LESDEQVWGSVSGPFHFTKQVDFAPEVLALARP----------
CPXT2_SYNJA           PVTHRQVWGAVAGPFRFRKVVDWQAELLQ--------------
Q2JI96_SYNJB          PITHRQVWGALAGAFRFQKVVDWQAELLL--------------
CPXT3_SYNJA           PETDQVVWGSLSGPFRFVKKQDFSCYLPRWS------------
Q2JMN1_SYNJB          PETDQVIWGSLSGPFRFVKKQDFSQYLPQWAEVLNHEAVGATG
CPET_MICDP            VNTHQQVWGSTFGPLRFEKRESFADEIPNIL------------
A5HIW7_9CYAN          VNTHQQVWGSTFGPLRFEKRESFADEIPNIL------------
B2J9J1_NOSP7          IETHKQIWGSTAGPLRFEKRESFADELLAVRALC---------
B7KLW5_GLOC7          LNTHEQVWGSVHGPLRFEKRTSFADELPILSEHQCLTPD----
B7K6L4_RIPO1          INTHEQVWGTATGLLRFEKRQSFAEEIPGFQGFS---------
CPXT3_GLOVI           RETHRQIWGSQAGPLHFEKREGFDPPLPPLGKGG---------
B4WGJ6_SYNS7          IETNEHVWGSTEGALRFEKRESFADELP-LGRL----------
CPXT1_TRIEI           VNTHEKIWGSNSGPFKFDKVQDFSGEIPDIAIL----------
CPXT_PROM1            IETDKKVWGSEFGPLIFKKIINFDCFINEYWK-----------
Q46H68_PROMT          IETDKKVWGSEFGPLIFKKIVNFDCFINEYWK-----------
A9BDV8_PROM4          VQTDKKVWGSENGPYEFLRVEE---------------------
Q3AWC8_SYNS9          PATDQPQWGSEHGPLRFKRIESFSELISSSWINQKES------
Q0ICT6_SYNS3          PDTNKQIWGSEHGQLIFKKVEDIGEIITNDWINKQFNHER---
Q7U4R1_SYNPX          PENNAQVWGSEHGMLRFKKITSFSNEITNEWLELKT-------
Q3AMG6_SYNSC          PNTDEQIWGSEHGLLRFKRTQSFSAEINEEWLNSKT-------
A5GVN6_SYNR3          PETDAQCWGSEHGQLRFKRVHWFGNELTEQWAISEK-------
A5GJ09_SYNPW          PETDEQRWGSEHGPLRFERVAYLGDHLDEHWLRW---------
Q7V594_PROMM          PKTHEQLWGSKHGPLHFQRIVNLGDHLNESWLRSSSH------
CPXT_SYNPY            PQTHDRCWGSIAGKFHFQRISHWAENIPETWL-----------
Q0ICV8_SYNS3          PQTHERCWGSIAGEFHFQRISNWAENIPEKWL-----------
CPXT_SYNPZ            PITNERCWGSVAGPFRFKRTQSWAADLASAWL-----------
A5GIY9_SYNPW          PITNERCWGSVAGPFRFQRTQSWSADLASAWM-----------
W0GRS9_9SYNE          PDTNERCWGSVAGPFRFKRTQSWTADMAAAWV-----------
Q7U4P3_SYNPX          PKTNARLWGAIAGEFQFKRTKSWEAKWEQDIHS----------
Q3AMI7_SYNSC          PKTNERVWGAIAGEFKFRRTKSWEAKWE---------------
Q3AUU1_SYNS9          PETNERCWGSIAGEFRFKRKASWSNDLPTTWG-----------
CPXT_PAUCH            PVTHEQLWGSLGGVFEFNRTTDFSKEIPYDWIEEWKK------
B5IPJ8_9CYAN          PQSHAQVWGSLAGPFEFSRTNDYSHEIPAAWHDAFQQ------
A5GVM7_SYNR3          PDTHEQLWGSLPGPFLFERKEDWSDELLPLWGGLMQG------
CPXT1_SYNJA           ATTGQQTWGSRAGPYRYQKRIPVVFPPRP--------------
Q2JNQ9_SYNJB          AATGQQTWGSRAGPYRYQKGIPPAPLQV---------------
CPXT4_GLOVI           ATTGEQTWGSRAGAYRYLKQLH---------------------
CPXT3_MICAN           SL-GQQVWGAQDNVYQFRWQKP---------------------
A8YDV9_MICAE          SL-GRQVWGAQDNFYQFRWQKP---------------------
B7KLF4_GLOC7          AQ-GNQVWGANDDPFEFRWLEQKR-------------------
CPXT1_GLOVI           AQ-GNQVWGAKEEPYRFRRLTP---------------------
                             **: