CLUSTAL format seed alignment for MF_01463_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

B1YJQ7_EXIS2          ------------------------------------------------------------
D6XWY8_BACIE          ------------------------------------------------------------
E3E8W8_PAEPS          ------------------------------------------------------------
C0ZAP6_BREBN          ------------------------------------------------------------
SECD_ALIAD            ------------------------------------------------------------
SECD_ANADE            ------------------------------------------------------------
Q08P79_STIAD          ------------------------------------------------------------
A9F8D1_SORC5          MLLNIFQYGFAGVAGLCLLGAWLSRSKRSVFAWAALSAGAAAIAAHYHVFWALATFGLMV
Q6MKZ2_BDEBA          ------------------------------------------------------------
E1X0T6_HALMS          ------------------------------------------------------------
D0LJ86_HALO1          ------------------------------------------------------------
SECD_SYNFM            ------------------------------------------------------------
Q2LVH4_SYNAS          ------------------------------------------------------------
E1YHR5_9DELT          ------------------------------------------------------------
E1QIL8_DESB2          ------------------------------------------------------------
B8F9E3_DESAL          ------------------------------------------------------------
SECD_THEYD            ------------------------------------------------------------
D8PI89_9BACT          ------------------------------------------------------------
B6ANM3_9BACT          ------------------------------------------------------------
B5ECA4_GEOBB          ------------------------------------------------------------
Q3A3C4_PELCD          ------------------------------------------------------------
D5MHP3_9BACT          ------------------------------------------------------------
SECD_CALNY            ------------------------------------------------------------
SECD_DESIS            ------------------------------------------------------------
C4XSM5_DESMR          ------------------------------------------------------------
C7LN34_DESBD          ------------------------------------------------------------
Q1MSC1_LAWIP          ------------------------------------------------------------
SECD_MAGMM            ------------------------------------------------------------
SECD_RHOM4            ------------------------------------------------------------
D5HAA4_SALRM          ------------------------------------------------------------
B3EJI9_CHLPB          ------------------------------------------------------------
Q3ANT9_CHLCH          ------------------------------------------------------------
B3QTH7_CHLT3          ------------------------------------------------------------
B0VHR7_CLOAI          ------------------------------------------------------------
SECD_ELUMP            ------------------------------------------------------------
SECD_UNCTG            ------------------------------------------------------------
SECD_ACEP3            ------------------------------------------------------------
Q0BS58_GRABC          ------------------------------------------------------------
D3NUL2_AZOS1          ------------------------------------------------------------
D8JWH1_HYPDA          ------------------------------------------------------------
E3I016_RHOVT          ------------------------------------------------------------
E2CQN1_9RHOB          ------------------------------------------------------------
A7HXL0_PARL1          ------------------------------------------------------------
B0UI92_METS4          ------------------------------------------------------------
A7IND6_XANP2          ------------------------------------------------------------
A4U1K0_9PROT          ------------------------------------------------------------
D5BQT5_PUNMI          ------------------------------------------------------------
Q9A6U2_CAUVC          ------------------------------------------------------------
D9QLN2_BRESC          ------------------------------------------------------------
Q5NL89_ZYMMO          ------------------------------------------------------------
Q1GSE5_SPHAL          ------------------------------------------------------------
SECD_RHOCB            ------------------------------------------------------------
Q0C0W6_HYPNA          ------------------------------------------------------------
C6XJ02_HIRBI          ------------------------------------------------------------
Q0ANE6_MARMM          ------------------------------------------------------------
Q2RTI1_RHORT          ------------------------------------------------------------
SECD_ECOLI            ------------------------------------------------------------
C4K8M1_HAMD5          ------------------------------------------------------------
SECD_HAEIN            ------------------------------------------------------------
A1SWT8_PSYIN          ------------------------------------------------------------
Q493H1_BLOPB          ------------------------------------------------------------
Q7VQA9_BLOFL          ------------------------------------------------------------
B8GTQ2_THISH          ------------------------------------------------------------
Q31FZ7_HYDCU          ------------------------------------------------------------
D0KW97_HALNC          ------------------------------------------------------------
Q60B03_METCA          ------------------------------------------------------------
A1WXP8_HALHL          ------------------------------------------------------------
D3RSH9_ALLVD          ------------------------------------------------------------
D0U555_9BACT          ------------------------------------------------------------
Q5ZU07_LEGPH          ------------------------------------------------------------
A9KE82_COXBN          ------------------------------------------------------------
A0A0E1PNG4_ACIBA      ------------------------------------------------------------
Q0VS97_ALCBS          -----------------------------------------------------------M
A4GHV3_9BACT          ------------------------------------------------------------
A4GK28_9BACT          ------------------------------------------------------------
Q1QTM7_CHRSD          ------------------------------------------------------------
A1TZN9_MARHV          ------------------------------------------------------------
C3K1N2_PSEFS          ------------------------------------------------------------
B8KXG6_9GAMM          ------------------------------------------------------------
Q21KW0_SACD2          ------------------------------------------------------------
B3PDJ8_CELJU          ------------------------------------------------------------
C7RB47_KANKD          ----------------------------------------------------------MF
B2FN02_STRMK          ------------------------------------------------------------
A5EWX7_DICNV          ------------------------------------------------------------
Q145I2_PARXL          ------------------------------------------------------------
D8INT3_HERSS          ------------------------------------------------------------
E6UXK2_VARPE          -------------------------------------------------MRFAAQGPNSR
D6CKE5_THIA3          ------------------------------------------------------------
E8UEP8_TAYEM          ------------------------------------------------------------
E0XSS7_9PROT          ------------------------------------------------------------
D7N3K1_9NEIS          ------------------------------------------------------------
D7DM25_METV0          ------------------------------------------------------------
Q0AG53_NITEC          ------------------------------------------------------------
B6BWI8_9PROT          ------------------------------------------------------------
B7J4R7_ACIF2          ------------------------------------------------------------
Q0HXS6_SHESR          ------------------------------------------------------------
E1SV05_FERBD          ------------------------------------------------------------
B7VQL0_VIBTL          ------------------------------------------------------------
Q7MD23_VIBVY          ---------------------------------------------MTVLTLSFATEGNSM
A1S8J5_SHEAM          ----------------------------------------------------MLTDQLLH
A4SLM7_AERS4          -----------------------------------------MRAVHLFGVRARRLLLTEA
Q15N36_PSEA6          ------------------------------------------------------------
Q3IL52_PSEHT          ------------------------------------------------------------
A8EY98_RICCK          ------------------------------------------------------------
B3CTC4_ORITI          ------------------------------------------------------------
B9KH60_ANAMF          ------------------------------------------------------------
A0A0H3M0Z2_EHRRW      ------------------------------------------------------------
B3CPT1_WOLPP          ------------------------------------------------------------
Q2GDE0_NEOSM          ------------------------------------------------------------
D0RNY3_9PROT          ------------------------------------------------------------
Q4FM00_PELUB          ------------------------------------------------------------
Q7VFM8_HELHP          -----------------------------------------------------------M
C5ZWZ2_9HELI          ------------------------------------------------------------
E7A9U3_HELFC          ------------------------------------------------------------
A0RNX0_CAMFF          ------------------------------------------------------------
C3XE91_9HELI          ------------------------------------------------------------
SECD_AQUAE            ------------------------------------------------------------
D3DH34_HYDTT          ------------------------------------------------------------
B4U9J1_HYDS0          ------------------------------------------------------------
C1DVG5_SULAA          ------------------------------------------------------------
E8T6K3_THEA1          ------------------------------------------------------------
SECD_KORVE            ------------------------------------------------------------
E8X5K0_GRATM          ------------------------------------------------------------
C1F9I4_ACIC5          ------------------------------------------------------------
Q029K4_SOLUE          ------------------------------------------------------------
SECD_PETMO            ------------------------------------------------------------
C5CF36_KOSOT          ------------------------------------------------------------
A6LP86_THEM4          ------------------------------------------------------------
A0A1Q6S007_9FIRM      ------------------------------------------------------------
D3R265_MAGIU          ------------------------------------------------------------
B8I6M6_RUMCH          ------------------------------------------------------------
B0SPU4_LEPBP          --MQSYRLLLLPFFILVVSFTILYPNFADRTLKVVVREDVYSLPEAEQKTVVGGLFERWE
SECD_TREPA            ------------------------------------------------------------
Q73PW4_TREDE          ------------------------------------------------------------
E1R5K7_SEDSS          ------------------------------------------------------------
E0RQA9_SPITD          ------------------------------------------------------------
D5UAD5_BRAM5          ------------------------------------------------------------
SECD_LEPBD            ------------------------------------------------------------
SECD_SEBTE            ------------------------------------------------------------
A5TW61_FUSNP          ------------------------------------------------------------
SECD_GEMAT            ------------------------------------------------------------
B2A263_NATTJ          ------------------------------------------------------------
SECD_ACIFV            ------------------------------------------------------------
D1BLM4_VEIPT          ------------------------------------------------------------
B8CXF7_HALOH          ------------------------------------------------------------
D9QVJ1_ACEAZ          ------------------------------------------------------------
D5XEJ6_THEPJ          ------------------------------------------------------------
Q2RHU6_MOOTA          --------------------------------------MWRRWHSQQLTVNSGRGYNRMS
Q3ABZ0_CARHZ          ------------------------------------------------------------
B0TF81_HELMI          -----------------------------------------------MFRISWQSSVEKK
C9R7V3_AMMDK          ------------------------------------------------------------
B1I4K5_DESAP          ------------------------------------------------------------
C8W4E1_DESAS          ------------------------------------------------------------
A4J544_DESRM          ------------------------------------------------------------
Q0AX22_SYNWW          ------------------------------------------------------------
Q892A4_CLOTE          ------------------------------------------------------MRRRNM
D9SMV2_CLOC7          ------------------------------------------------------MSNFNK
Q67LL8_SYMTH          ------------------------------------------------------------
D9TNU7_THETC          ------------------------------------------------------------
A4XIR1_CALS8          ------------------------------------------------------------
E3GFZ5_9FIRM          ------------------------------------------------------------
D9RXQ2_THEOJ          ------------------------------------------------------------
E3PRC6_ACESD          ------------------------------------------------------------
A6TQN4_ALKMQ          ------------------------------------------------------------
D4M8M0_9BACT          ------------------------------------------------------------
E6SLR2_THEM7          ------------------------------------------------------------
SECD_DICTD            ------------------------------------------------------------
SECD_DEHMV            ------------------------------------------------------------
B3T9T5_9ZZZZ          -----------------------------------------------MPIILRVLLTLLG
SECD_THET1            ------------------------------------------------------------
B9KYU6_THERP          ------------------------------------------------------------
A9B5U9_HERA2          --------------------------------------MRCCDGSFFRYLWVGCIPRHAH
A7NP80_ROSCS          ------------------------------------------------------------
SECD_ANATU            ------------------------------------------------------------
SECD_PROMA            ------------------------------------------------------------
B5IKE7_9CYAN          ------------------------------------------------------------
B4WJX6_SYNS7          -------------------------------------------------MVLGYLTAPGH
D3EPH0_ATETH          ------------------------------------------------------------
SECD_ACAM1            ------------------------------------------------------------
Q2JY13_SYNJA          ------------------------------------------------------------
Q7NDR6_GLOVI          ------------------------------------------------------------
Q1AWD0_RUBXD          ------------------------------------------------------------
A0QWJ2_MYCS2          ------------------------------------------------------------
A0A0H3MPV3_MYCLB      --------------------------------------------MSCVKGLVMRHVGSVG
C0ZZ50_RHOE4          ------------------------------------------------------------
D0LCM8_GORB4          -------------------------------------------------------MTTTR
D5UNI7_TSUPD          ------------------------------------------------------------
D9UX19_9ACTN          ------------------------------------------------------------
C7MQZ9_SACVD          ------------------------------------------------------------
A4FBB0_SACEN          ------------------------------------------------------------
C6WCM7_ACTMD          ------------------------------------------------------------
C8XE16_NAKMY          ------------------------------------------------------------
D2S9I0_GEOOG          ------------------------------------------------------------
Q4JVE1_CORJK          ------------------------------------------------------------
C4LIX5_CORK4          ------------------------------------------------------------
Q8NPZ9_CORGL          ---------------------------------------------------------MEL
D7BNQ2_ARCHD          ------------------------------------------------------------
D6ZHF4_MOBCV          ------------------------------------------------------------
B2GIL6_KOCRD          -----------------------MAAQKKGSDSSAPRTTPRWRRSSSADDAGSPRRSGPR
A9WSE2_RENSM          -------------------------------------------MSASAEPEASKRR----
E1VWF6_GLUAR          ------------------------------------------------------------
C5CCH9_MICLC          ------------------------------------------------------------
B0REC2_CLAMS          ------------------------------------------------------------
E8NFI9_MICTS          ------------------------------------------------------------
D5UEN5_CELFN          ------------------------------------------------------------
D1BGW2_SANKS          ------------------------------------------------------------
C5C5R0_BEUC1          ------------------------------------------------------------
C7R4G5_JONDD          ------------------------------------------------------------
D1BSK1_XYLCX          ------------------------------------------------------------
Q83MZ7_TROWT          ------------------------------------------------------------
A6WCH6_KINRD          ------------------------------------------------------MSNDRP
E6SB77_INTC7          ------------------------------------------------------------
C7NI44_KYTSD          ------------------------------------------------------------
C7MCC2_BRAFD          ------------------------------------------------------------
D6Y2C4_THEBD          ------------------------------------------------------------
D2AWR2_STRRD          ------------------------------------------------------------
D1AEV4_THECD          ------------------------------------------------------------
A0LUK3_ACIC1          ------------------------------------------------------------
A8KZE4_FRASN          ---------------------------------------------------------MAL
Q2JD92_FRACC          -----------------------------------------------------------M
E2PV76_STRC2          ----------------------------------------------------MRSGWTGR
E4N7T8_KITSK          ------------------------------------------------------------
C7QJQ1_CATAD          ---------------------------------------------MTDAPAPDTTRHTKR
D7GDS9_PROFC          ------------------------------------------------------------
Q6A8K5_CUTAK          ------------------------------------------------------------
D2PVF3_KRIFD          ------------------------------------------------------------
A1SJA9_NOCSJ          ------------------------------------------------------------
C4RGU0_MICS3          ----------------------------------MSTSGRRPRHPSPGSPARHSCRRPGG
A4X5X5_SALTO          ------------------------------------------------------------
D3PYP7_STANL          ------------------------------------------------------------
E1QZN3_OLSUV          ---------------------------MARDTKSSEPRTGVERWNASEGAGATAKGGRAV
C7LYS6_ACIFD          ------------------------------------------------------------
                                                                                  

B1YJQ7_EXIS2          ----------MIKKGKLATFFIIVAALLVLIGTTSNWLL---------------------
D6XWY8_BACIE          -----MKKRRGVKKGHLAAFFAIIISLGILIAATVMDHV---------------------
E3E8W8_PAEPS          -------------MKRILSFIVVVLITTGVMVGTSPGLL---------------------
C0ZAP6_BREBN          ----------MVKWGRFLLFLVVVGLLATLVATTTKQVA---------------------
SECD_ALIAD            -----------MKWGRLLAFLAMVVVVLGLTISTGPKIW---------------------
SECD_ANADE            ----------MERSWYWRVALVVAVAILSIYQLVPSWFYFKLP-----------------
Q08P79_STIAD          ----------MDRGWWWKFGVIVAVTLGTVWFLVPTYYSLAVLD----------------
A9F8D1_SORC5          PWALLCVGPWIDFAWRAKTGFVLFLALGSALAIYPTYHDERYGRPVHTGLSSEE------
Q6MKZ2_BDEBA          ----------MEGLRWRTFVAVLGVA-ASLVWVLPNLVNLSEVS----------------
E1X0T6_HALMS          ----------MKRSWWYRFIFLIIVTITSVVIILPTALDFQEES----------------
D0LJ86_HALO1          ----------MDRKIRWRTFWLGALVVLSISLLIPTLVPSESMP----------------
SECD_SYNFM            -----------MSNLKWRALLVVVVLIVGVVYLVPTFVSTLPPG----------------
Q2LVH4_SYNAS          ----------MFGSIRVRAFIALAVILVAVFYLFPTLTADLPEF----------------
E1YHR5_9DELT          -----------MKIFSWKLYLSVIVLITAIIYFLPTFKPGI-------------------
E1QIL8_DESB2          ----------MSENLTLRTAIVAVVIFIGLLFLMPNVVPKMPAW----------------
B8F9E3_DESAL          -----------MKNFTFRLTLVAIVLALALLFLWPTVNQWFVDK----------------
SECD_THEYD            ----------MRKGIYLRIALIAFTVILAIIFFLPNTPLFSYMP----------------
D8PI89_9BACT          ----------MKKVGGRLLALVTMVVASIIFFLPSYQPLYKELP----------------
B6ANM3_9BACT          ----------MKRKIGFRFTLLGGAALLSFLLLLPSLPVWKDLP----------------
B5ECA4_GEOBB          ----------MPKSISWRITMIVFFVLLSFLYLTPTLVSNL--P----------------
Q3A3C4_PELCD          ----------MSKSIKLRGGVVLFCLALSLLALMPTLFPNSS-P----------------
D5MHP3_9BACT          -------------MIAGYYLFPTLSGRSSLPSLLPPLLPRA-------------------
SECD_CALNY            ----------MQLKLRWITILIVFVVSLFFMFPLD-------------------------
SECD_DESIS            ----------MDGKLIAKLLLIAAVIGFCIHLATPLN-----------------------
C4XSM5_DESMR          ----------MTGNLRWRLAVISLVAFLGLIYMLPSLGSVKQ------------------
C7LN34_DESBD          -----------MGSLRWRALLAAFVIFLALIHVLPSIPSVRN------------------
Q1MSC1_LAWIP          -----------MKSLPWRITISLFILILSIIYVLPSIPFIDN------------------
SECD_MAGMM            ----------MRQQPRWKLYLVVLVALGSIYYALPSLLGGNL------------------
SECD_RHOM4            -----------MKRNGFKIGVTLALLLLCGYYLYPTVRYALLQRKLNRMSE---------
D5HAA4_SALRM          -----------MQGNGFKVGLTIFFVGLCGFYLFPSVQNLYVSYKMNNMPE---------
B3EJI9_CHLPB          -----------MKNNRFKSILIVALTALALWSLWPTYQDYSYSKQLDRQETA--------
Q3ANT9_CHLCH          -MFASNNFFYLMKNKRFNLLLIALITLLSLWSLWPTWRDYSISQELQNARTP--------
B3QTH7_CHLT3          -----------MKKNQFRLFLIVLFTALAVWSIIPTIQDYLHTKKLGELSS---------
B0VHR7_CLOAI          -----------MKKFSWRGLFIIIFFCVTAFFLAPMVIPNLPSWWS--------------
SECD_ELUMP            ----------MSNKVLVKWAVILVALFASVYLLYPVYKWYSLSNEDRAKLE---------
SECD_UNCTG            ------------MKINWKLLITVTLLAFSVWALWPSLKFALMSDEKKEQSE---------
SECD_ACEP3            ---------MRMYYSRLKLASVLGVCLLGLLLCLPNGMR---------------------
Q0BS58_GRABC          ----------MLYFSRLKTTTIYLVCLLGMLLCLPNLMA---------------------
D3NUL2_AZOS1          ----------MLYFSRWKIYMILATCLAGFILILPNFLG---------------------
D8JWH1_HYPDA          ----------MLHFTRWKIIATLLTCLAGLLVALPNFFP---------------------
E3I016_RHOVT          ------MSAFTLHFSRWGAVATILISVASVIFALPNVIP---------------------
E2CQN1_9RHOB          ----------MLYFARWKIALILVVVTAGILATLPNFLS---------------------
A7HXL0_PARL1          ----------MLHFDRWKVALILLVCFAGLAYSAPNFIP---------------------
B0UI92_METS4          ----------MLRFSSSKLVGTLAVIIVGLALAIPSFFSP--------------------
A7IND6_XANP2          ----------MLHFSRLKTTAILLTIAVGLLFALPNVLP---------------------
A4U1K0_9PROT          ----------MLQFPKWKIALVLLVALWGGIWATPNLLS---------------------
D5BQT5_PUNMI          ----------MLQFEGWKKLLVLFVILLGVFFALPNLAP---------------------
Q9A6U2_CAUVC          ----------MLTLSRWKIVLVTFSVIFGILFTLPNLLP---------------------
D9QLN2_BRESC          ----------MIQLSRWKVIVLIAALVFGLLLALPNVLS---------------------
Q5NL89_ZYMMO          ----------MLDFPRWKIWSIILVLVLGVFLAIPSLLP---------------------
Q1GSE5_SPHAL          ----------MLDFPRWKTIGISIILLLGVLFAIPSFLP---------------------
SECD_RHOCB            ----------MLQISLWKRLVILGLCLAALITAAPNMFYARVEGHNDAVSAFEK------
Q0C0W6_HYPNA          ----------MLQFPAWKVLLVLGVLVWGVVMALPNAVNM--------------------
C6XJ02_HIRBI          ----------MLQFALWKRLLVIGVVLLGAWLCLPNLLNAGQ------------------
Q0ANE6_MARMM          ----------MLHFGRWKLLSIFLITLLGVMYTIPNFVPEEDRFTINEV-----------
Q2RTI1_RHORT          ---------MPALFSLWKAIPVILVVLAGITFSLANVVP---------------------
SECD_ECOLI            ---------MLNRYPLWKYVMLIVVIVIGLLYALPNLFGEDPAVQITGARG----VAASE
C4K8M1_HAMD5          ---------MLNRYPLWKYVMLIFVILLSFLYALPNFYGEDPAVQITGVRG----NAASE
SECD_HAEIN            ---------MLNRYPLWKNLMVIFIVAIGILYSLPNIYGEDPAVQISGTRG----QEANT
A1SWT8_PSYIN          ---------MLNKYPMWKYLLLLFIVFISLLYAAPNLYGEDPAVQISATRG----AKVEL
Q493H1_BLOPB          ---------MLNNYPLWKYLTVILVFVTGIIYTLPSLYRDYPTIYIAQCALEQNYQEMDD
Q7VQA9_BLOFL          --MNFTRKILINSFSIWKYVVIFITLMMGFIYAIPNLYKEGFAISITPYIF--NNHNLDN
B8GTQ2_THISH          ---------MINQYPLWKYLLIVVVVAVGALYAMPNLYPEDPAVQISNT-TT---DEVDE
Q31FZ7_HYDCU          -MFESRQKVISNQYPAWKYLLLLIVLVLGVIYAAPNIFGDDPAVQISPA-KS---VQFDA
D0KW97_HALNC          ----------MNRYPWWKNLLIILVLLLGIFFALPNIYGENPALQISK--RN---AVMDQ
Q60B03_METCA          --------------------MVAAVLILGIIYALPNFFGEDPSVQLSAV-RA---AKVDD
A1WXP8_HALHL          ----------MNRYPLWKYLLVVAVLVVGGLFALPNLFGEDPSVVITTG-DD---EVPSE
D3RSH9_ALLVD          ----------MNRYPLWKNLLILGVILVGLLLAWPNLYSQDPSIEITAA-RG---HEIGA
D0U555_9BACT          ----------MNHYAGWKNALIVFFLFISTLYALPNLYGSDLAIQITGT-GD---YVVQE
Q5ZU07_LEGPH          ---------MQNKYPLWKNLMLIVIAVIGFVYAIPNLYTENPVVQISAG-TD---EDT-E
A9KE82_COXBN          ----------MNRYPLWRYILLAVLIIISLIYALPNLYGEDPAIQISAK-NS---API-E
A0A0E1PNG4_ACIBA      -----------MRYPAWKYLLILVVLVVSTLYALPSLYPDEPAVQISGAKAG---TQIDQ
Q0VS97_ALCBS          IKKSALLERTMTRYPRWKFFLLMAALVVCSLYALPNLYPDAPAIQISHSEAG---GEVSA
A4GHV3_9BACT          ----------MKRYGLWKYLLILSVLCFGVIYSLPNLYAPDPAVQISYTSSS---QTADT
A4GK28_9BACT          -----------MRFQAWKIFSILIVLSIGIIFSLPNIFPPDPSVQITTASAG---DGFSN
Q1QTM7_CHRSD          ---------MLNRYPLWKYLLILVVLLVGLIYALPNLYPADPAVQISSTASG---AALDQ
A1TZN9_MARHV          ---------MLNKYPLWKNLVIVFALVIGFIYALPNFFPDDYAIQITGARGS---TEVEQ
C3K1N2_PSEFS          --------MMLNKYPLWKYVLILAVLAIGFIYSAPNLYPDDPAIQITGASTS---LQVNQ
B8KXG6_9GAMM          ---------MLNKYSLWKYLLILTVVVTGFYYAAPNLYTPDPALQIAPSSSS---VQLDA
Q21KW0_SACD2          ----------MNRYPLWKYLLILAVVVIGFLYSLPNIYVPDPAIQISGIRSG---VEVDA
B3PDJ8_CELJU          ---------MLNRYPLWKYLVLLFLLLIGTVYAIPNLYIPDPAVQVSGDSSA---KVIDQ
C7RB47_KANKD          TDQSNQRLLPINTYPKWKYVLILFVVAISLLYAAPNIYGEDPAVQLSALRDA----TISE
B2FN02_STRMK          --MAPRGTQAMLEFPRWKYVVILIVLALSALYALPNIYQKDPALQITANRGG----QIDD
A5EWX7_DICNV          ---------MPKPFTPWKYALIVMVLLLGLLFALPNWYGKSPAVQMRFTATP-----AEQ
Q145I2_PARXL          ----------MNRYPLWKYAVMLVALVIGLVYTLPNLFGEAPAVQVSSGKATV---KLDS
D8INT3_HERSS          ----------MNRYSLWKYALIVLALLFGVIYTVPNFFGESPAVQISSAKSTL---KVEP
E6UXK2_VARPE          RVPFLEKRFLMNRYPVWKYTIIVIVLLVGLIYALPNFFGESPAVQVSAAKSTV---KIDA
D6CKE5_THIA3          ----------MNRYPWWKYLIMVVVLVVGVVYALPNLYGESPSVQISSTNGG----KVDN
E8UEP8_TAYEM          ----------MNRYPLWKYLIVLVALIFGLTYTLPNIFGQTVAVQISSLNVTK---KVDA
E0XSS7_9PROT          ----------MNKPATWRIVLMFLALIFGMTYSIPNFFGELPAVQVSSTKATV---KVTG
D7N3K1_9NEIS          ----------MNRYPLWKYLLIAFTVVLAVIYSLPNLFGETPAVQVSTNRQSI---IINS
D7DM25_METV0          ----------MNRYPMWKNILVAVMILIGLIYTIPNFFGESPAVQITPAKSTT---KLDS
Q0AG53_NITEC          ----------MNRYPLWKYIVIAVSILLGLLYTLPNFFGESPAVQISPLRADV---RTDT
B6BWI8_9PROT          ----------MNQFSRWKNTLILLIVVFALFYALPNFFGEAPAVQIMPIKSGE---KMDP
B7J4R7_ACIF2          ----------MTRYPWWKYLIILVVVLPSLFYALPNFYGWHSAVEVRAPAGTL------L
Q0HXS6_SHESR          -MDKIQSKKLLNHYSAWKYVVLIVTIIVMLFSALPTWYGEDAAVQVGAKAGLNLSPIELR
E1SV05_FERBD          MKKPTRASAVINRYPAWKYVVLVVTLVVMTLSALPSWYGEDAAIDIHWSHAKDAQSTE--
B7VQL0_VIBTL          -MKLKRSIAPINYSAKWKVIVLVLSVVLMLLSALPSAFGEREALHIS-NQTHSTHADDVY
Q7MD23_VIBVY          TKKHKAAQKLLNHYSAWKYVVLITTLVILTLSAIPTWFGEQPSIQISYQNNVKGPTTEHY
A1S8J5_SHEAM          RGRRGNASKTLNRTSPWLALTFSVALILLALSALPSFFGERAALTLGKDAWIAPEQAG--
A4SLM7_AERS4          FAMRKKSRITLNRMSKWQYALLLLMLFTFAFYSLPTFFGEQPSLGLHGQTSLTEAQRT--
Q15N36_PSEA6          -----MRKTTAKPKYTWQILVIIVTVIILGLNAIPTFYGNHNALLVSAV--NPTQSLPNT
Q3IL52_PSEHT          MLSFKNNKKPFMAKFKLSTFAMLVVLLLLAMSALPNLYPNQSWLYISAAPHSKIQTPPST
A8EY98_RICCK          ----------MPNLPKWKIFLSIICTVFATICALPNFMQVNS-K----------------
B3CTC4_ORITI          ----------MKQFLFNKIFITVLITAIALCFVVPNFFDTTKYQ----------------
B9KH60_ANAMF          ------------MHPIGKAVAAFILCVVSVYLVMPNFVDSNL------------------
A0A0H3M0Z2_EHRRW      -------MYDMLFKLEIKPIVVTLLCTIAIYLVLPNFIDNKF------------------
B3CPT1_WOLPP          ----------MPNKIIVKSLSVLLIFLLSLYIILPNFIDNKF------------------
Q2GDE0_NEOSM          -----------MRSLRVKCFFLLFLFLVSAFVVWGNFSSG--------------------
D0RNY3_9PROT          ----------MLHFSRLKIFFISLTILIGLFFFIPNFLNTPSK-----------------
Q4FM00_PELUB          ----------MLYFSKLRITLVSLVSIFFIFIAASNFQN-PED-----------------
Q7VFM8_HELHP          AKQHTYSVQGSHKGLNYRLWSFIFVALVGIILCLPSFTDIN-------------------
C5ZWZ2_9HELI          ----------MKKSFNTKLFSFIIAALFGIALSIPSLFQTQ-------------------
E7A9U3_HELFC          -------------MFNARLLIFVIALVFGVGLSLPSLLQTK-------------------
A0RNX0_CAMFF          ---------MLKGRVTYRLVIFILALIFGLGFSMPSFLQSEK------------------
C3XE91_9HELI          ---MAKIHTNTQKPFNYRLLAFILACCFGIFFSIPSFFQDSSKYPFFDG-----------
SECD_AQUAE            -----MILIMQKKNLWLHLLGLVILTLLSAYAVVKYP-----------------------
D3DH34_HYDTT          -----------MKNIYLNLSLLLALVALSVGISLFKP-----------------------
B4U9J1_HYDS0          ----------MPKNIFINILIGTFIIIGSLLVVAFKP-----------------------
C1DVG5_SULAA          ----------MKVDAKIKLLVIFLVLVGSIYVMMTKT-----------------------
E8T6K3_THEA1          -----------MKNLKWKVLFILAVLVGSLYVALTKP-----------------------
SECD_KORVE            ----------MKKNLTWKVVVIVAVLLVFAFGIIGNPAEVKWDKEGLKTALM--------
E8X5K0_GRATM          ----------MGKNLATKLAAIVVVLLFFIYGIIGIP------HGSLKQSIA--------
C1F9I4_ACIC5          ----------MRTNLRAKTILIVVILIAFVYGIFGIPKG--FSGAALQTAIL--------
Q029K4_SOLUE          ----------MKKNLTARTVIIVVTILICVFGIIGIPKS----GADIARNFS--------
SECD_PETMO            ------------MRNRRIRILFTVIVFVFALLGLILPLSGNVNDISILRFFPN-------
C5CF36_KOSOT          ------------MRANQKRLIVVVIVIVLALLPLVIPRGETAGGSFLSLITSN-------
A6LP86_THEM4          ------------MKENKVRGIITLVVIALAFLSLLWP--SSKGYQGVLSIFNR-------
A0A1Q6S007_9FIRM      ----------MKRVPKPVFFVVALLILAFSFTAIFGISYYTGDNKTTVLKGIS-------
D3R265_MAGIU          ---------------------MALIIALLTVISYTGISVPEPGGTKIRLAGAS-------
B8I6M6_RUMCH          ----------MRGSNAVKFFSILVIIGILTWIAAYGSIL------GVEIPGVR-------
B0SPU4_LEPBP          NDYGKSSGWTIEPKGTLPPKENPFYTVKGRFITSAKINQISQENQSLVNEGKNK------
SECD_TREPA            ----------MSKKARFGVVLVVLAACSGFLFPTLQWYFLTDAQTRQRALSSREQIKEYA
Q73PW4_TREDE          ----------MSKRFRFIVVLLVIALCFVFLHPTLKWYFWTNQEDKALALASREKIKDYS
E1R5K7_SEDSS          ----------MSKRSRLFIVLLVLVVCGVFLYPTFEWYFMVPQAQKELAAGSKQQIQAYA
E0RQA9_SPITD          ----------MSKRARLLLVLFFMVIAGVFIYPTVKWYFFVPEEEKTVAQASVEEVRRYS
D5UAD5_BRAM5          ----------MSHNLRLAFIIIGLAVMAWFITPTVRWYFFTSEDKKEESNLSLDEMIAKG
SECD_LEPBD            ----------MQNKK-SHYIWLFLVIFVPALILYFN------------------------
SECD_SEBTE            ----------MEIKT-SRIVILILVVVIPAILIFRN------------------------
A5TW61_FUSNP          ----------MNNKLFLRLLMVIAIFGVSLYYSLVK------------------------
SECD_GEMAT            -----------MANLKYRILLIAALFAASVFALFPRTVVERVKREGVFVYDTVR------
B2A263_NATTJ          -----------MIRWKYVTILLVILLAVFGLSFYSYHYARDN------------------
SECD_ACIFV            -------MESKNR-------AKLLVSVLAIVIAFAVF-----------------------
D1BLM4_VEIPT          -------MNGKAI-------IKFLVVIAAIIGLFAYC-----------------------
B8CXF7_HALOH          -------MRYKQKR------ILNAIIILAIILFSYYL-----------------------
D9QVJ1_ACEAZ          -------MTRKNKK------LLKIVGIMAAVIIAAYF-----------------------
D5XEJ6_THEPJ          -----MRTKSLIS--------LLLTIALIAVSGYLLI-----------------------
Q2RHU6_MOOTA          ASFNLSREERVLAGGKGAGGFLKLAVVFLAILAIGIG-----------------------
Q3ABZ0_CARHZ          ---MRLGKFTLFSG------VLILILILGWYTFLGFG-----------------------
B0TF81_HELMI          QTFARRQRAKMNARK-----LLQLVALISVVAIAAAL-----------------------
C9R7V3_AMMDK          -----MRWNKLLTLL----AVVTVVGVAMWFAFLPPI-----------------------
B1I4K5_DESAP          -----MRLGNLLKV-----AVILVVAAAVSLVSFYPV-----------------------
C8W4E1_DESAS          -----MNWKSISKL-----AVIVLLVAAVSVVFFKPNLKPV-------------------
A4J544_DESRM          -----MKWDRVLRLF----AVVIAVVVIAVFSVQPIF-----------------------
Q0AX22_SYNWW          -----MKLQKNFSV-------AVILAIIVALGALSYF-----------------------
Q892A4_CLOTE          RNKKSSKGKSAFLLT----LSVVVILSLAYVGAFGIN-----------------------
D9SMV2_CLOC7          SKQKNRKKSTGKFFT----LTIATII-VALVGAFGLTFGG--------------------
Q67LL8_SYMTH          ----MRGGWNALVLA----LILVVVG--GVIGFYLTP-----------------------
D9TNU7_THETC          ----MMRSRGLAKFL----SVIVLAVIVAYVAFYGIN-----------------------
A4XIR1_CALS8          -----MQNRSLAQFL----IASLIIAFAFYIVFFGLN-----------------------
E3GFZ5_9FIRM          -MKEKVNTKKTITLV----IFIAILAFCGYTLFHGLS-----------------------
D9RXQ2_THEOJ          ---MSLRARSLLKIA----VILLIGFFLAYMLYFGIK-----------------------
E3PRC6_ACESD          -----MKFKNVSLFI----LIILVIAGFSFTAINGLN-----------------------
A6TQN4_ALKMQ          -----MNFKSTIIFI----MIVVMVGLASFTAFNGLE-----------------------
D4M8M0_9BACT          -----MNRRDRLRLW------VVLIVIVAALA----------------------------
E6SLR2_THEM7          -----MRARRRWRAV------LTLVLSLALLGGIAAW-----------------------
SECD_DICTD            -----MNIRPEIKTA------FIVIILGIAIW----------------------------
SECD_DEHMV            ---------MRRKNGLVFLAILAAMILAFTIVLPTDKGALLGKG----------------
B3T9T5_9ZZZZ          GWFFKLPSHLRALLVIVLIVGFSMAVLAVQHIDLEVGGARFERGSD--------------
SECD_THET1            ----------MRRSTLYSLIFIIILTAFAVWVDLPGS--RNVFG----------------
B9KYU6_THERP          ----------MRIRPWQTLIVIVLLSLAAIWVDLPGQQ-LDPFGWK--------------
A9B5U9_HERA2          PSPNTEAAFVVRKQVISALVVTIVAVALATWIVFFPKSFQSLTG----------------
A7NP80_ROSCS          ----------MRSRDIYSLIFILLIAGVALSIVFAPEG-RWLFN----------------
SECD_ANATU            -----------MKRYYFTLALIVLLLGLTIWFNVPGHPQIKIGNFE--------------
SECD_PROMA            ---------MARQQGWFALLIALVISAFLLCINLPFQ-----------------------
B5IKE7_9CYAN          ---------MARQQGWFALILALAIAAGALLMSFPLQ-----------------------
B4WJX6_SYNS7          DGFIKPMDSMGKQRLILASLLGLVIAAIVLIVQVPTQ-----------------------
D3EPH0_ATETH          ---------MKQQRLLIVLIIALLTSAITFLNIMPLQ-----------------------
SECD_ACAM1            --------MLKQQRFLLALIALLVVGALIVVTPFGKQYGLG-------------------
Q2JY13_SYNJA          ---------MARSPALWLSRLAVLRGLIFILAVVVALVYLGFSR----------------
Q7NDR6_GLOVI          ---------MRQRTLLLLLVAVVIVGSILIVA----------TR----------------
Q1AWD0_RUBXD          -----------MNNTRNNLIILGLVLVLIAVSAYLIFIRQPVA-----------------
A0QWJ2_MYCS2          ----------MASSSAPVHPARYLTLFLVLLVGV--------------------------
A0A0H3MPV3_MYCLB      KNRFRGDTRNVASSSAPVHFGRYLSMFLVLFIGV--------------------------
C0ZZ50_RHOE4          ----------MAPSTGTVHPVRYLALFGVLVVAL--------------------------
D0LCM8_GORB4          RAGTDTRRAKRSGPSREIPPWQPLAVFLALLAVV--------------------------
D5UNI7_TSUPD          ------MAKTSSSRDGSGDPWKPLAFFGVLLIAV--------------------------
D9UX19_9ACTN          ----------MAPSAGHLRPGRYLAFFALIVVVL--------------------------
C7MQZ9_SACVD          ----------MAPPAGQIRPGRYFAFFVVIVAAL--------------------------
A4FBB0_SACEN          ----------MAPPAGQIRPGRYLAIFTLIVAAL--------------------------
C6WCM7_ACTMD          ----------MAPPAGQIRPAKYLGAFVLIVAVL--------------------------
C8XE16_NAKMY          ----------MATPPGHLRPWRLIGTFVGIVIVL--------------------------
D2S9I0_GEOOG          ------------MAQRTLPARRYFGAFLLVVAVL--------------------------
Q4JVE1_CORJK          ---MAKKKKRTAAQGGFAWPKRALAAFVVVVLIV--------------------------
C4LIX5_CORK4          ---MAARKNR-ARSTKSRWPYRAIGIFVIFLVAV--------------------------
Q8NPZ9_CORGL          KETFLARQKKSAASAWERWPKRAIALFVLIVVGV--------------------------
D7BNQ2_ARCHD          ------MQTSRDELSKQSKPIGRLITLTVMIVAL--------------------------
D6ZHF4_MOBCV          ----------MAAKKTKNKALRTLIFFAVIVVAL--------------------------
B2GIL6_KOCRD          GAGPGNRRPATGAAAAASSARKALLALVAVTALL--------------------------
A9WSE2_RENSM          -----NRETHMARKGPASEARKVILWLGALTVVM--------------------------
E1VWF6_GLUAR          ----------MSSIRPVKQARKALLWLLIVFIIA--------------------------
C5CCH9_MICLC          ----------MAKRTPTGSAGRTLAWLAALLVVL--------------------------
B0REC2_CLAMS          ---------MAKSPTPVRKARRKLIWLLVIIGIL--------------------------
E8NFI9_MICTS          ---------MAPSP-PVRHAWRVLTGLLAITAVL--------------------------
D5UEN5_CELFN          ----------------------------MLTVAL--------------------------
D1BGW2_SANKS          ---------MATTNRSTSRPGRSLIGLGIIVLVL--------------------------
C5C5R0_BEUC1          ---------MATRKRPGGRPLRPLLFLLLIVAAI--------------------------
C7R4G5_JONDD          ---------MASTNTRGRAPWRPLITLLVILAAG--------------------------
D1BSK1_XYLCX          -------MKLANPSTRRSRPVRTLVVFAVLTMLLPLAGLV--------------------
Q83MZ7_TROWT          ---------MHKFPPAIRKARRSLGILAVVVLLL--------------------------
A6WCH6_KINRD          PAPSGPPRVRRGAPIRRPRPGRTLAALVLVVVAL--------------------------
E6SB77_INTC7          ---------MARSITTKKAALRSLAVLLALTVGL--------------------------
C7NI44_KYTSD          ---------MNMRAQRAKAVNTLLTLLLLLMLLF--------------------------
C7MCC2_BRAFD          ----------------MPARRIALAALAVLILLL--------------------------
D6Y2C4_THEBD          -------MDDKA-------PRRALLLLAVLVLAM--------------------------
D2AWR2_STRRD          ----------------------MLLALLVIILAM--------------------------
D1AEV4_THECD          ---MAAPRTPSR-------PGRTLLALFAVLAGL--------------------------
A0LUK3_ACIC1          ----MPPVRRSR-------PSRGLLTTGVVLAAL--------------------------
A8KZE4_FRASN          ARRSARASGGVS-------VGARLGVLGALLAVL--------------------------
Q2JD92_FRACC          ARGSARVPRGIS-------VWTRLGILGGLIVVL--------------------------
E2PV76_STRC2          NEKVAAPKRGRRPAGGQGKPGRTLVLILIALVAL--------------------------
E4N7T8_KITSK          ---MATPKSRSR----DGYPGRALALILVVTVGL--------------------------
C7QJQ1_CATAD          RTNPLAGSKAPRSRNRKTSPWTPLTALAAVIMAL--------------------------
D7GDS9_PROFC          -MAASNRNKHTH-------PGRRLIVFALVIVFL--------------------------
Q6A8K5_CUTAK          ---MATKKRTHH-------PGRTLVIFLVIIIVM--------------------------
D2PVF3_KRIFD          ----MATTTTSR-------PGRLLIVLGVVLVLL--------------------------
A1SJA9_NOCSJ          -----MARKSYR-------PGRTLVVFFLVVAVS--------------------------
C4RGU0_MICS3          ATVTGRQTAVAPPPQGQMRPGRQLAVLGFIFVVL--------------------------
A4X5X5_SALTO          ----------MAPPQKQMRPGRQLAVLGFIFVVL--------------------------
D3PYP7_STANL          --MGPKSKELPRRRKKVARKQLRVAPYFVSLLVV--------------------------
E1QZN3_OLSUV          RKGKRTKPKRGWGRRMAPQVRRYVSTLVVLAVVL--------------------------
C7LYS6_ACIFD          ---------MSKTRWLWSVVLSALVAVAAFIGVVELA-----------------------
                                                                                  

B1YJQ7_EXIS2          ------------------------------------------------------------
D6XWY8_BACIE          ------------------------------------------------------------
E3E8W8_PAEPS          ------------------------------------------------------------
C0ZAP6_BREBN          ------------------------------------------------------------
SECD_ALIAD            ------------------------------------------------------------
SECD_ANADE            ------------------------------------------------------------
Q08P79_STIAD          ------------------------------------------------------------
A9F8D1_SORC5          ------------------------------------------------------------
Q6MKZ2_BDEBA          ------------------------------------------------------------
E1X0T6_HALMS          ------------------------------------------------------------
D0LJ86_HALO1          ------------------------------------------------------------
SECD_SYNFM            ------------------------------------------------------------
Q2LVH4_SYNAS          ------------------------------------------------------------
E1YHR5_9DELT          ------------------------------------------------------------
E1QIL8_DESB2          ------------------------------------------------------------
B8F9E3_DESAL          ------------------------------------------------------------
SECD_THEYD            ------------------------------------------------------------
D8PI89_9BACT          ------------------------------------------------------------
B6ANM3_9BACT          ------------------------------------------------------------
B5ECA4_GEOBB          ------------------------------------------------------------
Q3A3C4_PELCD          ------------------------------------------------------------
D5MHP3_9BACT          ------------------------------------------------------------
SECD_CALNY            ------------------------------------------------------------
SECD_DESIS            ------------------------------------------------------------
C4XSM5_DESMR          ------------------------------------------------------------
C7LN34_DESBD          ------------------------------------------------------------
Q1MSC1_LAWIP          ------------------------------------------------------------
SECD_MAGMM            ------------------------------------------------------------
SECD_RHOM4            ------------------------------------------------------------
D5HAA4_SALRM          ------------------------------------------------------------
B3EJI9_CHLPB          ------------------------------------------------------------
Q3ANT9_CHLCH          ------------------------------------------------------------
B3QTH7_CHLT3          ------------------------------------------------------------
B0VHR7_CLOAI          ------------------------------------------------------------
SECD_ELUMP            ------------------------------------------------------------
SECD_UNCTG            ------------------------------------------------------------
SECD_ACEP3            ------------------------------------------------------------
Q0BS58_GRABC          ------------------------------------------------------------
D3NUL2_AZOS1          ------------------------------------------------------------
D8JWH1_HYPDA          ------------------------------------------------------------
E3I016_RHOVT          ------------------------------------------------------------
E2CQN1_9RHOB          ------------------------------------------------------------
A7HXL0_PARL1          ------------------------------------------------------------
B0UI92_METS4          ------------------------------------------------------------
A7IND6_XANP2          ------------------------------------------------------------
A4U1K0_9PROT          ------------------------------------------------------------
D5BQT5_PUNMI          ------------------------------------------------------------
Q9A6U2_CAUVC          ------------------------------------------------------------
D9QLN2_BRESC          ------------------------------------------------------------
Q5NL89_ZYMMO          ------------------------------------------------------------
Q1GSE5_SPHAL          ------------------------------------------------------------
SECD_RHOCB            ------------------------------------------------------------
Q0C0W6_HYPNA          ------------------------------------------------------------
C6XJ02_HIRBI          ------------------------------------------------------------
Q0ANE6_MARMM          ------------------------------------------------------------
Q2RTI1_RHORT          ------------------------------------------------------------
SECD_ECOLI            QTLIQVQKTLQEEKITAKSVALEE------GAILARFDS-----TDTQLRAREALM-GVM
C4K8M1_HAMD5          LTLNQVHDILKKNHLTSQSIALKN------GTILVRFKD-----PNVQLAARDVLI-SIL
SECD_HAEIN            SVLGQVQDVLKTNNLPTKSIVLEN------GSILARFTN-----TDDQLLAKDKIA-ERL
A1SWT8_PSYIN          STLGDVQDILKQSNIIPKSAVLEN------DQLLIRLKS-----SEDQLLARETII-EKL
Q493H1_BLOPB          ILLCQIKKILAYEKIINKSIVSQA------NKIRIQFFH-----EQDQLQAYQKLS-TIF
Q7VQA9_BLOFL          VLVSDIITGLKKEEIFSKFVVSNV------NKIQICFFS-----ELDQIRAYQILY-TIY
B8GTQ2_THISH          ATRRQVEAVLAGRGLNPKTGVEYD-----GQHVLLRFDN-----TDDQLQAADILRTALM
Q31FZ7_HYDCU          STEDLVTQTLQKASLKPKS-MAYQ-----NGQFLIRFHN-----TDEQMKARSALK-EVM
D0KW97_HALNC          AAVDKAVAALKAANIPVKS-ARLE-----DKDGLIQFTS-----TDAQLKAVNVVR-EAL
Q60B03_METCA          SLKVQVQGLLDAAGLKAKA-VEMA-----DKRMLIRFGD-----TDSQLKASDVLN-EKL
A1WXP8_HALHL          EVQSDVLGFLEEEGYKPLSAEVLE-----G-QWVLRYGS-----TDEQMRASDLIS-AKL
D3RSH9_ALLVD          ASSGEIKAALENAKVPLKGIESLE-----GGKLLARFDT-----PGEQLRGQEAIE-RTL
D0U555_9BACT          RDLKRINETLEENDVDYKS-ASIE-----NDNVLIRFSD-----SKSQLASKALLR-ESL
Q5ZU07_LEGPH          TIKNQVESILKNANMDYKS-LVVE-----RDGVEVVFSS-----TDSQLLARDVIK-NSL
A9KE82_COXBN          AVEEKIKSTLNAQHISYLS-VRPV-----DNTVLVRFPS-----TEDQLKAQDVIQ-AVV
A0A0E1PNG4_ACIBA      SVVQKAEQILKTANIASHDNTFTN------NAALLRVSS-----SEAQLKAKEVLRRDLG
Q0VS97_ALCBS          VARQRVLSALDAAGLAHGDGEVVG------SSLLVRMND-----TEAQLRAKDIAASTLG
A4GHV3_9BACT          FLADKVKELIEKQNLEA-KIELEK------DYVLVRTNS-----YQNQLIIKDILSTAMI
A4GK28_9BACT          KFLDDLKDLSKKTDIDTLSFEKTE------KSILIRTNS-----YQDQILLKDYLQKELN
Q1QTM7_CHRSD          ERLDRLTQALEDKDIAIKQSELDG------NSALIRLER-----AGQQVAAREIIDERLG
A1TZN9_MARHV          RVLDRALAKLEQEGIEVKSSLLEE------RDALIRLTS-----SDEQLRARPAVQAALG
C3K1N2_PSEFS          ADLERASKALTDAGIQVKAATLAAD----AKGGLLRLTK-----QEDQLPAKDVVRKAMG
B8KXG6_9GAMM          ALLSKAENALDEAGINYFGEELQNS----GKSALIRLAS-----AEQQLRAQAILSRALG
Q21KW0_SACD2          NALNTATKALEENGIQYFGAEAGE------KSALIRFAT-----QDDQLRARTIVQRALS
B3PDJ8_CELJU          PVLEAMEAALKKADIEYFGAEADG------KTALVRLLN-----NDQQMVARTVIQRALG
C7RB47_KANKD          QQVEQIEAAWQQEGLASKAIERDG------EKLVIARFQSNEEQLQAQEIANKILNPSLE
B2FN02_STRMK          ALRDRVLADLKTAGVTPVGVEKEG------ESLIVRLPD-----LKAQSAASDALRDTV-
A5EWX7_DICNV          NTVDRIASLLSAEKIPYKNIVRSA------ENIDILFAQ-----TDEQIEAKDVLA--KH
Q145I2_PARXL          TTLSAVEAALAANQIKPDDVTFDNSAT--NANIRVRLPD-----TDTQLRVKDLLQKSLN
D8INT3_HERSS          AVAGRVDQILKQGNLGAESVAFDNSGS--QPSVRARFAT-----TDIQFKAKALLEKELN
E6UXK2_VARPE          STQARVEEVLKTAGLTPDLLTLEPT------AVRARFVT-----TDDQIKARDALQQALV
D6CKE5_THIA3          ALLLKGEQILDAANLKPDSADFNGA------TVNYRFSN-----TSVQLKARDVLAKALN
E8UEP8_TAYEM          NLLSFAEQTLKQANIPFENSQIQANGP--NNTIRIRFNS-----PNEQIQARGILERALN
E0XSS7_9PROT          ELIKKIELALSEANIVHDPVRFENNIS--GGTAKIRFDT-----TDNQLKAKEIIEKSIN
D7N3K1_9NEIS          QTEAKVAAALKAANIPTDGMFVVDN------SLKVRFKD-----AETQLKGRDVIENTLG
D7DM25_METV0          ALLDKVEDIFKQEKIEYDGVYQDAR------GVKARFKN-----TDTQIRAKDVLQANLG
Q0AG53_NITEC          ALLQRLEQVLNQQNLPYNGTILEAT------GIKIRFAD-----TDTQIKAKDILSSEVG
B6BWI8_9PROT          IIASQSEKILEENNITYNGVVLTEN------FIKIKLTN-----NEDQLTSKGLLEDKLG
B7J4R7_ACIF2          PPVATQQGWLQAAGIPVTRVSSGE------KGSTFFFPN-----NDAQGLAETLLQNKLP
Q0HXS6_SHESR          -------DKLKAQGVDVKRIEVKHAQHGNANSSEDGQTLIVLNDDSEQTLVKTLVSSMVS
E1SV05_FERBD          -------RYLESQGISVKAIN-----------QQGEQTQIVLADPNSQFTAQAALTKWIG
B7VQL0_VIBTL          -------RYLVDNSIDVHSVS-----------ENNDRLVVTFASSGQQVPAQALMSDFIQ
Q7MD23_VIBVY          DVV-QLKGLLEHQSVSVDKVT-----------EKEGVTTLVFSDENAQSQARKILDNTLG
A1S8J5_SHEAM          -------QILTEAHIGVAAIS-----------ARDKGIQIILSDENQQMAARQLLAEAAQ
A4SLM7_AERS4          -------LLADNQIAPVKQVQ------------QKERVELVFSSQSEQQRAKQLLEQQGY
Q15N36_PSEA6          QT---LRKAVQQQNINVEQIIN----------SESSSKIVIDGDDEALLVAQSQLKTTLG
Q3IL52_PSEHT          NT---LVTFLNEQGLNVAQAYE----------SQATINVLLN-EPTKSAQAQAAIKAQYA
A8EY98_RICCK          ------------------------------------------------------------
B3CTC4_ORITI          ------------------------------------------------------------
B9KH60_ANAMF          ------------------------------------------------------------
A0A0H3M0Z2_EHRRW      ------------------------------------------------------------
B3CPT1_WOLPP          ------------------------------------------------------------
Q2GDE0_NEOSM          ------------------------------------------------------------
D0RNY3_9PROT          ------------------------------------------------------------
Q4FM00_PELUB          ------------------------------------------------------------
Q7VFM8_HELHP          ------------------------------------------------------------
C5ZWZ2_9HELI          ------------------------------------------------------------
E7A9U3_HELFC          ------------------------------------------------------------
A0RNX0_CAMFF          ------------------------------------------------------------
C3XE91_9HELI          ------------------------------------------------------------
SECD_AQUAE            ------------------------------------------------------------
D3DH34_HYDTT          ------------------------------------------------------------
B4U9J1_HYDS0          ------------------------------------------------------------
C1DVG5_SULAA          ------------------------------------------------------------
E8T6K3_THEA1          ------------------------------------------------------------
SECD_KORVE            ------------------------------------------------------------
E8X5K0_GRATM          ------------------------------------------------------------
C1F9I4_ACIC5          ------------------------------------------------------------
Q029K4_SOLUE          ------------------------------------------------------------
SECD_PETMO            ------------------------------------------------------------
C5CF36_KOSOT          ------------------------------------------------------------
A6LP86_THEM4          ------------------------------------------------------------
A0A1Q6S007_9FIRM      ------------------------------------------------------------
D3R265_MAGIU          ------------------------------------------------------------
B8I6M6_RUMCH          ------------------------------------------------------------
B0SPU4_LEPBP          ------------------------------------------------------------
SECD_TREPA            VQSAERDLADLTRLARAGSDEDISARYAPLVAAARQNLSYSGRPAPSRWTAAALVSAFPV
Q73PW4_TREDE          ENMARADVDKLIEMAASNSTEPLSEKYAPIIKEAKNRRKALGMEIPYQWTAQDVAASFKL
E1R5K7_SEDSS          RGQAAKAVGELKSLVAASGSDAVPEKYAYLIPIAKEHYKLDGRDLPSKWTVSTLLKGFNT
E0RQA9_SPITD          QTKALEVLERLKQGVRENPDAELPEDLSFLVPYAKRNYRIAKESLPGTWTYQAVLSSFVD
D5UAD5_BRAM5          YTKEQI------------------------------------------------------
SECD_LEPBD            ------------------------------------------------------------
SECD_SEBTE            ------------------------------------------------------------
A5TW61_FUSNP          ------------------------------------------------------------
SECD_GEMAT            ------------------------------------------------------------
B2A263_NATTJ          ------------------------------------------------------------
SECD_ACIFV            ------------------------------------------------------------
D1BLM4_VEIPT          ------------------------------------------------------------
B8CXF7_HALOH          ------------------------------------------------------------
D9QVJ1_ACEAZ          ------------------------------------------------------------
D5XEJ6_THEPJ          ------------------------------------------------------------
Q2RHU6_MOOTA          ------------------------------------------------------------
Q3ABZ0_CARHZ          ------------------------------------------------------------
B0TF81_HELMI          ------------------------------------------------------------
C9R7V3_AMMDK          ------------------------------------------------------------
B1I4K5_DESAP          ------------------------------------------------------------
C8W4E1_DESAS          ------------------------------------------------------------
A4J544_DESRM          ------------------------------------------------------------
Q0AX22_SYNWW          ------------------------------------------------------------
Q892A4_CLOTE          ------------------------------------------------------------
D9SMV2_CLOC7          ------------------------------------------------------------
Q67LL8_SYMTH          ------------------------------------------------------------
D9TNU7_THETC          ------------------------------------------------------------
A4XIR1_CALS8          ------------------------------------------------------------
E3GFZ5_9FIRM          ------------------------------------------------------------
D9RXQ2_THEOJ          ------------------------------------------------------------
E3PRC6_ACESD          ------------------------------------------------------------
A6TQN4_ALKMQ          ------------------------------------------------------------
D4M8M0_9BACT          ------------------------------------------------------------
E6SLR2_THEM7          ------------------------------------------------------------
SECD_DICTD            ------------------------------------------------------------
SECD_DEHMV            ------------------------------------------------------------
B3T9T5_9ZZZZ          ------------------------------------------------------------
SECD_THET1            ------------------------------------------------------------
B9KYU6_THERP          ------------------------------------------------------------
A9B5U9_HERA2          ------------------------------------------------------------
A7NP80_ROSCS          ------------------------------------------------------------
SECD_ANATU            ------------------------------------------------------------
SECD_PROMA            ------------------------------------------------------------
B5IKE7_9CYAN          ------------------------------------------------------------
B4WJX6_SYNS7          ------------------------------------------------------------
D3EPH0_ATETH          ------------------------------------------------------------
SECD_ACAM1            ------------------------------------------------------------
Q2JY13_SYNJA          ------------------------------------------------------------
Q7NDR6_GLOVI          ------------------------------------------------------------
Q1AWD0_RUBXD          ------------------------------------------------------------
A0QWJ2_MYCS2          ------------------------------------------------------------
A0A0H3MPV3_MYCLB      ------------------------------------------------------------
C0ZZ50_RHOE4          ------------------------------------------------------------
D0LCM8_GORB4          ------------------------------------------------------------
D5UNI7_TSUPD          ------------------------------------------------------------
D9UX19_9ACTN          ------------------------------------------------------------
C7MQZ9_SACVD          ------------------------------------------------------------
A4FBB0_SACEN          ------------------------------------------------------------
C6WCM7_ACTMD          ------------------------------------------------------------
C8XE16_NAKMY          ------------------------------------------------------------
D2S9I0_GEOOG          ------------------------------------------------------------
Q4JVE1_CORJK          ------------------------------------------------------------
C4LIX5_CORK4          ------------------------------------------------------------
Q8NPZ9_CORGL          ------------------------------------------------------------
D7BNQ2_ARCHD          ------------------------------------------------------------
D6ZHF4_MOBCV          ------------------------------------------------------------
B2GIL6_KOCRD          ------------------------------------------------------------
A9WSE2_RENSM          ------------------------------------------------------------
E1VWF6_GLUAR          ------------------------------------------------------------
C5CCH9_MICLC          ------------------------------------------------------------
B0REC2_CLAMS          ------------------------------------------------------------
E8NFI9_MICTS          ------------------------------------------------------------
D5UEN5_CELFN          ------------------------------------------------------------
D1BGW2_SANKS          ------------------------------------------------------------
C5C5R0_BEUC1          ------------------------------------------------------------
C7R4G5_JONDD          ------------------------------------------------------------
D1BSK1_XYLCX          ------------------------------------------------------------
Q83MZ7_TROWT          ------------------------------------------------------------
A6WCH6_KINRD          ------------------------------------------------------------
E6SB77_INTC7          ------------------------------------------------------------
C7NI44_KYTSD          ------------------------------------------------------------
C7MCC2_BRAFD          ------------------------------------------------------------
D6Y2C4_THEBD          ------------------------------------------------------------
D2AWR2_STRRD          ------------------------------------------------------------
D1AEV4_THECD          ------------------------------------------------------------
A0LUK3_ACIC1          ------------------------------------------------------------
A8KZE4_FRASN          ------------------------------------------------------------
Q2JD92_FRACC          ------------------------------------------------------------
E2PV76_STRC2          ------------------------------------------------------------
E4N7T8_KITSK          ------------------------------------------------------------
C7QJQ1_CATAD          ------------------------------------------------------------
D7GDS9_PROFC          ------------------------------------------------------------
Q6A8K5_CUTAK          ------------------------------------------------------------
D2PVF3_KRIFD          ------------------------------------------------------------
A1SJA9_NOCSJ          ------------------------------------------------------------
C4RGU0_MICS3          ------------------------------------------------------------
A4X5X5_SALTO          ------------------------------------------------------------
D3PYP7_STANL          ------------------------------------------------------------
E1QZN3_OLSUV          ------------------------------------------------------------
C7LYS6_ACIFD          ------------------------------------------------------------
                                                                                  

B1YJQ7_EXIS2          -------------------------------KDTKLGLDLKGGFEVLYEVQPLKK-----
D6XWY8_BACIE          -------------------------------DDIRLGLDLQGGFEVLYEVEPLDE-----
E3E8W8_PAEPS          -------------------------------KSLKLGLDLKGGFEILYEAQPLEA-----
C0ZAP6_BREBN          -------------------------------GNITLGLDLQGGFEILYEVEPLEA-----
SECD_ALIAD            -------------------------------KSIPLGLDLKGGVDLLYAVDTPK------
SECD_ANADE            ----------PDQRNTEAYDTSVPGWAPDAKHHLNLGLDLQGGILLSMGVDVDRAVKTKV
Q08P79_STIAD          ---------RSERNNLAVLEERLPAWAPPAKYRLNLGLDLQGGIHMVMRVDTKTALQKRT
A9F8D1_SORC5          -------VAEQETQARAGELGFSRFLTSNIPFRLVRGLDLKGGLRLVYTVDVDEAISDKR
Q6MKZ2_BDEBA          -----------------------WWPSK---QKLNYGLDIQGGLHLVMGVDVDGVVKEST
E1X0T6_HALMS          -----------------------NYPVK---SKINLGLDLQGGLYMILGIDFKKVYKDEV
D0LJ86_HALO1          -----------------------AWFNRVFSKKIQLGLDLQGGLYTVYSIDLDKAVDDKA
SECD_SYNFM            ----------------------WS--KFLPKDKIRLGLDLQGGMHLILEVEADQAVSNTA
Q2LVH4_SYNAS          ----------------------WK--KNLPKDRIHLGLDLQGGMHLVLEVDADKAIEATL
E1YHR5_9DELT          ----------------------------WPHKKINLGLDLQGGMHLALEVESEKAVESSI
E1QIL8_DESB2          ----------------------WP--GFLPSDKIRLGLDLQGGMHLVLEVKVAQAVEASV
B8F9E3_DESAL          ----------------------DKDHTAWPHKVINLGLDLQGGMHLVLEVQTQEAVVSTM
SECD_THEYD            ----------------------GWWKKNLPHKGIVLGLDLRGGSHLIFEVDLKRAREITV
D8PI89_9BACT          ----------------------RWVREVLPDKGITLGLDLQGGIHLVLEVEEDRAVEIAV
B6ANM3_9BACT          ----------------------QGLRKVLPSGKISLGLDLKGGMSVTLQVDREKAVDGTL
B5ECA4_GEOBB          ----------------------NWWTGYFPKDKIHLGLDLQGGTHLVMKVDTQKAVEGYI
Q3A3C4_PELCD          ----------------------DWLKKSF--DPLHLGLDLQGGMHLVLGVDVEKAVESRI
D5MHP3_9BACT          -------------------------------ERLNLGLDLQGGMHLVLEVVAEKAVENTI
SECD_CALNY            -------------------------------KRINLGLDLKGGMHVILGVETEKAVQAKI
SECD_DESIS            -------------------------------EKIALGLDLQGGMHLALDVDTEQAVERKL
C4XSM5_DESMR          ----------------------SFLGKFLPDDVISLGLDLKGGIHLTLGVDVDKALANSL
C7LN34_DESBD          ----------------------SSLGALLPGDEIGLGLDLKGGIHLTLGVDLDAALSNAV
Q1MSC1_LAWIP          ----------------------SIIGKYLPDTKINLGLDLKGGIHLTLGVDVNTAVSNAL
SECD_MAGMM            -------------------------PSWMPNKVIHQGLDLQGGLYLLYDVKVEEAIKQAG
SECD_RHOM4            ------------EERAAFIEANYGTIQSLRERALKLGLDLQGGMHVTLEVRVDALIRELA
D5HAA4_SALRM          ------------EERVEYREDNRQWLEQVDASSLNLGLDLQGGMHVTLEVEIGNLLNQLA
B3EJI9_CHLPB          ------------EDSLSFVRDHRESIEAAAEKSLKLGLDLRGGMYLVLEVDLIDLIEEKA
Q3ANT9_CHLCH          ------------KDSAAVAVKHRAELEEVRQKSLKLGLDLKGGMHLVMEVDQVDLFEQKA
B3QTH7_CHLT3          ------------EEALKYVRENRADIEAAKEKRLKLGLDLQGGMHIVLEVDVLGLIEERA
B0VHR7_CLOAI          ------------------------------KHHLKLGLDLRGGMQILLEVDTSELSAADA
SECD_ELUMP            -----------------------ASGD-RPKNILNLGLDLRGGSSLLLELDVTKLPDNTP
SECD_UNCTG            -----------------------KERDPVLGRTLKLGLDLKGGTYLLLETDTSHL--NGA
SECD_ACEP3            -----------KPF-----PSIPW-------RQIHLGLDLRGGSYLLMQVDLKSLTHDRL
Q0BS58_GRABC          -----------RPA-----AWLPW-------RTVHLGLDLRGGSYLLMQIDMKAVVRERL
D3NUL2_AZOS1          -----------RDTLAALPSWYAN-------TRVSLGLDLRGGSHLLLEVDMATVIRDRV
D8JWH1_HYPDA          -----------KETVQSWPSFMP-------KQQLTLGLDLQGGAHLLLAMDQDEIKKDWI
E3I016_RHOVT          -----------LSTYESLPSWAQ-------LPRMPLGLDLRGGTHLLYQIDTAQLKKDWL
E2CQN1_9RHOB          -----------QKTLDSWPDFLP-------KNQMVLGLDLQGGAYLLYEVDKEDYIQKRL
A7HXL0_PARL1          -----------KASLQGVPEWLP-------HQQINLGLDLRGGSYLLLAVDTASIVRDRQ
B0UI92_METS4          --------EQRKAFVASAPSWLTAL---VPTRAIVLGLDLQGGSQIVLEVDRPDLTRTMA
A7IND6_XANP2          -----------QSALAHLPSWLA-------SSRVTLGLDLQGGSHILLEVDGSALRKERT
A4U1K0_9PROT          -----------RDTTDQMPSWWQPV---------SLGLDLQGGSYLLLEVDTAYVKREHL
D5BQT5_PUNMI          -----------TQNDNQSDSTVESVFGFLPGKHINLGLDLQGGSHLLLRVDMDIVEQERL
Q9A6U2_CAUVC          -----------QKTLDSFPDWLPK-------QKLNLGLDLQGGSYLMYEVDTDALRKERL
D9QLN2_BRESC          -----------PSQRAALPGFMPK-------NTLNLGLDLQGGSYLLLEVDVDAMRTKRI
Q5NL89_ZYMMO          -----------SNLDQKFGLGALP--------RINFGLDLSGGSHILLEADTADVAHQRI
Q1GSE5_SPHAL          -----------PKAFESLPGFAQA--------KVNLGLDLAGGSHLLLEADINDLRKTQL
SECD_RHOCB            ---TGAMTETQEAAKAAWPDWAPS-------ALVNLGLDLRGGAHLLAEVHLGEVYKARM
Q0C0W6_HYPNA          ---------------SNAPGFMPK-------QAVNLGLDLRGGVYLEMEIPPAEVISSRL
C6XJ02_HIRBI          --------------RAGLPGFMPS-------ETVKLGLDLKGGSYLLLEVDPEELQQNRL
Q0ANE6_MARMM          ---------DGTATPKGIWRFIPA-------GTINLGLDLQGGSHIVFEVDMDEVRDAQL
Q2RTI1_RHORT          -----------GAGEGGLRWWRP----------LSLGLDLKGGSTFLIDLDAPALVHETQ
SECD_ECOLI            GDK----YVVALNLAPATPRWLAAIHA----EPMKLGLDLRGGVHFLMEVDMDTALGKLQ
C4K8M1_HAMD5          GDS----YVVALNLAPATPIWLRALGA----DPMKLGLDLRGGVHFLMEVDMDAILSKLQ
SECD_HAEIN            GNN----YTTALNLAPATPAWLSMFGA----NPMKWGLDLRGGVRFLMEVDMNATLVKRQ
A1SWT8_PSYIN          EGD----FVTALNLAPSTPAWLEAIGA----GPLKLGLDLRGGVYFLMEVDMDEAVSKAQ
Q493H1_BLOPB          SKK----YQILLCNTRNIPHWLSAIKA----KPIKLGLDLCGGIYFVIHANTKTVLDKFQ
Q7VQA9_BLOFL          SER----YLVSCTKIPDMPLWLFYIRA----KPLKLGLDLKGGLYLLVRVDIQSMLNKIQ
B8GTQ2_THISH          GTQ----NVVALNLAPATPDWLRTFNA----RPMSLGLDLRGGVHFLMEVDMAAVVTASH
Q31FZ7_HYDCU          GRQ----AVVALNLAPATPDILRAVGG----EPMYLGLDLRGGVHFLMDVDMEAAVQKTY
D0KW97_HALNC          GEN----YPVALNLAPAAPRWMQNLGA----KPMYLGLDLRGGVHFLMQIDMQAAIKTAL
Q60B03_METCA          GDA----YTVALNLAPSTPSWLRAFGA----KPMYLGLDLRGGVHFLLQVDMDAAIKQAE
A1WXP8_HALHL          DRE----YSVAMTLVPATPQWLRAMGA----EPMFLGLDLRGGVHFLLQVDIDAMVGETM
D3RSH9_ALLVD          SER----YRTALTQSADLPGWMRWLGL----NQMSLGLDLRGGIHVVIDVDMEAAIEQAV
D0U555_9BACT          SRN----YVVALNLAPSIPQWLSSLGG----RAMSLGLDLRGGVHFLLEVDMNAVTAMAM
Q5ZU07_LEGPH          GSD----YTVALNLAPSTPAWLEAIHA----DPMKQGLDLRGGVHFLLEVDVESVISRRY
A9KE82_COXBN          GTD----YSVALNLAPRTPRWLQAIGA----KPMRLGLDLRGGIHFLLDVDVGAMVKAQE
A0A0E1PNG4_ACIBA      -DQ----YVVALNLAPTTPEWLQKIGA----KPMKLGLDLRGGVHFLLEVDMDKAISQRM
Q0VS97_ALCBS          -DN----YVVALNLAATTPQWLRDIGA----SPMNLGLDLRGGVHFLLQVDMDSVVKSRM
A4GHV3_9BACT          -ND----VVIALNLAPTTPKWLMDIGA----NPMKLGLDLRGGVHFLMQVDTETAIKNRQ
A4GK28_9BACT          -EN----FVVALNLAANTPDWLKALNA----KPMKLGLDLRGGVNFLMEVDTELLLQTKL
Q1QTM7_CHRSD          -DA----YTVALNLADATPGWLQALSA----TPMKLGLDLQGGVHFLLEVDMDAAVEQRL
A1TZN9_MARHV          -NE----YLVALNMAPSTPGWLRSLGA----GPMKLGLDLRGGVHFLLEVDMETALNQRL
C3K1N2_PSEFS          -DD----YVVALNLAQTTPAWLRSIGA----HPMKLGLDLSGGVHFLLEVDMDKALDARL
B8KXG6_9GAMM          -DF----FVVALNLAPTTPEWLMSGGA----EPMKLGLDLSGGVHFQLEVDVDAATERRL
Q21KW0_SACD2          QEN----YVVAFNLAPTTPQWLVDLGA----GPMSLGLDLAGGVHFLLEVDTESVLAKEM
B3PDJ8_CELJU          -DG----YVVALNKASTTPGWLQALGA----EPMKLGLDLAGGVHFLLEVDTASAVAKRQ
C7RB47_KANKD          NQS----YVVALNLAPATPDWLSSLGG----KPMKLGLDLRGGIHFLMQVDMEQAMARQQ
B2FN02_STRMK          GEK----YTVALNLASTVPDWLANLGG----RPMVLGLDLQGGVHFVLQVDQKAALDKRL
A5EWX7_DICNV          YPD----AEISVNLLANTPRWMQALGL----DPANLGLDLRGGVSFLLQVDSKELLERRS
Q145I2_PARXL          SDPSDPQYIVALNLQSASPRWLTALHA----LPMYLGLDLRGGVHFLLQVDMAGALNKKL
D8INT3_HERSS          TDPSDPTYIVAFNLLPNTPQWLQSLHA----FPMYLGLDLRGGVHFLMQVDIKAVLNKRL
E6UXK2_VARPE          PNADEASYVVALNLVSRSPHWLTALHA----FPMYLGLDLRGGVDFLLQVDMRGVLDKKA
D6CKE5_THIA3          PNADDPRYVVAVNLLSRSPAWLTALNA----NPMYLGLDLRGGVHFLLQVDMQAAVHKKL
E8UEP8_TAYEM          PNPEEPNYVVALNLLSATPSWLQSLGA----NPMALGLDLRGGVHFLLQVDMKGALKSRY
E0XSS7_9PROT          PSKENPSYVVALNLVSSVPDWLSRLKA----LPMYLGLDLRGGVYFMLQIDLESAIFSKL
D7N3K1_9NEIS          EG-----YITALNLLADSPEWMAKINA----NPMFLGLDLRGGVHFTMQVDMKAAMQKTF
D7DM25_METV0          TD-----YTVALNLLSRSPNWLRSLGA----KPMYLGLDLRGGVHFLMQVDMKAALSKAA
Q0AG53_NITEC          SD-----YVVALNLLPNSPQWMRHIGA----LPMYLGLDLRGGVHFMLQVDMAGALTKSL
B6BWI8_9PROT          PN-----FVVALNLLPNSPKWLESIGG----QPMYLGLDLRGGVHFLMQVDLSNIEAKES
B7J4R7_ACIF2          ANA-----QVILSQMSAEPDWLRSIGG----KPVNLGLDLRGGVYLLLRVDTDAVIKHAL
Q0HXS6_SHESR          EPK-----ELTLALVSAAPSWLQNMGF----EPIKLGLDLRGGVQFLLDVDVQPVYQAQA
E1SV05_FERBD          PDD-----SLALSQQPAAPSWLLNMGF----GPMSLGLDLRGGVQFLLDVDMAPVMNAQQ
B7VQL0_VIBTL          PSE-----TVALTLEPSAPSWLTSLGF----QPIKFGLDLRGGVQFLLDVDLVPVFNAHA
Q7MD23_VIBVY          DDA-----NISFSYVSVAPQWLSDMGF----NPIKLGLDLRGGVQFLLNVDVDKAFDEQR
A1S8J5_SHEAM          NPA-----AITLSMVPAAPPWLNRLGL----SPIKLGLDLRGGVQFLMQVDTAPVFKAQG
A4SLM7_AERS4          DSA-----ALTLEFYSNAPTWISQLGA----APIKLGLDLRGGSQLLIGVDLSFVVDNQT
Q15N36_PSEA6          DDF-----QVRLGSQSAAPKWLQGMGM----SPIKLGLDLSGGVLFVLEVDTHKADQERL
Q3IL52_PSEHT          NT------QTKIVERATSPSWLQSFGL----SPIKLGLDLNGGVLFVLDVDLDKAIDEQL
A8EY98_RICCK          ---------------------------FLPHDSVNLGLDLRGGAHLLLDVDFESYLNDSM
B3CTC4_ORITI          ---------------------------WLPQKTINLGLDLKGGSYVLLQLDFDTYVTEQL
B9KH60_ANAMF          ---------------------------LISKKKANLGLDLQGGVYLLLEVDFHEYLKGRL
A0A0H3M0Z2_EHRRW      ---------------------------LISNKKVNLGLDLQGGVYLLLEADFKEYLKERM
B3CPT1_WOLPP          ---------------------------FTSKKRINLGLDLKGGSSLLLNVDLDFYFKEKL
Q2GDE0_NEOSM          -----------------------------SNKKINPGLDLRGGVSIIMSINRTGYIQEKL
D0RNY3_9PROT          ---------------------------IFPEKKVVLGLDLQGGSYLLLEVDSKPLFKEKI
Q4FM00_PELUB          ---------------------------SFISKKINLGLDLQGGSYLLLEIDNEPVEIQKL
Q7VFM8_HELHP          ------------------------------GRKIALGLDLQGGLNLLLGIKTQEAIKARF
C5ZWZ2_9HELI          ------------------------------GPKITLGLDLQGGLNLLLGVKTEEAVKTRY
E7A9U3_HELFC          ------------------------------GPKITLGLDLRGGLSLLLGVQIEEALKNKY
A0RNX0_CAMFF          ------------------------------GYKISLGLDLQGGLHMLLGVQTDEAITSKI
C3XE91_9HELI          ------------------------------YKKITLGLDLQGGLSLLLDVDVNEAVGNKY
SECD_AQUAE            ---------------------------------INLGLDLKGGVEFLLEPDFSVAIEREY
D3DH34_HYDTT          ---------------------------------VNLGLDLKGGISMLLEPDMDYALTQEY
B4U9J1_HYDS0          ---------------------------------VNLGLDLKGGISMVLAPDIDKVIKEEY
C1DVG5_SULAA          ---------------------------------PKLGLDLQGGISITLKVDIDKVIKDQY
E8T6K3_THEA1          ---------------------------------INLGLDLKGGTHLVLQIETQKALENEV
SECD_KORVE            -------------------------------NRIHLGLDLRGGTHLILQVVVNDAVNAET
E8X5K0_GRATM          -------------------------------DRIHLGLDLKGGIHLVLAVHVEEAVASTT
C1F9I4_ACIC5          -------------------------------NRIQLGLDLKGGTHLILQVMTDEAVAAQA
Q029K4_SOLUE          -------------------------------DNIRLGLDLKGGTHLVLEIQVQDAVKADA
SECD_PETMO            ---------------------------------INLGLDIQGGVLLE-------------
C5CF36_KOSOT          ---------------------------------IRLGLDIKGGALLE-------------
A6LP86_THEM4          ---------------------------------IKLGLDISGGARIE-------------
A0A1Q6S007_9FIRM      --------------------------------DIRWGIDIRGGVEA--------------
D3R265_MAGIU          --------------------------------EIRFGIDIRGGVEA--------------
B8I6M6_RUMCH          --------------------------------DIRTGIDIQGGVDAR-------------
B0SPU4_LEPBP          ----------------LEPTWIEDMIRGGKSLSIKLGLDLQGGMRVVLKGDFEDYTAKLR
SECD_TREPA            KSEQGF-VLYARPLMEQTYREAVLKMKRRQAQAVKLGLDLSGGTSVVIKADLSEV-----
Q73PW4_TREDE          SSKEKF-IPIAQSILETAYRDSILGIKNYQTNAVKLGLDLSGGMLVIIKADLDAAIS---
E1R5K7_SEDSS          EEA-------AFSAIEGYYRTKLFDLKDEGGSVLQLGLDLSGGMSILLEADLDSL-----
E0RQA9_SPITD          EKE-------ALETIEDYFRARIISLKELRNRTLQLGLDLSGGLTVTLAPDFSSL-----
D5UAD5_BRAM5          --------------------DDIQALKRLRSESVNMGLDLQGGIRIVLQADFEEYAAR--
SECD_LEPBD            --------------------------------KVKLGLDLRGGTSVVLQAQG--------
SECD_SEBTE            --------------------------------PINLGLDLRGGTSVVLEAQEEDGK----
A5TW61_FUSNP          --------------------------------PIKLGLDLKGGAYVVLEAVQDENSN---
SECD_GEMAT            ------------------------------RVPLKRGLDLQGGMHLTLEVD---------
B2A263_NATTJ          ---------------------------------INLGLDLSGGIYVLLEAE---------
SECD_ACIFV            --------------------------IKPLVSTVKQGLDLQGGTHVVLQAQ---------
D1BLM4_VEIPT          --------------------------IQPLAGSLKQGLDLQGGTHIVLEAE---------
B8CXF7_HALOH          --------------------------YYQYQ--LNLGLDLEGGSHIVLRAE---------
D9QVJ1_ACEAZ          --------------------------LLPINEAINLGLDLQGGTHVVLEAE---------
D5XEJ6_THEPJ          -------------------------HFKVFQKHINLGLDLQGGLHVVMEAV---------
Q2RHU6_MOOTA          -------------------------VFKPLINAQRLGLDLKGGVHVLIQAQ---------
Q3ABZ0_CARHZ          -------------------------AVKPLVKYTTLGLDLQGGVHVVFQAK---------
B0TF81_HELMI          -------------------------SYNPIVQNTKLGLDLQGGLHVVLQAV---------
C9R7V3_AMMDK          ----------------------KNIPWLPVTKHVRLGLDLQGGVHVVLQAV---------
B1I4K5_DESAP          ----------------------AGVPWLPLTQDINLGLDLRGGVHVVLEAV---------
C8W4E1_DESAS          --------------------YNKEISWMPLVKIINLGLDLRGGVHVVLQAE---------
A4J544_DESRM          ----------------------PNVKWLPLTKEIPLGLDLQGGVHVALEAH---------
Q0AX22_SYNWW          -------------------------TYQPILKNLNLGLDLRGGLHVVLEAQ---------
Q892A4_CLOTE          --------------------NIFGYKVKSFGETIKKGLDLQGGVSLVEE-----------
D9SMV2_CLOC7          --------------------GAYEYQIKSFGDRIGKGLDLVGGVSILMQ-----------
Q67LL8_SYMTH          ---------------------HPQTGSARILQHMKLGLDLQGGAHIVLEGV---------
D9TNU7_THETC          ---------------------AGNYSIKPVQDSIRLGLDLRGGVY-VLEQA---------
A4XIR1_CALS8          ---------------------IGTASIPSVKDVIRYGLDLKGGVYIVYEAA---------
E3GFZ5_9FIRM          ---------------------VGIYDIGNIGDHVHYGLDLTGGVNVVLQAE---------
D9RXQ2_THEOJ          ---------------------IGPYQVAPAKKAIKLGLDLQGGIYVLLEAK---------
E3PRC6_ACESD          ---------------------IGNIKLSPVGTQINQGLDLKGGVFVVYEAK---------
A6TQN4_ALKMQ          ---------------------VGNVAIRPIGESVRQGLDLQGGVYVVYEAQ---------
D4M8M0_9BACT          -------------------------YSWPIKGRINQGLDLRGGAHIVLQAK---------
E6SLR2_THEM7          -----------------------TLLDFKLQDRINRGLDLAGGVRVVLQGV---------
SECD_DICTD            ---------------------------ILLTFPFRYGLDIRGGIRVTLQCQ---------
SECD_DEHMV            ---------------------------------ILFGLDLKGGLHMVYQADLSN------
B3T9T5_9ZZZZ          -----------------------------NLLGLRLGLDLAGGVHLVYQAGSED------
SECD_THET1            -----------------------------RQAEVVEGLDLQGGLQVLLQARHV-------
B9KYU6_THERP          -----------------------------RSITVRLGLDLQGGVQLVLQARPP-------
A9B5U9_HERA2          -----------------------------RDVSTHLGLDLQGGSQIFLRPADP-------
A7NP80_ROSCS          -----------------------------RDVSVRLGLDLRGGTQVLLRAAEP-------
SECD_ANATU            -----------------------------RSMDLIQGLDLQGGVQVLLEADLP-------
SECD_PROMA            -----------------------------------LGLDLRGGSQLTLEVQALN------
B5IKE7_9CYAN          -----------------------------------LGLDLRGGSQLTLQVMPAG------
B4WJX6_SYNS7          -----------------------------------LGLDLRGGTQLTMQVSPTE------
D3EPH0_ATETH          -----------------------------------LGLDLKGGSQLTIQLKPTE------
SECD_ACAM1            --------------------------------KINLGLDLRGGSQLTLQVNPTE------
Q2JY13_SYNJA          --------------------------------EVRLGLDLKGGTQLTLQALPTE------
Q7NDR6_GLOVI          --------------------------------PTVLGLDLQGGSQLTLLAKPTD------
Q1AWD0_RUBXD          -------------------------------RATQLGLDLKGGVRVQLEGYQHG------
A0QWJ2_MYCS2          --------------------YLLVFLTGDKKPEPKLGIDLQGGTRVTLTARTPD------
A0A0H3MPV3_MYCLB      --------------------YLLAFLTGDKRVVPRLGIDLQGGTRVTLTARTPD------
C0ZZ50_RHOE4          --------------------YALVFFTGDKSATPKLGIDLQGGTRVTLTARTPD------
D0LCM8_GORB4          --------------------YGLIFFTGAKTLEPKLGIDLQGGTRVTLTARTEN------
D5UNI7_TSUPD          --------------------FGLIFFTGDKKPEPKLGIDLQGGTSVTLQATRPD------
D9UX19_9ACTN          --------------------YALVFFTGSGKATPKLGIDLQGGTRVTLTARTPD------
C7MQZ9_SACVD          --------------------YSLVFFTGDGSPTPKLGIDLKGGTRVTLTARTPD------
A4FBB0_SACEN          --------------------YALVFLTGDHKPLPKLGIDLQGGTRVTLTARTPD------
C6WCM7_ACTMD          --------------------YALVFFTGNGSAIPKLGIDLQGGTRVTLTARAPD------
C8XE16_NAKMY          --------------------YGLVFLTPGSN-TPKLGIDLQGGTRITLTARTVD------
D2S9I0_GEOOG          --------------------YGLVFLTGDTR-TPQLGLDLRGGTTVTLTAATPD------
Q4JVE1_CORJK          --------------------LGLIMFTGNKSFGPKLGIDLQGGTRVTLVPQ---------
C4LIX5_CORK4          --------------------YLLVFLTGNKKPEPKLGIDLQGGTRVTLVPQ---------
Q8NPZ9_CORGL          --------------------YALVLLTGDRSATPKLGIDLQGGTRVTLVPQ---------
D7BNQ2_ARCHD          ----------------FAALGFGTFTGAKNRFLPELALDLEGGTQIILTPATTD------
D6ZHF4_MOBCV          ----------------AGTL-VGSTIFSNGSYAPKLAIDLEGGTQLILTPKNTE------
B2GIL6_KOCRD          --------------AATLIWGV---GTDRTGWAPKLALDLEGGTQMVLSPSLQGE-----
A9WSE2_RENSM          --------------ALLLTGGS---LWWGASWAPKLALDLEGGTQMILAPKVDG------
E1VWF6_GLUAR          --------------TGVLVAGA---ANGKTGWGPKLALDLEGGTEMILAPRVQG------
C5CCH9_MICLC          --------------AAILGGGV---ASGAASWAPKLALDLEGGTQMVLAPETST------
B0REC2_CLAMS          --------------AGGNAASV---AFSNGSWTPKLALDLEGGTQIILAPQLDG------
E8NFI9_MICTS          --------------FGLNALGVY--AFKASSWTPDLALDLQGGTQIILQAQTTD------
D5UEN5_CELFN          --------------FASIFAG---TRWGDASLTPNLALDLEGGTQIILRPVAEA------
D1BGW2_SANKS          --------------FGSIGIG---TWQSDASWSPKLALDLEGGTQIILQPVTTD------
C5C5R0_BEUC1          --------------FGSVGAG---AKWGDASFTPELALDLEGGTQIILTPNTTD------
C7R4G5_JONDD          --------------AGALFAGV--TTSSEAQWTPKLALDLEGGTQIILQAVTAN------
D1BSK1_XYLCX          --------------AGTFIDGRSAENPDGAGFAPGLALDLEGGTQIILTPTATD------
Q83MZ7_TROWT          -----------------LSLDIWQVFFSGSTFLPKLALDLEGGTQIVLRAKSAE------
A6WCH6_KINRD          --------------FAAVGAGS---IWSTAKWSPGLALDLEGGTQVVLTPRATA------
E6SB77_INTC7          --------------AVL-AGGLF--QWAGGQLTPRLGLDLEGGTEMVLAPVIED------
C7NI44_KYTSD          --------------GGLGAAHLF--AKPQAQLTPLLGLDLEGGQQLILEPAIE-------
C7MCC2_BRAFD          --------------GGGIGAGVS---KGGWEPAPKLALDLEGGTQIILQAQSRD------
D6Y2C4_THEBD          ----------------------GVTAVLQKAFVPAFGLDLAGGTTVTLSPVTPD------
D2AWR2_STRRD          ----------------------GGVMFFNKAYAPEYGLDLAGGTTVTLQPVTPN------
D1AEV4_THECD          ----------------------TGVMFLHGQTTPRLALDLAGGTSVTLTAETEG------
A0LUK3_ACIC1          ----------------------YGGMAATGHYGPQLGLDLRGGTTVTLAAKPNP------
A8KZE4_FRASN          ----------------------YGLMAVTGIWTPKLGLDLQGGTSVILTPRSIT------
Q2JD92_FRACC          ----------------------YGLMAATGNWKPRLGLDLQGGTSVILTPRATQ------
E2PV76_STRC2          ----------------------TGGMFATGDTTPRLGIDLAGGTTITLKAKAEPG-----
E4N7T8_KITSK          ----------------------VALMFGTGNTKPRLGIDLAGGTSVTLTAKSD-------
C7QJQ1_CATAD          ----------------------VGTMIGTGHRTPQLGIDLAGGTTMVMTAQGN-------
D7GDS9_PROFC          ----------------------YGLMGLTKTWTPRLGLDLRGGTTITLTARNNS------
Q6A8K5_CUTAK          ----------------------YVLMGVMRTWSPKLGLDLRGGTSVTLTAKTE-------
D2PVF3_KRIFD          ----------------------FAIMGLTKTWEPKLGLDLRGGTTITLTAKSLA------
A1SJA9_NOCSJ          ----------------------YGLVALGGTWKPELGLDLKGGTRIMMTATGN-------
C4RGU0_MICS3          --------------YLLVFFSGGASGGFKDRLEPRLGLDLVGGTRLTLEATNSL------
A4X5X5_SALTO          --------------YLLVFFGGGASGSWQDRLEPKLGLDLVGGTRLTLEATNTV------
D3PYP7_STANL          --------------AGLLWLAAFAGTGFKSFPIPKLGLDLQGGMTMTLKASLPN------
E1QZN3_OLSUV          --------------------VAAAVGFTPLGERITQGLDIQGGVSVIMAANKAD------
C7LYS6_ACIFD          ------------------------------HDGPILGLDLQGGASVVYRPA---------
                                                          .:*: **                 

B1YJQ7_EXIS2          ------------------------------------------------------------
D6XWY8_BACIE          ------------------------------------------------------------
E3E8W8_PAEPS          ------------------------------------------------------------
C0ZAP6_BREBN          ------------------------------------------------------------
SECD_ALIAD            ------------------------------------------------------------
SECD_ANADE            ARRADEIGEFLK-GKNVAFTG----------------TKVVGGGAQVEVSAANPGEVKDA
Q08P79_STIAD          ERRGQQIVRYITQDKKLGELK----------------ADSNPERLTLTLTAADPA-TMDA
A9F8D1_SORC5          DRYYDDLRAALAKSFGFHEGD----------------KPPTIEEMQKLQTKLRIEKSREQ
Q6MKZ2_BDEBA          TRLISTIKAEMTKDNVAYA------------------DVKSEKPESGEVQVVVADAAGKA
E1X0T6_HALMS          KGYTRKVESLLADNGISSTPG----------------DLNLADEMDPMQTLVLASPADME
D0LJ86_HALO1          SEIKREFDAKMAERSIAGR-------------------VTTPRQPVGAINVILEEEAQKS
SECD_SYNFM            TRLAEDLKDAFRKEKIAFNKI----------------DKTGKWDIEVQLPGTEQQSQIGP
Q2LVH4_SYNAS          ERTAVDLKETLMDKRIRFKRL----------------ERSTSQNITVELPDSASRSAFDK
E1YHR5_9DELT          ERMANDLKGLFRSQHLSYQKI----------------ERIEGTKISIVLEGQENIDGFDK
E1QIL8_DESB2          ERTAQELERRLKSE-VRATRP----------------KAIGGNQIAITVAGENDLAKLKD
B8F9E3_DESAL          DRYSDDLKEGLRREHIRSKDQ----------------DLINGDTLTVTIIGSEALDKFKK
SECD_THEYD            ERIGMHLQSLL-EKKGLKPSV----------------KVQGE-KIFIQPVNEDVKKIIKE
D8PI89_9BACT          ERTAAGLQDLLVEKKIPAESV----------------KRTGSSQITIGFQNAELKAQVQK
B6ANM3_9BACT          QEIATAMKTPDMQPSIQGPAI----------------HFPVP----EGEQRETIKKRIAR
B5ECA4_GEOBB          DLIASDLEDSLNVRRIRIHQI----------------NRVGEDAIRLAFYDVNSAEN-EA
Q3A3C4_PELCD          DGIVDQVETELKEKDIIFKRV----------------SRVGNDRLVVVVYDDEAGKQVDA
D5MHP3_9BACT          DRLIAELRRETDKANILVEQM----------------TREGIDRIRIKLQATEGLEG--V
SECD_CALNY            DTLTGQIRKELRNSKINFAFV----------------QKNESGKISIGLSDPAERNKVKD
SECD_DESIS            DAMTNALRLEAQQQHLVIGTI----------------QRRGM-QILIPVPYAEEKAEFKR
C4XSM5_DESMR          AQMGRDVRDQVKDEGIVIQRPG---------------TSPDGKRLEFVLATPDKRDALDK
C7LN34_DESBD          TSIGQDLRLEAREKKILVLRP----------------RLLDSRRLEFTLLKQEQRAELDE
Q1MSC1_LAWIP          VLTGQDLRSTASKNGLTILKTK---------------ITPDGQ-LEFLLPRKEQENDLEE
SECD_MAGMM            NNMVDSARNLLRKERQRYRGI----------------EQVGADQVVIRLTPNSDTERMLS
SECD_RHOM4            TDVDETFEEVLAAARERA-RSG---------------DVSLIDAFVEEFERRDPNARLSR
D5HAA4_SALRM          VNKDEAFQQALRTAEQRA-EEE---------------NVSVVEAFVEEFEAENPDGRLSR
B3EJI9_CHLPB          WNKDDTFRRIIADVRSKT-AGS---------------NAQVIEVLVSEFQKRS--IRMSR
Q3ANT9_CHLCH          WNKDATFTAIMQSVRAQALAQS---------------DARVIDLLVQEFNKRN--IRLSR
B3QTH7_CHLT3          RNRDEKFEQIIQSVREQS-KTS---------------KSLITELLADAFKKEN--IRMSR
B0VHR7_CLOAI          RN----------------------------------------------------------
SECD_ELUMP            AARND-------------------------------------------------------
SECD_UNCTG            VKVKD-------------------------------------------------------
SECD_ACEP3            QTLAENTRDTL-------LKS-QLGYQNINVDADK-------NTVSFQPRDAAEADTDVA
Q0BS58_GRABC          ESLSDTARQAM-------RNA-HIFYTGLKAEPDA-------NRIVLSPRDPAQLNAAVA
D3NUL2_AZOS1          EGLVDGARQQL-------RTA-NVGYTALNAG--E-------RSLTVQLRDPAQADEAVK
D8JWH1_HYPDA          NNLRDEARKEL-------RDA-KIGFTGIGTQG--------LTQLVVKLAKPEEQAAALK
E3I016_RHOVT          QSIQTESRRSL-------SEA-RIAHSGVVIAG---------NQVRVNLRDPANTDAALT
E2CQN1_9RHOB          KGLVGDIRATL-------REQPRIGYTGLGVQG---------EAAQVRIRDLTKLADAEE
A7HXL0_PARL1          QSLVNDVRNAL-------RSE-RIPYTGLGLQG---------EGVSVRITNPEDVEKARE
B0UI92_METS4          QQLRDDVRRAL-------REEGVQADGGVQITP---------RGVQLRVSDPAARAKALP
A7IND6_XANP2          EQVRDEIRRVL-------RDQ-KIGYSNLAVRD---------TSVSLRLRDPADTQKAVA
A4U1K0_9PROT          SAMVETLRATL-------RKE-KVRYSELGISGL--------DSVKVRISDEAERERVRP
D5BQT5_PUNMI          DSIGETIRQEF-------RND-KIRFADLKVDG---------KAVHVTIRDADDADKAEA
Q9A6U2_CAUVC          KNLVEDVRTVL-------RGE-QITFGELAEVN---------GTVRLRIADAAKVDEAAN
D9QLN2_BRESC          DNLIEDIRVGL-------REA-GIATNQITRES---------GGAVVTLADPSQAEAAYQ
Q5NL89_ZYMMO          VTMEEMVRSQI---S---RAQPAITIGDMSADN---------DQLSFMVRDNHQLDSAVE
Q1GSE5_SPHAL          TNMEKTVRTAMRGQS---GPDDDIAIGELSTTG---------GRISFLVRDAAKLDAARE
SECD_RHOCB            DALWPEVRKVL--------AAERATIGAIRRVPSP------EGELRIQIGERAQIARAVE
Q0C0W6_HYPNA          SVFARDVRSAFARTA---DREPIYFQPELRGRTML------IKLSRPDADGNYPVEEALR
C6XJ02_HIRBI          LELSRDIQRTLIKKP---N------NVKFRGREVV------DGGVRFRVMEPTQIDEAKR
Q0ANE6_MARMM          ETLASDIRTTLRDAP---P-------VLARSVAVI------GDEVVVLLVRPEERDTALE
Q2RTI1_RHORT          VALAASAGAAL-------RGERIGGAANLGEDG----------AVVVDIADAGQRAAALR
SECD_ECOLI            EQNIDSLRSDLREKG--------IPYTTVRKEN--------NYGLSITFRDAKARDEAIA
C4K8M1_HAMD5          IQNMDSLRRELQEKN--------ITYTQITKQNSTH-----GYGIEIDFSDAKSRDEAMS
SECD_HAEIN            EQLQDSLRGELRKEK--------IQYTAIKNTE--------HFGTLITLANVSQRAKAER
A1SWT8_PSYIN          EQMVQDLRGDLRTEK--------IRFRGITKANS-------ATGVLVTFTEQSILDSAID
Q493H1_BLOPB          EQYINSLRVILFEKN--------IPYLQIYKIK--------NNDIEINFKNSNYRNKAIL
Q7VQA9_BLOFL          IQYMDIVQDNLNEKN--------IVYLKICAIN--------CSDIEIIFKNSDDRNQAIS
B8GTQ2_THISH          ERYVGEFRSLLRDER--------IRYLSVERAS--------E-GVVVRFRDAAERDQAGD
Q31FZ7_HYDCU          NRYVDEVKGAFREAR--------IRYLSVSYET--------D-HLMIKFRDAKSVSAAQA
D0KW97_HALNC          ERRVDGMRGDLRQAN--------IRYVAADVEN--------GDEIALRFPDAAARDAALK
Q60B03_METCA          DRYAEDARSLLRENK--------IRYQSVEKQN--------G-VIQVRLPDPNALSQAQV
A1WXP8_HALHL          EGHQQDIRTLFREER--------IRFSALEVTD--------EQQIRMAFADTDLRARALE
D3RSH9_ALLVD          ERYSGDLRTLLREDK--------IRYLTL-TRD--------GTNILIRFEDAASREAGEK
D0U555_9BACT          DRYYNELRATLRKDK---------LYKKIQKNE--------D-ILLVSFKTEELKNKAKK
Q5ZU07_LEGPH          EGIMKNIGQELREAG--------IRYSGIRYLS--------DKGIELRFRDSDSMENALV
A9KE82_COXBN          TGDLHTMSTALREAR--------IRYTEMSSDQ--------N-GVMIHFRDQAARDQART
A0A0E1PNG4_ACIBA      ETSATDLRRQFRENK--------IKFNNLALNN--------NV-ITVQFADNADRDAAMD
Q0VS97_ALCBS          EAWEGTAKLTLRDAG--------VRYREVSVDG--------TT-LIATFGDQVAADAARA
A4GHV3_9BACT          DGTLQDLRRRFREEK--------IRYSQAGVES--------DASIYLKFNNPDVLQKAEE
A4GK28_9BACT          ESTASVIRNSLRDER--------VKTNFIEIEE--------NKILVSLVD--DEKTEIFN
Q1QTM7_CHRSD          EANASAVRDLLRDER--------IRYRDTSIDG--------RA-ITFQFANADDRNAARG
A1TZN9_MARHV          EALSGQIKRELREER--------IRYRGGDIED--------QARIVLSFRDEAARSEAFE
C3K1N2_PSEFS          KVYEGDVKSLLRKEK--------LRYRSLPQLN--------GA-IQLGFADEASREQARA
B8KXG6_9GAMM          AMYESGVKRQLREE----------RIRGLVTLD--------GTDLEMKFRSEADREAARA
Q21KW0_SACD2          EGFEDDISGLIRKEK--------LYGVSTRLT---------DGEIVITADSDDLRTDVLL
B3PDJ8_CELJU          EISADEMKDKLRKEK--------IRYASVDTDR--------DNRIVGRFRSADTRDQAIN
C7RB47_KANKD          EQLRRDFIESLTAEK--------PSIRGRVETI--------DNGLVISFRNQDDAERAFS
B2FN02_STRMK          DAYTEDVRSTLRDAR--------IAYQSVERRA--------DNSIVANLSPSAGDDAAQR
A5EWX7_DICNV          AELLDTLRATLQEKS--------LPHIRLENAD--------NGGALVWFQSQEERANALE
Q145I2_PARXL          DSDASDARTLLRDSN--------IRDGGVNRVN---------QTVVINFADQATADIASK
D8INT3_HERSS          QGMQASVRSLLRDKN--------IRHSGISRSG---------DSIEISFRDADTRNKARA
E6UXK2_VARPE          ESFAGDIRAGLRDKK--------VRGSAVNRNG---------QTVEITLRDAASLEIARR
D6CKE5_THIA3          DSISGELRRDLRDKD--------ARYTKLERVG---------DTLQGVFVDASALNTAKE
E8UEP8_TAYEM          NSLNTELRTLFRDSK--------ITAESIQLEG---------STITALFSNEKDANKAKD
E0XSS7_9PROT          ETLKSDVRSELRKSR--------IRHSGVRRED---------NTIIVKASSQEISEEIRK
D7N3K1_9NEIS          ERYSGDIRRELRRRK--------IRFGTIRQAE---------NGLIVPFQDASDVQKAIP
D7DM25_METV0          ERFVGDFKIALRKER--------ISYVGVSREG---------ETVQIHFNNAEELTKAHA
Q0AG53_NITEC          DRFSADLRSTLREQR--------IPSAGIERDR---------SKIIIRFRDEQAREKAIT
B6BWI8_9PROT          SGRVNEIRTLLRENK--------IRYDQISVED---------GSILVQLTNENDLKKSKS
B7J4R7_ACIF2          QQDSGSLRTFLRHRN--------LQYLAVNMTG--------PQSLAIEMENAAVAAQAQK
Q0HXS6_SHESR          GALVESLRQFLREQQIRGASVRIDSTRDDAGGQIAI-----AFNAVA-----ESTNNARS
E1SV05_FERBD          QAVMQSLRSTVR------------GVRAQAQHDHSV-----TTSALT-----DAQ---RQ
B7VQL0_VIBTL          QSVIDDLRQEFR-------------VRGRVENG-EV-----VIARYN-----EAL---LG
Q7MD23_VIBVY          DVLSDEIRAMLRT----------EKLRGVQVRNTGT-----AQLAVQ-----SDNAVALE
A1S8J5_SHEAM          EALKGAIRQVIRD----------KGLRSVAVLKDES-----RLTENPDALKLSGATQSLA
A4SLM7_AERS4          RNLVDMLRSQFRE----------ARLRGANVARVSE-----GEVRVI-LPEVADQAPWLN
Q15N36_PSEA6          GNAKDEALQLIHD----------KGLRGMSVKLADS-----QEKINL--HFLTHQASQVK
Q3IL52_PSEHT          VSAYQQAKSIIIK----------QKAHG--VKALQT-----QTGFVI--NTLPNAGDKLT
A8EY98_RICCK          ENLADTLRKNFREDK--------IGYKNLLVNQN---------QNSIQLELRTSK--ELK
B3CTC4_ORITI          NIIVGNLRKELRNNK--------IGYKELKIQK-----------QYIHLELRDSE--ARF
B9KH60_ANAMF          YGLSDTLQAFLLKEK--------ISYKRLYVKDD---------SLVLSLSNEK----DYA
A0A0H3M0Z2_EHRRW      YGLYDEVNEFLLSKN--------IKYKSFDVYED---------KLVLILKDSQ----DFD
B3CPT1_WOLPP          SMLTDEIKEGLLTQK--------IEFSAKN--DK---------QVVVTLNNID----DYK
Q2GDE0_NEOSM          RRLVSEILEFAKEKG--------IKIKKIGIDES---------NQIISISLEQSEENNIA
D0RNY3_9PROT          DTKAFDIRKKIRSER--------INYTNFKINNS---------QTISFQINLE----NKN
Q4FM00_PELUB          QNTTTVIRNFLKDKK--------ITFNDLRIED----------KKIIFSIPND----NIE
Q7VFM8_HELHP          SSLASQIVFDTKKEN--------ILIDNLKVFE---------DKISFELVDTDEKPMLDK
C5ZWZ2_9HELI          ASLASGINFYALEEQ--------ILLDGLRVDL---------ESVVFELLDSNEKTKIDN
E7A9U3_HELFC          TSIATSLDYALKAQN--------ILVKDLRSSL---------QGVEFDLLDPDETKALDK
A0RNX0_CAMFF          KSIASSIRYFTNKND--------ILVENLKTDT---------DTVHLTILDSDEAKKIDE
C3XE91_9HELI          SSMLSDLKHQTDKKN--------IFINKLRMQG---------DSISFILLDSSRTKDMES
SECD_AQUAE            EDLARNLREKL--SK--------FNVLEVYATK---------EGVIIELLDKKEVENIKK
D3DH34_HYDTT          ERYAKDIERKLRDAG--------INVLDVTSDK---------SGIKVEVLDKKDIDSISQ
B4U9J1_HYDS0          ENTASDISKLFLKNH--------INVLDVTPSQ---------DGIYIDLLNASDYSKVYE
C1DVG5_SULAA          LNVAKDIEKKFKENN--------IELLSSKLEN---------DTLKLILLDPTKIDKAVE
E8T6K3_THEA1          SAALRDIKRSLEEEN--------LPVVSAVRKG---------TTIEIEMLTADAAQKAQE
SECD_KORVE            DRAIERIKEDLANNK--------VTYSDITKPDAANAP----ERIAIKGITPDGATTLRR
E8X5K0_GRATM          DRDVQRLEAALPAGG--------VTGATVGKSDPAHQ-----DIITITGVPVGQMSSLRT
C1F9I4_ACIC5          AQDAETIQGDLQQNG--------ITGEQVTNPEPKQNP----GLVTIQGAPAAHVQDINS
Q029K4_SOLUE          DQTAERLKEDLKKQN--------ITWASMDTPDVAKVEDADNMAITIKGVPATQSSAFRS
SECD_PETMO            ------------------------------------------------------------
C5CF36_KOSOT          ------------------------------------------------------------
A6LP86_THEM4          ------------------------------------------------------------
A0A1Q6S007_9FIRM      ------------------------------------------------------------
D3R265_MAGIU          ------------------------------------------------------------
B8I6M6_RUMCH          ------------------------------------------------------------
B0SPU4_LEPBP          DLYAKEIAELNLTLNNPLAKP---------------------------------------
SECD_TREPA            ------------------------------------------------------------
Q73PW4_TREDE          ------------------------------------------------------------
E1R5K7_SEDSS          ------------------------------------------------------------
E0RQA9_SPITD          ------------------------------------------------------------
D5UAD5_BRAM5          ------------------------------------------------------------
SECD_LEPBD            ------------------------------------------------------------
SECD_SEBTE            ------------------------------------------------------------
A5TW61_FUSNP          ------------------------------------------------------------
SECD_GEMAT            ------------------------------------------------------------
B2A263_NATTJ          ------------------------------------------------------------
SECD_ACIFV            ------------------------------------------------------------
D1BLM4_VEIPT          ------------------------------------------------------------
B8CXF7_HALOH          ------------------------------------------------------------
D9QVJ1_ACEAZ          ------------------------------------------------------------
D5XEJ6_THEPJ          ------------------------------------------------------------
Q2RHU6_MOOTA          ------------------------------------------------------------
Q3ABZ0_CARHZ          ------------------------------------------------------------
B0TF81_HELMI          ------------------------------------------------------------
C9R7V3_AMMDK          ------------------------------------------------------------
B1I4K5_DESAP          ------------------------------------------------------------
C8W4E1_DESAS          ------------------------------------------------------------
A4J544_DESRM          ------------------------------------------------------------
Q0AX22_SYNWW          ------------------------------------------------------------
Q892A4_CLOTE          ------------------------------------------------------------
D9SMV2_CLOC7          ------------------------------------------------------------
Q67LL8_SYMTH          ------------------------------------------------------------
D9TNU7_THETC          ------------------------------------------------------------
A4XIR1_CALS8          ------------------------------------------------------------
E3GFZ5_9FIRM          ------------------------------------------------------------
D9RXQ2_THEOJ          ------------------------------------------------------------
E3PRC6_ACESD          ------------------------------------------------------------
A6TQN4_ALKMQ          ------------------------------------------------------------
D4M8M0_9BACT          ------------------------------------------------------------
E6SLR2_THEM7          ------------------------------------------------------------
SECD_DICTD            ------------------------------------------------------------
SECD_DEHMV            ------------------------------------------------------------
B3T9T5_9ZZZZ          ------------------------------------------------------------
SECD_THET1            ------------------------------------------------------------
B9KYU6_THERP          ------------------------------------------------------------
A9B5U9_HERA2          ------------------------------------------------------------
A7NP80_ROSCS          ------------------------------------------------------------
SECD_ANATU            ------------------------------------------------------------
SECD_PROMA            ------------------------------------------------------------
B5IKE7_9CYAN          ------------------------------------------------------------
B4WJX6_SYNS7          ------------------------------------------------------------
D3EPH0_ATETH          ------------------------------------------------------------
SECD_ACAM1            ------------------------------------------------------------
Q2JY13_SYNJA          ------------------------------------------------------------
Q7NDR6_GLOVI          ------------------------------------------------------------
Q1AWD0_RUBXD          ------------------------------------------------------------
A0QWJ2_MYCS2          ------------------------------------------------------------
A0A0H3MPV3_MYCLB      ------------------------------------------------------------
C0ZZ50_RHOE4          ------------------------------------------------------------
D0LCM8_GORB4          ------------------------------------------------------------
D5UNI7_TSUPD          ------------------------------------------------------------
D9UX19_9ACTN          ------------------------------------------------------------
C7MQZ9_SACVD          ------------------------------------------------------------
A4FBB0_SACEN          ------------------------------------------------------------
C6WCM7_ACTMD          ------------------------------------------------------------
C8XE16_NAKMY          ------------------------------------------------------------
D2S9I0_GEOOG          ------------------------------------------------------------
Q4JVE1_CORJK          ------------------------------------------------------------
C4LIX5_CORK4          ------------------------------------------------------------
Q8NPZ9_CORGL          ------------------------------------------------------------
D7BNQ2_ARCHD          ------------------------------------------------------------
D6ZHF4_MOBCV          ------------------------------------------------------------
B2GIL6_KOCRD          ------------------------------------------------------------
A9WSE2_RENSM          ------------------------------------------------------------
E1VWF6_GLUAR          ------------------------------------------------------------
C5CCH9_MICLC          ------------------------------------------------------------
B0REC2_CLAMS          ------------------------------------------------------------
E8NFI9_MICTS          ------------------------------------------------------------
D5UEN5_CELFN          ------------------------------------------------------------
D1BGW2_SANKS          ------------------------------------------------------------
C5C5R0_BEUC1          ------------------------------------------------------------
C7R4G5_JONDD          ------------------------------------------------------------
D1BSK1_XYLCX          ------------------------------------------------------------
Q83MZ7_TROWT          ------------------------------------------------------------
A6WCH6_KINRD          ------------------------------------------------------------
E6SB77_INTC7          ------------------------------------------------------------
C7NI44_KYTSD          ------------------------------------------------------------
C7MCC2_BRAFD          ------------------------------------------------------------
D6Y2C4_THEBD          ------------------------------------------------------------
D2AWR2_STRRD          ------------------------------------------------------------
D1AEV4_THECD          ------------------------------------------------------------
A0LUK3_ACIC1          ------------------------------------------------------------
A8KZE4_FRASN          ------------------------------------------------------------
Q2JD92_FRACC          ------------------------------------------------------------
E2PV76_STRC2          ------------------------------------------------------------
E4N7T8_KITSK          ------------------------------------------------------------
C7QJQ1_CATAD          ------------------------------------------------------------
D7GDS9_PROFC          ------------------------------------------------------------
Q6A8K5_CUTAK          ------------------------------------------------------------
D2PVF3_KRIFD          ------------------------------------------------------------
A1SJA9_NOCSJ          ------------------------------------------------------------
C4RGU0_MICS3          ------------------------------------------------------------
A4X5X5_SALTO          ------------------------------------------------------------
D3PYP7_STANL          ------------------------------------------------------------
E1QZN3_OLSUV          ------------------------------------------------------------
C7LYS6_ACIFD          ------------------------------------------------------------
                                                                                  

B1YJQ7_EXIS2          ------------------------------------------------GDVIDANAMSAT
D6XWY8_BACIE          ------------------------------------------------ETEITRGLLTDT
E3E8W8_PAEPS          ------------------------------------------------GQRVTSQSLIQT
C0ZAP6_BREBN          ------------------------------------------------GHKVDIELLKST
SECD_ALIAD            ------------------------------------------------GHPLDSTGKAAL
SECD_ANADE            VLGSTGYSEEMYS------------------PGGAPDGAVRFAFKDSVLRDFREKAVKQA
Q08P79_STIAD          IEKEVLTTFNDFT------------------KVGREGATLTLAPDESQTNFFRGEAVDQA
A9F8D1_SORC5          ADTIAITFNDPADSEKINDEFLAKFLHELQLQRSADRRVAKFRIRDEVSSNIRERAVSQA
Q6MKZ2_BDEBA          AVEKFISDKYSTVLQ----------------VVSSTDTSVTARYFDAYLNDYKNRVIQQS
E1X0T6_HALMS          TAKAKIHEFYQGYIR----------------ITGDTGANLQLALTKVLKTQIEEQSVSKS
D0LJ86_HALO1          AIDADFLSDYAEILENRD------------CPEGLEATSVCLLVSPEYADGIRKSAQEQA
SECD_SYNFM            LVEK-EFP-TLKWVSAET--------------QPEGTVKVMLTVHEKEVERVQKAAIAQG
Q2LVH4_SYNAS          SLKD-SYP-DLEVVSSET--------------V-EGIERVSLGVSERRKDEIRKLAIEQS
E1YHR5_9DELT          ILEK-EFK-ELRIVSRSN--------------D-GGLLKIVMDYPEKEAETIKKLAIEQA
E1QIL8_DESB2          IIEN-QYSNDYEIASTKP--------------LDRGRSEVVLRLKAEAIADIEKQASAQA
B8F9E3_DESAL          WAGE-EMS---ELVPDYD--------------PQGENTVCTFTMPESDQKAIMDSSRDQA
SECD_THEYD            ------NYADLSISEH--------------------GGNIICELPETAFKRVETTSVEQA
D8PI89_9BACT          MLDDFPTYVEVESAGS--------------------ANKVVWELRDAEIKRIKDSAINQA
B6ANM3_9BACT          HY----PYLTLSSSD---------------------ASGVTFSLSPAEQKRIRKHAMTQA
B5ECA4_GEOBB          QLIK-KKYPELEQIQIRD--------------SEGGMVHLEFRMEKKAVQDRKDKAVAQA
Q3A3C4_PELCD          FMAD-GGYRDLEPLTL-E--------------TQGGYIEKYFRFSSSAVASIQDNAVKQA
D5MHP3_9BACT          RRIL-KNYSNLQESGG------------------SGPTELILSLASGEMKRMQESAVRQS
SECD_CALNY            LISK--NYPILKESGLN-----------------SDEKVIELSLDTDEVKRIKDYAVEQA
SECD_DESIS            LMQR--RYGQLELQDE-------------------QPELLVYGYTTYDIEEIKELAVGQA
C4XSM5_DESMR          FLSS--HFSVLHVDGVES--------------AADNKLLYKLSFTQRYKDDQARMTVDQA
C7LN34_DESBD          LLGS--RFATMQIISAED--------------GGNGQLRYVLGVTPDYVKYLQDLTMDQA
Q1MSC1_LAWIP          LIVK--SYPQL-VLSKPT--------------TIDGSLKYYAHFTQQAKISIENMALEQA
SECD_MAGMM            VLKDELRESKVEHFQP--------------------EAQIRLTLGEAEKVEIRKFAVDQA
SECD_RHOM4            YFRNPDAGITRRSSNEEV---------------------------AAYLRQQAEEAVNRA
D5HAA4_SALRM          YFRNQGEDITRRSSNDEV---------------------------QEYLQGQADTAVQNG
B3EJI9_CHLPB          YFYEV------RDSDEEI---------------------------IVKLRKEAQDAVVRA
Q3ANT9_CHLCH          YFYDI------RNSDKEI---------------------------IGKLEKESEEALSRA
B3QTH7_CHLT3          YFYDI------RDSDADI---------------------------VEKLETEATEAVNRA
B0VHR7_CLOAI          -------------------------------------------------------AVEQN
SECD_ELUMP            -------------------------------------------------------AVSRA
SECD_UNCTG            -------------------------------------------------------AVSRA
SECD_ACEP3            TLDKLPRVV-PNEFSVK--------KQD--------DGTIALVLSADAIKARAREAVTQS
Q0BS58_GRABC          ALGKAVENE-VSANGVR--------EVEVKALEGAQAGQIALILPEAALHDRATAAVQQS
D3NUL2_AZOS1          ALRQLSSPVGRSALGVG--------QPD--LDVTVNGGTVTLALSEVALRDRATQAIEQS
D8JWH1_HYPDA          ALNKVRQPIGNALLGAGAY-----DVEVS---SGTEPGTIVIKESDQGLRQRVANAASAS
E3I016_RHOVT          KLKTLAQPLSTSLLTSSGG-----DTGMDVAVQSTQPGVITLEPTQAGIQRRIENAISRS
E2CQN1_9RHOB          RLQDLKNPLVSNLFAGQ--------PVDEFQINVSDDGLIRFTYTDEGLDNRLQSIVQQS
A7HXL0_PARL1          AIEGLSTIVSGNAFSTL--------PERDLAI-VTTERQITVALTEAEKIARTQSAVQQS
B0UI92_METS4          KLQALSQPVTDAVLGQT--------GARTLEVRDEPNGTIQLTFTEAGTNARVRRAVQQA
A7IND6_XANP2          ELRKLAVPVTNALFGNSS-------GELDLLVSSSSDGAVTVQLSEAGLNARMRSAVEQS
A4U1K0_9PROT          ELRKLDPEAQFEAG---------------------EGGLFTFTYPTPVMAKRINQAVDQS
D5BQT5_PUNMI          ILNELATGLNVAS----------------------NALVYVISFSETGLTELQSNTIAQS
Q9A6U2_CAUVC          LLRRSVGSPFAGSISGRD-----------VSVDKRDDQRLELSFIPEAAAQDASMAVDQS
D9QLN2_BRESC          ELRKLIGAPGANGAAER-------------AATRLSDGRVRLAFTQQTLDTMGATAVDQS
Q5NL89_ZYMMO          AVRTLTNGIGATGQRDW-------------DVRVVDGNRIVMRPTKAGIQSFVNQAMEGA
Q1GSE5_SPHAL          RLFSETQGAGLTGQRDW-------------NIDVVDSTRIVMSPTSAGQTQAVANAMDTA
SECD_RHOCB            VARTLASPVVSLTGVGQT-----------DYEVTGEGDTVVFRLSEAEKKATDDRTMQQS
Q0C0W6_HYPNA          RLDRINGPIEGGLAG---------GKTFEITRAG--QDGILVSVSSASESAMLEDALSKT
C6XJ02_HIRBI          RVRELSSPV-GGIGG---------QQSLNISEQ---NGVMNVTFSSARLEELEVEALNDS
Q0ANE6_MARMM          RIRELNAPVTTGIGQVGL------SNMYDIGADPSDPSAIRISVTSQQYESIRNRTLEQS
Q2RTI1_RHORT          LLRGLEAGTEAEITP---------------------AGAIRLTFTAIAQAERTDRMVARG
SECD_ECOLI            YLSKRHPD-LVISS--------QGSNQ------------LRAVMSDARLSEAREYAVQQN
C4K8M1_HAMD5          YLSSRQKH-MLINA--------DRGNK------------LKALMTSDRLREVREYAVQQN
SECD_HAEIN            IIRQLHPT-LDITE--------PDADS------------INLGLSTAALNEARDLAIEQN
A1SWT8_PSYIN          YLKPNNPG-YQFSE--------SVDNGR---------YILSIEMTEQKLQASKEYALQQN
Q493H1_BLOPB          PLSKIDNE-LILYA--------IGTNK------------LHVIFSERKKNAIREHAIHQN
Q7VQA9_BLOFL          CLSNCHNH-LIFNT--------INDCK------------LRISFSESYINTMYEYAMQQN
B8GTQ2_THISH          FLRREYRGDLDFRS--------DQAGEV---------FLLIASLTQDTLTDQRRLALQQN
Q31FZ7_HYDCU          EMEKQFPGEFNLAP--------VDGQN-----------ALELRLQPKTIEEAKTYALKQN
D0KW97_HALNC          SMAGNYPE-LKFST--------DERNGQ---------PFLTAKFTDVGATAERKAAVDQN
Q60B03_METCA          LLKRELRG-LQIDV--------KE--GE---------NLLEGRLSEVERREIKRFAVAQN
A1WXP8_HALHL          ALEEHIEG-LNYSE--------EEDEDT---------YTLIASMDEEELQEMKDLAVQQN
D3RSH9_ALLVD          KLKREFRE-LDFQP--------SEESGA---------FVLRAGLPETEQQKIKDFALQQN
D0U555_9BACT          VIKSDLPDLIIAEG--------SE--QE---------LELGYEISSSAQSAAKLSALKQN
Q5ZU07_LEGPH          ELRQKISD---VVF--------VKTKTQ---------NSILGAISPAELNSIRQNTIEQT
A9KE82_COXBN          LLEKQFPD---YRF----------EATA---------SSLRGTISITALHQIQQNAVDQI
A0A0E1PNG4_ACIBA      FLRRNGNEYTQQAL--------AST-TG---------SILKLTYTDVRRQEIQAYAVNQN
Q0VS97_ALCBS          PLRQALDKLAMQPA--------GDS-PR---------IVMTLNETALK--EMQDYAVDQN
A4GHV3_9BACT          FISDNYSQFNFPLI-----------SDA---------MSLRLVLSDLEIEQIESDAIDQN
A4GK28_9BACT          GIVNDLGNLDIDL------------DQN---------LVYELSFSDEEIDETIDYAVLQN
Q1QTM7_CHRSD          LITDQFPDFEYSTP--------DTE-RG---------ASLTMTFTDQAVQDLQDYAVNQN
A1TZN9_MARHV          LVRDQYNEFLLDET--------TEG-EE---------FLLTLTLSEAEVRNIQEYALEQN
C3K1N2_PSEFS          LIRKNFNDFDIVPA--------DLN-GQ---------AVLRLAMSPAKIAEIREYSIKQN
B8KXG6_9GAMM          ATADLYPELFLDRT--------EEG-DS---------WNLTASVTEQTLSEVVDYAVSQN
Q21KW0_SACD2          LLKKELSELETKRT--------ERG-GK---------YIVTAVPSDAYIREKEKHAVQQN
B3PDJ8_CELJU          SLRRDHPNQLFTRV--------DNGESN---------FSFVASLSETAVRTIESEAVSQN
C7RB47_KANKD          VLYQNYIDRIDINL--------AEQNNR---------PVVRATFNQTKLQAIQDNAIDQN
B2FN02_STRMK          ARAALVKAQPTLGY--------DVSGNR-----------ITVTVPETEIAQIANGAIEQN
A5EWX7_DICNV          TLYSRLPKGVQQFD--------AERDGQ---------FGLRFVYSEEAINAAKRRAADQN
Q145I2_PARXL          QLGRSISELQWASQ--------TGPDGG---------VQLVGTFTPTVQKAVQDAALKQN
D8INT3_HERSS          ALGELQEMLLTDAG--------SGDD-----------LKLIATLRPEALKQTQEDGVKQN
E6UXK2_VARPE          MLQDQMPDLSTVE---------SQQGTE---------SRIVASIKPEAARRFQDAALKQN
D6CKE5_THIA3          LITRQHPDLQLAP---------QAPAGS---------YSLSASLTPAAVSQEEDYAIKQN
E8UEP8_TAYEM          VIRQRLPELTTQY---------AEQNGK---------HVLTSTIAPNEVSRVQDTALKQN
E0XSS7_9PROT          SLKTNFPEISWNPSNLET-S--TEDKSL---------FFVTGTLSEENIFEIRENALKQN
D7N3K1_9NEIS          ELQKLFVEAKLEAD-------------G---------SNLILSLSEDAMQKVRSDAVKQN
D7DM25_METV0          VIAKEYPNLTLEES--------TIGEEK----------ILKASLNLVEQKSIQDFAIKQN
Q0AG53_NITEC          ELGKAFEDLAFQSE--------EVGGEA----------RLTISIKPEALVRMQNTAVQRN
B6BWI8_9PROT          LLLQDDSSFEFSKRINLG-G--SIGKEKIKEITDNGTFVLAIEGSQANKEEMTKFAIKQN
B7J4R7_ACIF2          AVAERYPDYAVVLQPH---------------------AVLSISITPDAASKMKDDALQQA
Q0HXS6_SHESR          TIRQFMQQSCPTWQ--------LTNADN----------GLVVKLAQEEQIKLRNLTVQQN
E1SV05_FERBD          QVIEVVKKDYPGWQ--------WRNHVD----------GLALSMKPEEQEQLTRLTVIQN
B7VQL0_VIBTL          DIRTHLRTQYPNWT--------LSQSGE----------RLMISMDEEEKRAIRTLTVTQN
Q7MD23_VIBVY          KVSNYLRSNYPNWQ--------VRTHSD----------SLEVKPSDAYAAEFQTTTLQQN
A1S8J5_SHEAM          ELRGWLLLNYPQWQ--------SESADG----------AILLRLKDTERVALVSQTLKEN
A4SLM7_AERS4          IIKDAAGTRQDQWT--------LNRSGN----------ELRLVMSEAERTLLANNAVTQN
Q15N36_PSEA6          KVVNELQQQLPGIT--------YTASGD---------RDAALVFSDQSVTTFHHEIMAQA
Q3IL52_PSEHT          PVIKELQSRFANLA--------VVTNNNG------TVKTAQFSYSEQGRSAFNKEVMSQT
A8EY98_RICCK          QLKKIINKI----------------DSEIIVEV-NEN-KIKLRYSDSRLNDLLNKVVDQS
B3CTC4_ORITI          KVENLLRNL----------------ETSILIKF-SQNNKLHISFTDHKLSELRESLIENS
B9KH60_ANAMF          RVKRF--------------------DANVTVSG--AYDRAAISFTSGYTKSLLRGVVSDS
A0A0H3M0Z2_EHRRW      RIKSFN-------------------DKNVRISK--QDVRIVMSFYDSYKENLLKNIITDS
B3CPT1_WOLPP          KVSTLIHKI----------------NPNLELSR--KNTAIFISYKPHYKNSLINEVVSES
Q2GDE0_NEOSM          VIRDFFKTS----------------DEIVFDSIDQKRAYMQLSYSERYLNEIDKKLLEDS
D0RNY3_9PROT          EIEKLLNNK--DINSR-------VDETNKELQFVINDNIVNINFSAAYLQRIKKNAMEQS
Q4FM00_PELUB          LVQSFFLDKESDINPYY------FQYKSHQFDVNIQDNEFTLTLSKYGLIEIKTSSQDQA
Q7VFM8_HELHP          ILSQIN--GLQVNENNG---------------------AYSIVFTAEYEEEIQSSALKQA
C5ZWZ2_9HELI          YLKEIQ--GLNVLEDNL---------------------KYTLTFTEAEIISIENYAIEQA
E7A9U3_HELFC          ILEDFKKDGAQVEHAQE---------------------HYTLSLSFEKAQTFQQQTLLQV
A0RNX0_CAMFF          MLKGIK--GLDIKKDGL---------------------NYRISLTAAEKIDTAKYAVDQA
C3XE91_9HELI          ILSNME--GVAWSQSGN---------------------TFNIALNEEAIKKVQKNALDQA
SECD_AQUAE            VI-QDINPNVIFEEEGD---------------------KLVVKFTQKYVEQLKEDIVRQS
D3DH34_HYDTT          MVSKDFPRFEVVSREKG---------------------QVLIKLKDDEIKKLKDSIAGQT
B4U9J1_HYDS0          LLTKYYKNRIDISKVSPL--------------------KVKVRFSSIYLSQIKENVITQT
C1DVG5_SULAA          VLKKEFPQLVVESSQDS----------------------ITVRFTDWELNRIKTQTMKQA
E8T6K3_THEA1          LIKEDYGRMFAIKRNGN---------------------RLTLSLKPSYVSKEIDRLAEQA
SECD_KORVE            VSD-ERLPEYSFGSGPEG--------------------SYTLTMKPAQLKDLKDRAVQQA
E8X5K0_GRATM          LVGGNDYASYEASSQPDG--------------------SMRLTMKPTAISDLEARTLETS
C1F9I4_ACIC5          VLQQQFSQEYTISQNGNT--------------------SWTLQMKPTVETQMKQKAVTQS
Q029K4_SOLUE          LVG-ERYPTYLLTATSST--------------------DYTMKLKPTDLQDLKVDTVKRA
SECD_PETMO            -----------------------------------------YSFDVPE-GVNTSEVVDNV
C5CF36_KOSOT          -----------------------------------------YALVTDTPKEEQSTIADRV
A6LP86_THEM4          -----------------------------------------YRVDIDKSVENPSKVAEDV
A0A1Q6S007_9FIRM      -----------------------------------------TFKPAGDV-DATDEQLESA
D3R265_MAGIU          -----------------------------------------VYAPKNFKGKPTEDQLQAI
B8I6M6_RUMCH          -----------------------------------------LYAVTKDNSKPKAEDLDAA
B0SPU4_LEPBP          -----------------------------EEKEKAQNRLSEIESSFDLSPMRKIVELEKA
SECD_TREPA            ----------------------------------------TKGVPDAERAAIRSEAMALV
Q73PW4_TREDE          ----------------------------------------ADGASSDTIADSKKAAMTLA
E1R5K7_SEDSS          ----------------------------------------EKRLGHPPTVDDQNQAVQRA
E0RQA9_SPITD          ----------------------------------------AERLGHEPTDVERRDAVDRA
D5UAD5_BRAM5          ----------------------------------------LDRNASSLTAEEKNDAMDRL
SECD_LEPBD            --------------------------------------------------KIEADTMSKV
SECD_SEBTE            --------------------------------------------------KLQPDTMDKV
A5TW61_FUSNP          -------------------------------------------------VKIDNEAMNRL
SECD_GEMAT            --------------------------------------------ESKQTVADKSEALDRA
B2A263_NATTJ          --------------------------------------------DVAGEDDD--DAIERA
SECD_ACIFV            ---------------------------------------------ETPESKVDDDAINRS
D1BLM4_VEIPT          ---------------------------------------------DSATGTADNDAVERA
B8CXF7_HALOH          ---------------------------------------------PTENREINNEIMKDI
D9QVJ1_ACEAZ          ---------------------------------------------PTEQSKVTNDSMQRV
D5XEJ6_THEPJ          ---------------------------------------------DTPEAPVTDDSLDRV
Q2RHU6_MOOTA          ---------------------------------------------STPDHAVTPDDMAAL
Q3ABZ0_CARHZ          ---------------------------------------------ELPGSPVNDKTMQST
B0TF81_HELMI          ---------------------------------------------ETPDRKVTQEEMQQV
C9R7V3_AMMDK          ---------------------------------------------DTPEAKVTPQAMKQV
B1I4K5_DESAP          ---------------------------------------------DTEDAKATPDAVQRS
C8W4E1_DESAS          ---------------------------------------------ETPGVSLTDDEIKKA
A4J544_DESRM          ---------------------------------------------DTEQAKVNDENMKQL
Q0AX22_SYNWW          ---------------------------------------------EKEGQKISADTINKA
Q892A4_CLOTE          ----------------------------------------------IQSDKVDAATIDRT
D9SMV2_CLOC7          ----------------------------------------------TDSD-VDEDTLNRT
Q67LL8_SYMTH          ---------------------------------------------ESELGPVTPDTIQAA
D9TNU7_THETC          ---------------------------------------------EGK---VTQDAMTRA
A4XIR1_CALS8          ---------------------------------------------KEN---PTKREMESA
E3GFZ5_9FIRM          ---------------------------------------------ATDDSGITSEKMDST
D9RXQ2_THEOJ          ---------------------------------------------PKPGETITDEKMNAA
E3PRC6_ACESD          ---------------------------------------------TDAKGEELNKIIDQT
A6TQN4_ALKMQ          ---------------------------------------------TDETGNELDRMMSQV
D4M8M0_9BACT          ---------------------------------------------DTPENPVGPDSIDRL
E6SLR2_THEM7          ---------------------------------------------DKPGNPVTREKIDDA
SECD_DICTD            ---------------------------------------------KTEGVEITDDAVRRT
SECD_DEHMV            -----------------------------------------------VDESNIDGVMDGV
B3T9T5_9ZZZZ          -----------------------------------------------VKPT--ADQMKGL
SECD_THET1            -----------------------------------------------GGKAPTREQMEEV
B9KYU6_THERP          -----------------------------------------------AGVTVTQDVLQGT
A9B5U9_HERA2          -----------------------------------------------NEADLAAK-LENA
A7NP80_ROSCS          -----------------------------------------------VERSV----MQTA
SECD_ANATU            -----------------------------------------------AETPIDPQALEDA
SECD_PROMA            -----------------------------------------------PNEQIKSEQLEAV
B5IKE7_9CYAN          -----------------------------------------------AIKRVDQEQLEAV
B4WJX6_SYNS7          -----------------------------------------------EIPSVGESELAAV
D3EPH0_ATETH          -----------------------------------------------DIKNISQEDLEAA
SECD_ACAM1            -----------------------------------------------EVKDITPNVMEAV
Q2JY13_SYNJA          -----------------------------------------------EVPEITSEVMQGV
Q7NDR6_GLOVI          -----------------------------------------------KVKTIDQEVMKGV
Q1AWD0_RUBXD          ------------------------------------------------GSEVTREEMQRA
A0QWJ2_MYCS2          ----------------------------------------------GSAPTRDA--LNQA
A0A0H3MPV3_MYCLB      ----------------------------------------------GSRPSREA--LSQA
C0ZZ50_RHOE4          ----------------------------------------------GSAPSQDS--LKQA
D0LCM8_GORB4          ----------------------------------------------GQQPSREQ--LDRA
D5UNI7_TSUPD          ----------------------------------------------GTVPDSNSPELEQA
D9UX19_9ACTN          ----------------------------------------------GGQPTRDS--LNQA
C7MQZ9_SACVD          ----------------------------------------------GSEPSREQ--LQQA
A4FBB0_SACEN          ----------------------------------------------GRPPTNES--LDQA
C6WCM7_ACTMD          ----------------------------------------------GKTPTDEA--LNQA
C8XE16_NAKMY          ----------------------------------------------GSDPTREQ--MQQA
D2S9I0_GEOOG          ----------------------------------------------GQAPDPTE--LELA
Q4JVE1_CORJK          ----------------------------------------------GDTPTPDQ--LSQA
C4LIX5_CORK4          ----------------------------------------------GSQPSNDQ--LEQA
Q8NPZ9_CORGL          ----------------------------------------------GQDPTQDQ--LNQA
D7BNQ2_ARCHD          --------------------------------------------GSE--VTDED--VKQA
D6ZHF4_MOBCV          --------------------------------------------AKAKAISDAD--IEQA
B2GIL6_KOCRD          --------------------------------------------KAGQDITQEQ--LDQA
A9WSE2_RENSM          ----------------------------------------------GASINDDQ--LNQA
E1VWF6_GLUAR          ----------------------------------------------DEAINQEQ--LDQA
C5CCH9_MICLC          ----------------------------------------------GESVTPEQ--LDQA
B0REC2_CLAMS          ---------------------------------------------ASSGPTSEQ--LAQA
E8NFI9_MICTS          ---------------------------------------------GAT-PDSEQ--LQQA
D5UEN5_CELFN          ----------------------------------------------EGRVTSET--IDQA
D1BGW2_SANKS          ----------------------------------------------GQTVTSED--INQA
C5C5R0_BEUC1          ----------------------------------------------GQEVTSDD--VNQA
C7R4G5_JONDD          ----------------------------------------------NEAVSAED--ISQA
D1BSK1_XYLCX          ----------------------------------------------GSQITDAT--VSEA
Q83MZ7_TROWT          -----------------------------------------------KEITSEQ--LQQA
A6WCH6_KINRD          ----------------------------------------------GGTVPPEQ--VQRA
E6SB77_INTC7          ----------------------------------------------GSAVNPGQ--LDRA
C7NI44_KYTSD          ----------------------------------------------GGEVSGGQ--VDQA
C7MCC2_BRAFD          ----------------------------------------------GSAIDSAA--MEQA
D6Y2C4_THEBD          ----------------------------------------------GGSPSQES--LDRA
D2AWR2_STRRD          ----------------------------------------------GTPPTEES--LNLA
D1AEV4_THECD          ----------------------------------------------GGSPPDAQ--MQQA
A0LUK3_ACIC1          ----------------------------------------------GQKVTSSE--LNTA
A8KZE4_FRASN          ----------------------------------------------GGSVDNGA--LNKA
Q2JD92_FRACC          ----------------------------------------------GNNVDSGA--VNQA
E2PV76_STRC2          ---------------------------------------------KESAVNETN--MNTA
E4N7T8_KITSK          ---------------------------------------------DPSAVNKTN--LDTA
C7QJQ1_CATAD          -----------------------------------------------KAPSTGD--MDTV
D7GDS9_PROFC          ---------------------------------------------DGSAPSKDN--LETA
Q6A8K5_CUTAK          ---------------------------------------------DGKAPSATS--LEQA
D2PVF3_KRIFD          ---------------------------------------------GGGTVTPEQ--LTEA
A1SJA9_NOCSJ          -------------------------------------------------PTSAN--LNEA
C4RGU0_MICS3          -----------------------------------------------DGKPPTAENLEEA
A4X5X5_SALTO          -----------------------------------------------DGQAPTAESLEEA
D3PYP7_STANL          -----------------------------------------------NG-TPDAARLEQA
E1QZN3_OLSUV          ----------------------------------------------GSTPSSDD--MATA
C7LYS6_ACIFD          -------------------------------------------------RPVSTAILNET
                                                                                  

B1YJQ7_EXIS2          LTAIENRVNVLGVSEPDIRIEGDN----------RIRVQLAGVKN--QSE-ARQILSSTA
D6XWY8_BACIE          VSALNARVDVLGVSEPSITIEGED----------RIRVQLAGIED--QSS-ARELLSTEA
E3E8W8_PAEPS          AQSLERRINALGTTEPEVTTEGTN----------RIRVRLAGVSN--EAE-VRSMLKKPA
C0ZAP6_BREBN          AHMIERRINIGGVAEPVTTTELPN----------RIRVQIASQSA--DQDKLRELIGKPA
SECD_ALIAD            VRAIEMRVNSLGVSSPIIQLEGRNQL-----GQDQIRVEVAGVKN--QQEAVSVIGATAQ
SECD_ANADE            EKVIRNRVDKWGVTEPDIKTKAN----------NQIQVQLPG--F-KDPEKAKELLGRTA
Q08P79_STIAD          MLVIRNRIDKWGVAELDVRKMGT----------DSIQISLPG--R-SDPEQAKELVGTTA
A9F8D1_SORC5          KETVLRRVDGLGLKEASVSTRDE----------DVIIEVPGDD-E-AAFTTIREIISQTA
Q6MKZ2_BDEBA          IETIRNRIDEFGVAEPSISQQGA----------NRILIQLPGM---ADAEKAKQLINTTA
E1X0T6_HALMS          IEVIRNRIDEFGVTEPEIISQGN----------DRIIIQLPGV---KDIERAKDLIGKTA
D0LJ86_HALO1          LIIIRDRINKRGVAEPSVKSKG-----------NQIVVELPGLDE-EEIERVKDLIGRTA
SECD_SYNFM            LETIRNRIDQFGVSEPDIRPQGE----------DRILVQLPGI---QDPQRAVELIGKTA
Q2LVH4_SYNAS          LETIRNRVDQFGITEPEIVPQGK----------DRILIQLPGI---KDPGRAKNLIGKTA
E1YHR5_9DELT          LETIRNRIDQFGVSEPDISLEGK----------DRIIVQLPGV---SDTQRAKELIGKTA
E1QIL8_DESB2          LEVIRNRIDQFGVAEPEIVPQEG----------GRILVQLPGV---KEPKRALALIGKTA
B8F9E3_DESAL          LETIRNRIDKLGVAEPDIRKQGE----------KRILVQLPGV---TDTQRAKDILVSTA
SECD_THEYD            IEVIRNRIDQLGVAEPAIHKQGE----------NEIVVQLPGV---KDPKKALEIIGKTA
D8PI89_9BACT          LETIRNRIDQFGVAEPLIQRQGL----------KQVVVQLPGI---KDAKLAKDLIKQTA
B6ANM3_9BACT          MEVIRNRIDQFGVAEPLIERQGK----------DRILVELPGI---NDPERAMSLIGRTA
B5ECA4_GEOBB          LETIRNRIDQFGVLEPVIQREGI----------DHIVIQLPGI---TDPKRAIELIGKTA
Q3A3C4_PELCD          LETLRNRIDQFGVSETVLQRQGS----------DRILVQLPGI---KDPRRAVDLLGKTA
D5MHP3_9BACT          LETIRNRIDQFGVAEPHIVQEGD----------RRIVVQLPGI---KEPQRAINLIGKTA
SECD_CALNY            VQVIRNRVDQFGVNEPVIQRQGK----------EHILVQLAGI---TDPERAVKLIGKTA
SECD_DESIS            LETIRNRIDQFGVSEPTVQKQGD----------RRIIIELPGV---EDVDRAVELIGRTA
C4XSM5_DESMR          VKTIRNRIDEFGVAEPDIRKQAD----------NRIQIQLPGL---QDPERAIKLIGKTA
C7LN34_DESBD          LKTIRNRIDQFGVAEPDIRKQQG----------NRIIVQLPGL---DDPKRAINIIGRTA
Q1MSC1_LAWIP          IRTIRNRIDQFGVSEPDIRKQDN----------FRIQIQLPGL---TDSTRAIHLIGQTA
SECD_MAGMM            IEIIRNRIDAFGVSEPSIQKQGE----------RRIIVQLPGI---KNPDRAKGLIGRTA
SECD_RHOM4            IEIIRDRVDRYGVTEPVIQKQGT----------RRIVVELPGV---DDPERVRRLLRGTA
D5HAA4_SALRM          IQVVRNRVNQYGVTEPSIQRQGD----------ERIVVELPGV---SDRERVRDLLESAS
B3EJI9_CHLPB          KEIIRNRVDQYGVAEPVIQSQGA----------RRIIVALPGV---SDEDRVRKLLRGSA
Q3ANT9_CHLCH          KEIIRNRIDQYGVAEPMITTQGS----------RKLVIELPGV---SDEGRVRNLLKGTA
B3QTH7_CHLT3          REIIRNRVDQYGVAEPVIQTQGG----------RRIIVELPGV---SDKQRVRKLLKGTA
B0VHR7_CLOAI          IKIIRERIDQFGVAEPSIQKLGE----------NRIMVQLPGV---SDYKAAENLIKQTA
SECD_ELUMP            IEIIRNRIDQYGVAETPITRQGE----------KWISVQLPGI---ANPAQAEALIGKTA
SECD_UNCTG            IEIIRNRIDQFGVTEPMIAKQGD----------KWIVIQLPGI---KDPKAAKDLIGKTA
SECD_ACEP3            IEIVRRRIDGTGAVDPEITRQGD----------DRIVVELPGISD---PERIKALLGTTA
Q0BS58_GRABC          IEIVRRRIDQTGVVDPNIARQGE----------DRIVVQLPGVDD---PQRIKDLLGTTA
D3NUL2_AZOS1          IEIVRRRIDETGVNEPTIARQGN----------DRILVQLPGVED---PDRIKRLLGTTA
D8JWH1_HYPDA          IETINRRVNNLGTSESTIVRQGA----------DRILIQFPGLKD---TTDLKKLIGETA
E3I016_RHOVT          IEVIRRRVDPQGTTEATIQAQGGANG------KDRILIQVPGLA----PDEVKSRVGTTA
E2CQN1_9RHOB          IEVIRRRVDELGTTEPNIQRQGT----------DRILVEAPGEND---PERLKDLVGQTA
A7HXL0_PARL1          IEIVRRRIDELGTTEPVIQQQGT----------DRILVQVPGLDD---PQRLKELLGQTA
B0UI92_METS4          IEVVRRRVDLGGTTEPSIQQQGA----------DRILVQVPGLQD---PQRLEEQLGKTA
A7IND6_XANP2          IEIIRRRIDQLGTVEPNIQRQGL----------DRILVQVPGLQD---PQRLKNLLGQTA
A4U1K0_9PROT          IGIVRRRVDELGTREPSIQRQGV----------DRIIVQLPGVKN---PEHIKSLLGKTA
D5BQT5_PUNMI          IEIIRRRLDPEGTKEPVIQRQGL----------DRVLVQLPGVDD---PEAVKRLLGRTA
Q9A6U2_CAUVC          IETIRRRIDTLGTKEPNITRQGA----------DRIVIQAAGESD---PERLKAVVGKTA
D9QLN2_BRESC          IEVVRRRIDSLGTREPSITRQGA----------ERIVVQAPGESD---PAALERVIGQTA
Q5NL89_ZYMMO          TEVVRKRIDSLGTREPIIIRQGS----------DRIVVQVPGLQN---PSALKALIGKTA
Q1GSE5_SPHAL          RDIIDKRVNALGTREPTIIREGA----------DRIVVQVPGLQD---PAALKELIGKTA
SECD_RHOCB            LEIVRRRVDAAGTREPTIMREGT----------DRILIEVPGIGS---AQELKDLIGTTA
Q0C0W6_HYPNA          MTIVRRRVDPEGVAEISLTPSGN----------NRIVLEAPGEPD---PERLKTLLSRDG
C6XJ02_HIRBI          IEVVRRRVDGSGTTDPNIQRQGS----------NRIVLEVPGLDD---PTELIELIQRAG
Q0ANE6_MARMM          ITVIRRRLDGLGTTDPTIARSGD----------RRVLVQVPGADD---PQEIIDLVGTQA
Q2RTI1_RHORT          LGVLRQRLREAGLSEIRLERRSD----------RRILVALPGLDD---SERVRDLLWRPA
SECD_ECOLI            INILRNRVNQLGVAEPVVQRQGA----------DRIVVELPGIQD---TARAKEILGATA
C4K8M1_HAMD5          MTILRNRVNQIGVAEPLVQRQG-----------DRIVVELPGIQD---TARAKEILGATA
SECD_HAEIN            LTILRKRVAELGVAEAVIQRQGA----------ERIVIELPGVQD---TARAKEILGATA
A1SWT8_PSYIN          LTILRNRVNELGVAEPLVQRQGT----------DRIVVQLPGIQD---TARAKEILGATA
Q493H1_BLOPB          CTILHHRIHQLGITEPLVQRHGS----------DRIIIELPGFQD---IEKIREMLGTTA
Q7VQA9_BLOFL          SNIIRYRINQLQISDPVIYRYGK----------DCVIIEIPGIQD---ISVIKTVLNNTA
B8GTQ2_THISH          ITTLRNRVNELGVAEPIIQQQGE----------DRIVVQLPGVQD---TARAKEILGATA
Q31FZ7_HYDCU          ITTLRNRINELGVAEPVIQQQGD----------RRIVVQLPGVQD---TAKAKEILGATA
D0KW97_HALNC          ITTLRNRVNELGVAEPLIQQQGD----------DRIVVELPGIQD---TVRAKEIIGATA
Q60B03_METCA          TTTLRNRVNELGVAEPVIQQQGE----------DRIVVQLPGVQD---TARAKEILGATA
A1WXP8_HALHL          ITTLRNRVDELGVAEPVIQRQGA----------DRIVVQLPGIQD---PGQAKEILGATA
D3RSH9_ALLVD          ITTLRNRVNALGVAEPSIARQGD----------RRIVVELPGAQD---PGRLKDILGATA
D0U555_9BACT          ITTLRNRVNELGVAEPIIQQQGT----------ERIVVQLPGVQD---TARAKEILGAVA
Q5ZU07_LEGPH          MSILRNRVNELGVGEAVVQQQGA----------TRVAVDLPGIQD---AARAKQILGGTA
A9KE82_COXBN          TTILRNRVNELGVAEPVIQQQGE----------SQISVDLPGIQD---TARAKDIIGKVA
A0A0E1PNG4_ACIBA      LTTLRNRINELGVAEALVQSQGS----------NRIVVELPGVQD---TAEAKRVLGRTA
Q0VS97_ALCBS          RTALNKRVNELGVAEAVVQRQGA----------DRIVVQLPGIQD---AATARRILGRTA
A4GHV3_9BACT          LTTLRNRVNELGVSEPIVQRQGK----------KRIVVQLPGIQD---TAEAKNILGKTA
A4GK28_9BACT          LTTLRNRVNELGVSEPVVQREGR----------KRISVQLPGIQD---TAEAKKIIGKTA
Q1QTM7_CHRSD          LTTIRNRVNELGVSEPLVQRQGP----------SRIVVELPGVQD---TAAAKRIVGATA
A1TZN9_MARHV          LTTIRNRVNELGVAEPLVQRQGA----------DRIIVELPGVQD---TAQAKRVLGATA
C3K1N2_PSEFS          LTTVRNRVNELGVAEPIVQRQGA----------NRIVVELPGVQD---TAEAKRILGKTA
B8KXG6_9GAMM          LTTLRNRVNELGVSEPLVQRRGA----------NRIVVELPGIQD---TAEAKRILGKVA
Q21KW0_SACD2          LTTLRNRVNEIGVSEPLVQTQGR----------NRIVVQLPGIQD---TARAKKILGKTA
B3PDJ8_CELJU          LITLRNRVNELGVSEPIVQSQGR----------SRIIVQLPGIQD---PAEAKRVIGKTA
C7RB47_KANKD          RLILSNRVNSLGVAEPLIQRQGS----------DRIVVQLPGVQD---SALAKRILGATA
B2FN02_STRMK          INTLRNRVNQLGVAEPIIQRQGA----------DRVVVQLPGVQD---TAEAKRMIGATA
A5EWX7_DICNV          RMRMASRVNSLGVAEPSVQVVGN----------DRILIQLPGIQD---VSKAKEILGSTA
Q145I2_PARXL          ITTLHNRVNELGVAEPVIQQQGS----------DRIVVELPGVQD---TAKAKDIIGRTA
D8INT3_HERSS          ISTLSKRVNELGVAEPLIQRQGA----------DRIVVELPGVQD---VSRAKDIIGRTA
E6UXK2_VARPE          VTTLHNRINELGVAEPVIQQQGL----------DRIVVQLPGMQD---PAQAKTIIGRTA
D6CKE5_THIA3          IQTLHNRINELGVAEPIIQQQGR----------DRVVVELPGIQD---VARAKDILGRTA
E8UEP8_TAYEM          IVTLHNRINELGVAEPIIQQQGN----------DRIVVQLPGVQD---IAKAKDILGRTA
E0XSS7_9PROT          ITTLSNRVNELGVSEPVIQQQGL----------DRIVVQLPGVQD---TAKAKDILGRIA
D7N3K1_9NEIS          ITTLHNRVNELGVAEPVIQQSGI----------DRIVVQLPGVQD---TAKAKDIIGRTA
D7DM25_METV0          IQTLHNRINELGVAEPIIQQQGA----------DRVVVQLPGVQD---TAKAKEILGRTA
Q0AG53_NITEC          ITTLRNRVNELGVAEPIIQQAGA----------DRVIVQLPGVQD---TAKAKDILGRTA
B6BWI8_9PROT          LETLNNRINELGVAEPIIQQQGE----------NRIVVQLPGVQD---TAKAKDIIGRTA
B7J4R7_ACIF2          IVVIRNRIDELGVSEPVIQRQGA----------DHIAVQLPGVQD---TQRAKSIIGSTA
Q0HXS6_SHESR          LQIMRSRIEELGITEALVQRQGE----------HRIRIELPGVQD---PAAAKNVIGATA
E1SV05_FERBD          LQILRSRIEELGITEAVVQRQGT----------NRIRIELPGVQD---PVAAKKVIGATT
B7VQL0_VIBTL          LQTMRGRIEELGITEAAVQRQGE----------NRIRIELPGVQD---PTSAKNIIGATA
Q7MD23_VIBVY          LKIMRGRIEELGITEALVQRQGA----------HSIRIELPGVQD---PAQAKNVIGATA
A1S8J5_SHEAM          ISIMRGRIQELGITEAIVQRHGE----------SRILVELPGVQD---PVAAKRVIGATA
A4SLM7_AERS4          LSILKKRINELGIVEASVQRQGQ----------DGIRIELPGVHN---PKQAKEVIGATA
Q15N36_PSEA6          LTTLRGRIEELGITEAVTQRQGQ----------NRIRIELPGVKD---PEQAKRIIGATA
Q3IL52_PSEHT          LTTLRSRIEELGITEAVTQRQGK----------QRIRIELPGVQD---PTEAKRIIGATA
A8EY98_RICCK          IEIVRMRVDSTGTKEPTLQKQGD----------KHILLQVPGEEN---PSYLKNILGKTA
B3CTC4_ORITI          MEIIRMRIDSSGTTEANIQKHGD----------NNIILEVPGIED---PKHLKNLVTKIA
B9KH60_ANAMF          IQNVQRRLDTSGTKEIIIKSYGE----------DKVSLQVPGIYN---PDSIKSLIGKTA
A0A0H3M0Z2_EHRRW      ISNIRRRLDKSGTKEITINSHGK----------DRISLQIPGIHD---TSQIKMLLGKTA
B3CPT1_WOLPP          IVNVQRRLDKLGTKEVSVQKQGQ----------NKILVQVPGVED---TQQIKSLLGKTA
Q2GDE0_NEOSM          INNLRRRVDEFGVRETLIYSLGG----------DRIAIEVPGLHD---PEELVTLLGKTA
D0RNY3_9PROT          LEIIRSRIDELGTREPTIIAQGE----------ERILIELPGIKN---PKRIKEIIGTTA
Q4FM00_PELUB          IEIVRRRVDEVGTNEPNILKRGN----------NRILVELPGLDD---PMRIKSLLGKTA
Q7VFM8_HELHP          IGTIRNRLDEFGLREPSVTQQGK----------DNILVQLPGIKTIEEEQRARDLIAKPA
C5ZWZ2_9HELI          IGNIRNRLDQFGLSEPSVTKQGT----------DSILVQLPGIKTQEDEQRALELISKGG
E7A9U3_HELFC          INTIRNRLDQFGLAEPTVLQQGK----------DAILVQLPGIKTLAEEQRAKDLITKSA
A0RNX0_CAMFF          VETIRNRLDQFGLAEPTVAKQGE----------NQILVELPGIKTAADEQRAKDLIAKSA
C3XE91_9HELI          IFTIRNRLSGFGLTEPNVLREGI----------NQIRVEMPGAQSEEEQKRLIKLISQNA
SECD_AQUAE            IEIIRDRIDKLGVTQPVVTRVGKY----------RILVDLPGFLD---VERAKKIIGSTA
D3DH34_HYDTT          VEVLRRRIDELGVVQPVITKVSGD----------RVLVELPGVLD---IDKAKSIIGKTA
B4U9J1_HYDS0          VEVLRRRVDQLGVVQPVITRLGNS----------KVMVELPGVMD---LERAKKVLGKTA
C1DVG5_SULAA          VETLRNRIDQFGTLSANIAQKGKD----------RILVEIPGVID---IERAKAIIGKTA
E8T6K3_THEA1          LETIRNRIDQLGVAEPVIVRNGKD----------RIIVELPGVKN---PERAKKIIGKVA
SECD_KORVE            IQKIRERVDSLGVSEPVIQEHGLG--------DYQILVQLPGVDD---PARVKEVMQSTA
E8X5K0_GRATM          IETIRQRVDSLGVSEPTIQKYGLG--------DNQVLVELPGIAN---ADEVEQAIQSTS
C1F9I4_ACIC5          IEVIRQRVDALGVTSPVVAPYNLG--------SDQILVELPGVDD---PARVRNVIQSTA
Q029K4_SOLUE          VDTIGNRIDQLGLAEKSVQQYGEAGK------KYEVLVQLPGVDD---PARAKELIGTAA
SECD_PETMO            ITVLRRRMDNAGYTEAIVSEVVSG---GES----RVRVEIPGISDTQRAEELIGSKGKLY
C5CF36_KOSOT          VEVLRKRLDAAGFTEATVEKVVASISFGEEVPSVRVRVQIPGITDIEKAEKLVGQTGKLY
A6LP86_THEM4          WTVLRNRLDMANYTEAVVKQTFRE----EN---TFIIVEIPGATDTAQAEQLIGSTGLLW
A0A1Q6S007_9FIRM      KSIIELRMVSQGITDYELYADAKS---------DRIIVRFPWK-EDSDQ-----------
D3R265_MAGIU          NKIMETRLDNLNILDRDIIIDRQN---------GYVIVRFPWKSKEAVF-----------
B8I6M6_RUMCH          RIIIGKRLDSKNIFDRVITVDKDK---------GYVLVQIPHK-KGEAF-----------
B0SPU4_LEPBP          KMIIDNRLTTQNLTEPQVRIQKEQ---------DAIEVSLPGVSNSAAILEILQ------
SECD_TREPA            LSTLENRINRFGLSEPVIRRQGED----------RVYVEIPGLTDRDRVHSIVMGRGVLA
Q73PW4_TREDE          MDTLRSRIDKFGLTDPVIRRQGDD----------RIYIEMPGAADADKINSIIMGRGILA
E1R5K7_SEDSS          MEILNNRIDKFGVTEPQIRQQGTN----------QINIDIPGAADPERVNSFLMGKGSLS
E0RQA9_SPITD          LEVLNNRIDRFGVTEPQIRKLEGN----------KILIEIPGDPDPTRVNSFLMGKGRLT
D5UAD5_BRAM5          ISRLRGRIDQFGVSEVGIRKQGED----------RVVVELPGARDPDRIKSVVLSQGALT
SECD_LEPBD            RNIIERRVNSIGVAEPVIQLSGN----------DKLIVELAGIKD---PQKAIELIGTTA
SECD_SEBTE            REIVQRRVDGLGVSEPVIQKSGE----------NRLIVELAGVKD---AQEAIDLIGTTA
A5TW61_FUSNP          IEVLNRRVNGIGVAESTIQKAGD----------NRVIIELPGLQN---TEDAINLIGKTA
SECD_GEMAT            LKVVRQRIDEFGVAEPVVQKAGS----------ERLIVELPGID---DAERAQDVVQKSA
B2A263_NATTJ          KTIIRSRVDELGVSEPVVQQEGA----------NRIRVELAGAGI--DRERAMDVIGRTA
SECD_ACIFV            IQIISRRVNELGLTEPVIQRQGK----------DKIIVELPGVKD---PEQAIAMLGKTA
D1BLM4_VEIPT          KQILERRINEMGLSEPLVQREGA----------RRIIIELPGVKD---PDEAIKRIGKTA
B8CXF7_HALOH          ENIIERRVNQLGLTEPVIQRQGK----------DRIIVELPAVDN---STEAINTIERTA
D9QVJ1_ACEAZ          ISVINRRVNQMGLTEPVIQREGD----------RRIIVELPGVEN---PNQAIETIGKTA
D5XEJ6_THEPJ          KAVIERRVNETGVKEPIIQREGK----------RRLIVELAGIKN---PDAAIDLIGKTA
Q2RHU6_MOOTA          ERVMRDRVDQLGIAEPVIQREGS----------DRLIIELAGVSN---PEEAIKMIGKTA
Q3ABZ0_CARHZ          ISIIETRVNELGISEPIIQKQGK----------DRIIVEIAGYKN---PEEAVRTLIKPA
B0TF81_HELMI          HAIMEQRINGLGVAEPLIQLEGT----------NRLIIELAGIQD---PDKAVDLIGKTA
C9R7V3_AMMDK          LAILQERVNRFGVTEPIIQQQGA----------RRVIVELPGVKD---PDEVVNTLIRTA
B1I4K5_DESAP          IGMLEERINQFGVTEPVIQQQGT----------NRIIVEIAGVDD---PDAVVRDLIRPA
C8W4E1_DESAS          MAVISNRVNQYGVAEPIIQQQGK----------DRVIVELAGIKD---PDEAVNNMVKTA
A4J544_DESRM          LEAIERRVNAFGVSEPIVQQEGD----------RRIIVELAGIKD---PDQAVRDIVKTA
Q0AX22_SYNWW          VGILRNRVDKLGVSEPLIYPQGE----------RRVVVELAGIDD---PEEAVNIIKNTA
Q892A4_CLOTE          IELLSMRVNKLGVSETSVTKEGQ----------KRIRIEIPGIYD---TKEVIETVGKTG
D9SMV2_CLOC7          ISLLDLRINKMGVSETTIAKEGD----------NRIRIEIPGKSN---TNEVINTVAKTG
Q67LL8_SYMTH          RQVIENRINALGVSEPIVQVDGQ----------NRIIVEIAGATD---IDQAREVIGKTA
D9TNU7_THETC          ISIIRNRVDSLGVSQPLIVQQGS----------NRIRIEIPGVND---PDQVISYLGQTA
A4XIR1_CALS8          VQLIRTRLDMRNFYDATATLQGS----------KRIRVEIPGVKD---PDEAIQYIGRTA
E3GFZ5_9FIRM          VAAIKKRVDSMGVSEAQVSKQGE----------DRIRVSIPSVQD---QQQALDMIGKTA
D9RXQ2_THEOJ          KEVIARRVDQLGVAEPVVVRQGE----------NRIRVELPGVKD---SQKALEVIGKTA
E3PRC6_ACESD          IEVFRKRVDGMGLTEPVIVKEGD----------NRIRIELPGVND---AQQAIETIGKTA
A6TQN4_ALKMQ          IEVFRRRVDSMGLTEPEIVREGD----------KRIRVALPGVEN---AQEAIEMVGKTA
D4M8M0_9BACT          LAVLRNRVDQYGVAEPIIQKSGE----------DRIIIDLPGIQD---PKAALELIGKTA
E6SLR2_THEM7          VEIIRNRVDALGVAEPVIQRQGE----------DRIVVELAGVKD---PQAAIETIGRTA
SECD_DICTD            IEVIRNRIDQLGVTEPSIYKEGS----------DKIVVELPGIKD---PERALEIIGQTA
SECD_DEHMV            VEVISNRINPLGVTEASIQRQGD----------DRIVVELPGLDI---TDEQKARIGRTA
B3T9T5_9ZZZZ          LTNIRRRVDSLGASEPNIQQLGE----------DRVLIQLPGLED---VDRAKRLIGQTA
SECD_THET1            RQVVEQRVNSLGLTEPVVQLQGS----------DRIVVELPGVKD---PEQAIRTFQGTG
B9KYU6_THERP          RDTIERRVNGLGVSEPVIQTRGT----------DQILVELPGFQD---PERAVRVLQRTA
A9B5U9_HERA2          AGVIERRVNGLGVSESVVQVVNS----------DSIVVELPGVKD---PAAASEALKGAG
A7NP80_ROSCS          AGVIERRINGLGVAESVVQLSGN----------DRIIVEIPGIAN---PEQAIETLRGTG
SECD_ANATU            RTILENRTNALGVSENLFQVAGE----------RRIVAEFPGLSD---PEKVLAVIKETG
SECD_PROMA            QSVLDRRVNGLGVAESSLRTIGT----------NQLILELPGEQE---PSKAARVLGKTA
B5IKE7_9CYAN          KEVLERRINGLGVAESTLQTVGT----------DQLVLQLPGEQD---PSRAARVLGSTA
B4WJX6_SYNS7          QRVIENRVNGLGVSEAVVQSVGQ----------DQLSIQLPGVSD---PEQAERVLGGTA
D3EPH0_ATETH          KTVLENRVNGLGVAEPIVQTLGK----------DKIVIQLPGVTN---PEQAERVLGGTA
SECD_ACAM1            QTVVANRLNPEGVSEIVVQTVGS----------QQILVQLPGVSD---PKDAEQLLSQVA
Q2JY13_SYNJA          EAVIQQRIDGLGVAEPLVQISGQ----------DRLFVQLPGVAD---PDRAIALLGDTA
Q7NDR6_GLOVI          AAVVEQRVNGLGVSEAVVQLKGS----------DQILVQLPGVKD---PTQAERLLGDTA
Q1AWD0_RUBXD          VEIIRQRVDSLGVTEPEIRLQGQ----------NQVLVDLPGISD---RDRAVEVIGRTA
A0QWJ2_MYCS2          QQIISARVDGLGVSGSEVVIDG-----------DNLVITVPGND-----GNEARNLGQTA
A0A0H3MPV3_MYCLB      QQIISSRVNGLGVSGSEVVVDG-----------DNLVITVPGND-----GNEARNLGQTA
C0ZZ50_RHOE4          QEIIETRVNGLGVSGSEVVVDG-----------DNLVITVPGDD-----SAQARSLGQTA
D0LCM8_GORB4          KQIIEQRVNGLGVGGSEVVING-----------DNLVITVPGKD-----GSQARTLGQTA
D5UNI7_TSUPD          RDIINQRVNGLGVAGSEVKING-----------SNLVITVPGED-----GDQARTLGQTA
D9UX19_9ACTN          RQIIETRVNGIGVGGTEVVLDG-----------NNIVITVPGEQ-----GDEAKNLGRTA
C7MQZ9_SACVD          RQIIENRVNGIGVSGAEVLLDG-----------NNVVITVPGDQ-----GEQAKTLGQTA
A4FBB0_SACEN          RQIIETRVNGMGISGSEVTRDG-----------SNLVITVPGAG-----GEEAKQLGQTA
C6WCM7_ACTMD          RTLIETRVNGLGVSGAEVVRDG-----------SNLVITVPGSD-----SEGAKSLGQTA
C8XE16_NAKMY          RTIMEGRVNGSGVVGAQVQIDGA----------NQLVVTVPGN-------EDLSGLTRTA
D2S9I0_GEOOG          RQIIEQRVNGLGVAEAEVVTEGD----------SNIVISVPGDD-----GEQARELGQTA
Q4JVE1_CORJK          RTILENRVNGMGVSGASVVTDG-----------NNLVITVPGSD-----AGEARSLGKTS
C4LIX5_CORK4          RKILENRVNGMGVSGATVQTDG-----------NTLVITVPGDD-----SAQARNLGQTS
Q8NPZ9_CORGL          RTILENRVNGMGVSGASVVADG-----------NTLVITVPGEN-----TAQAQSLGQTS
D7BNQ2_ARCHD          IEIIRQRVDASGVAEAEITAQGG----------SNIIVALPGQP----DKATLDLVRTSA
D6ZHF4_MOBCV          IEVIRQRIDASGVAEAEIARNGQ----------ENISVGIPGNP----SEETLALIQQSA
B2GIL6_KOCRD          VEIIRQRVDGAGVSEAEITTQSG----------SNIVVSMPGVP----SSETRDLIQTSA
A9WSE2_RENSM          ISIIRQRVDNTGVSEAQIST-SG----------SNVVVALPGEV----KPETRDLIKASA
E1VWF6_GLUAR          VEIIRQRVDGSGVSEPEITTQSG----------RNVVVSMPGTP----DQTTRDLIQASA
C5CCH9_MICLC          VEIIRQRVDGSGVAEAEVATQGS----------QNVVVSLPGVP----DEETRRLIQASA
B0REC2_CLAMS          VSIIRQRVDASGVSEAEITTQGG----------SNIVVSLPGEP----DAATMQRLQSSA
E8NFI9_MICTS          VSIIRQRVDASGVGETDIATEGS----------DKIVVQIPGEA----DEATRQRIQSSA
D5UEN5_CELFN          IAVIRQRVDASGVAEAEITSQGG----------NRIVVGLPGRP----SEETLDLVRTSA
D1BGW2_SANKS          IAIIRQRVDSSGVSEAEITSQGG----------SNIVVALPGQP----SQETLDLVRESA
C5C5R0_BEUC1          IAIIRQRVDGSGVSEAEITSQGG----------RNIVVAMPGNP----SQETIDLVSASA
C7R4G5_JONDD          IAIIRQRVDSSGVAEAEITSQGG----------RNIVVALPGNP----SEETLALVRESA
D1BSK1_XYLCX          INVIRQRIDANGVTEAEITSQGG----------QNIVVGIPGKP----DEATIALVSQSA
Q83MZ7_TROWT          VAIIRNRVDSSGISEAEISVQGS----------TNISVSIPGTP----SKEVYDRIRSSS
A6WCH6_KINRD          ADIIRQRVDATGLSETEVQVQGG----------QNISVSIPGQA----TREQLDLISQSA
E6SB77_INTC7          VEIIRQRIDANGVAESEISTQGG----------RNIVVAIPGTP----SEEQLDAIRKPS
C7NI44_KYTSD          VNIIRQRVDGSGVAEAEVTTLGG----------SNISVAMPGTP----DPAVLESLQASS
C7MCC2_BRAFD          RQIMSQRINAMGVAETEITVQGG----------TNIVIDVPGQL----DQATSQAIRQTA
D6Y2C4_THEBD          VAIIRARVNGTGITDAEVAKV-N----------DTIVVSIPGAG----RPEAIKLISTTA
D2AWR2_STRRD          VGIIRNRVNGSGISDAEVAKS-G----------DNIVISVPGAG----QEEVVKLVGTTA
D1AEV4_THECD          VKIIRNRVNGLGVSEAEVSRQGA----------DHIVVQVPGTGD---QRRVVDLIGTTA
A0LUK3_ACIC1          VNILRNRVNGLGVANADVHTE-G----------TNIVISVPGKD----KQGVLDKIGETA
A8KZE4_FRASN          VDIIRERVDGLGVAEAEVRRA-G----------DTIEISVPGRG----RNDVVDLVGQTA
Q2JD92_FRACC          VDIIRQRVDGLGVAESEVHRT-G----------NQIEISVPGRG----RNDVVDLVGQTA
E2PV76_STRC2          VGILERRVNGLGVSEAEVQTQGR----------SHIIVNIPKGTD---SEQARRQVGTTA
E4N7T8_KITSK          VNIIQKRVNGMGVSEAEVQTQGN----------ANIIVNIPDGGN---TQQSIDKVGDTA
C7QJQ1_CATAD          LQIMRNRVNGQGVSEAEVTKQGN----------NAIEVDLP-GKN---SSELLAQLGQTA
D7GDS9_PROFC          RSIIQKRVDALGVGESSVTVQGD----------RQIEVAVP-NVS---SDELVSLVGTTA
Q6A8K5_CUTAK          RLIIGQRVNALGVGESSVKTMGD----------RNIVVSAP-NVE---SSKLVEMVGQTA
D2PVF3_KRIFD          KNIISQRVNGAGVGEAEIATAGG----------SHINVAVP-GAS---QDSLIKQVGQTA
A1SJA9_NOCSJ          AGIIDQRVNGSGVAEAEVTTQGG----------RNIIVEIP-GPT---SNSLVGLATRTA
C4RGU0_MICS3          RQIIESRVNAYGVAEAEVVTEGN----------RNIVISLPGENR---D---LTDVGSAA
A4X5X5_SALTO          RQIIESRVNAFGVAEAEVVTEGD----------RNIVISLPGENR---D---LTEVGSAA
D3PYP7_STANL          RQIIEDRVNGTGVAEPEVYVEGS----------DHIVVNVAGKEA---NAEKLREVGAPA
E1QZN3_OLSUV          TTIVQNRVNSLGASETSVQQQGT----------NSILIQIPGATN---ADAAIQTIGQTG
C7LYS6_ACIFD          IGILRNRVDGLGIADPSIGQQGN-----------DIVVELPGVRD---PRQALALIGQTA
                         .  *                            :                        

B1YJQ7_EXIS2          ELSFRD------------------------------------------------------
D6XWY8_BACIE          RLSFRD------------------------------------------------------
E3E8W8_PAEPS          ELTFRSATAADAKKP---------------------------------------------
C0ZAP6_BREBN          HLTFRD------------------------------------------------------
SECD_ALIAD            LAIYGSAKIDPKTGK---------------------------------------------
SECD_ANADE            QLEFKIADDENP------------------------------------------------
Q08P79_STIAD          QLEFRMVDDTNP------------------------------------------------
A9F8D1_SORC5          RLEFKMVDDDQ-------------------------------------------------
Q6MKZ2_BDEBA          KLDFMIVSHE--------------------------------------------------
E1X0T6_HALMS          KLTFNLVNNE--------------------------------------------------
D0LJ86_HALO1          KLEFKMVAENSEYMRELYQHVSEDAKAKELGIDVGVDFWSH-------------------
SECD_SYNFM            QLEFKLVAEGVS------------------------------------------------
Q2LVH4_SYNAS          LLEFKLVDEGHS------------------------------------------------
E1YHR5_9DELT          LLEFKLLDETQD------------------------------------------------
E1QIL8_DESB2          QLEFRLVDDTID------------------------------------------------
B8F9E3_DESAL          QLQFRLLDDRQDQ-----------------------------------------------
SECD_THEYD            QLEFKLLDEETTLWK---------------------------------------------
D8PI89_9BACT          LLEFKLLDDENQLKL---------------------------------------------
B6ANM3_9BACT          RLQFLLVDDKN-------------------------------------------------
B5ECA4_GEOBB          RLEFKLVDENLSAS----------------------------------------------
Q3A3C4_PELCD          LLEFKMVAENIDLQ----------------------------------------------
D5MHP3_9BACT          LLEFKLVAEDANLA----------------------------------------------
SECD_CALNY            QLKFYLLDENANNE----------------------------------------------
SECD_DESIS            MLEFRLVNENVSTR----------------------------------------------
C4XSM5_DESMR          HLEFKVVDETVDM-----------------------------------------------
C7LN34_DESBD          HLEFKLVDDGADV-----------------------------------------------
Q1MSC1_LAWIP          HLTFHIVRDDLQQ-----------------------------------------------
SECD_MAGMM            RLDFKLVNEKGDLN----------------------------------------------
SECD_RHOM4            RLEFRLMADPQLLQAALQDIIAYYEPDT--------------------------------
D5HAA4_SALRM          QLTFHLMANPQQLGESVQRMIEYYEPTAEDSARIAEAQAAD-------------------
B3EJI9_CHLPB          KLEFKLVKDNESLLEALERINSSLAENEVSK-----------------------------
Q3ANT9_CHLCH          KLEFKLLREPELLVRALDRINSGLASGTMATSL-APTVAPD-------------------
B3QTH7_CHLT3          KLEFRLVRDKQVAFSVLEDINKYLASLEKATQSDSLAKIAE-------------------
B0VHR7_CLOAI          MLEFKLVAPQDEAKRVIETIDRNISSNLDKF-----------------------------
SECD_ELUMP            MLEFRIVKPQTSALDKAAAKIEDTEEPWD-------------------------------
SECD_UNCTG            LLEFRIVNTSEEARQVLDLIYEKRITPVQYR-----------------------------
SECD_ACEP3            KMTFRLVD----------------------------------------------------
Q0BS58_GRABC          KMTFHMVD----------------------------------------------------
D3NUL2_AZOS1          KMTFRLVDV---------------------------------------------------
D8JWH1_HYPDA          KLTFHEVHP---------------------------------------------------
E3I016_RHOVT          KLTFQLVDS---------------------------------------------------
E2CQN1_9RHOB          QLTFHMVDT---------------------------------------------------
A7HXL0_PARL1          KMNFRLVSN---------------------------------------------------
B0UI92_METS4          KLEFRMLAD---------------------------------------------------
A7IND6_XANP2          KLSFRMVDQ---------------------------------------------------
A4U1K0_9PROT          KLTFHLVDD---------------------------------------------------
D5BQT5_PUNMI          KLTFQLVDM---------------------------------------------------
Q9A6U2_CAUVC          KLTFQMVDD---------------------------------------------------
D9QLN2_BRESC          QLTFQMVDT---------------------------------------------------
Q5NL89_ZYMMO          KLEFKLVDD---------------------------------------------------
Q1GSE5_SPHAL          RLEFRMVDA---------------------------------------------------
SECD_RHOCB            KLTFHPVLS---------------------------------------------------
Q0C0W6_HYPNA          RMTFNLVES---------------------------------------------------
C6XJ02_HIRBI          VMTVNLVDE---------------------------------------------------
Q0ANE6_MARMM          AMSFHMVDE---------------------------------------------------
Q2RTI1_RHORT          RLSIRAAN----------------------------------------------------
SECD_ECOLI            TLEFRLVNT---------------------------------------------------
C4K8M1_HAMD5          SLEFHLVNT---------------------------------------------------
SECD_HAEIN            TLEFRIVNQ---------------------------------------------------
A1SWT8_PSYIN          TLEFHAVDS---------------------------------------------------
Q493H1_BLOPB          SLEFRLVNS---------------------------------------------------
Q7VQA9_BLOFL          SLEFRLVNT---------------------------------------------------
B8GTQ2_THISH          TLEFRLVD----------------------------------------------------
Q31FZ7_HYDCU          TLEFRLVE----------------------------------------------------
D0KW97_HALNC          TLEFRLVSG---------------------------------------------------
Q60B03_METCA          TLEFRLVDN---------------------------------------------------
A1WXP8_HALHL          TLEFRFVDH---------------------------------------------------
D3RSH9_ALLVD          TLEYRLVDT---------------------------------------------------
D0U555_9BACT          TIEFRMVD----------------------------------------------------
Q5ZU07_LEGPH          TLEFHLVD----------------------------------------------------
A9KE82_COXBN          TIRLQLVD----------------------------------------------------
A0A0E1PNG4_ACIBA      NLEFRLVSDLNDQYI---------------------------------------------
Q0VS97_ALCBS          TLEFRLVDN---------------------------------------------------
A4GHV3_9BACT          TLEFHLEAQ---------------------------------------------------
A4GK28_9BACT          NLEFRLEAK---------------------------------------------------
Q1QTM7_CHRSD          NLEFRLEAR---------------------------------------------------
A1TZN9_MARHV          NLEFRMEAR---------------------------------------------------
C3K1N2_PSEFS          NLEFRLAAE---------------------------------------------------
B8KXG6_9GAMM          NLEFRLVAE---------------------------------------------------
Q21KW0_SACD2          NLEFRLEAP---------------------------------------------------
B3PDJ8_CELJU          NLEFRLGAS---------------------------------------------------
C7RB47_KANKD          TLEFRLVNH---------------------------------------------------
B2FN02_STRMK          TLEYRAVVE---------------------------------------------------
A5EWX7_DICNV          TLEFYMVDDKA-------------------------------------------------
Q145I2_PARXL          TLEARLAD-PVN------------------------------------------------
D8INT3_HERSS          TLEVRMVDESVV------------------------------------------------
E6UXK2_VARPE          TLEMRLVDESTE------------------------------------------------
D6CKE5_THIA3          SLEVRMVDDSAA------------------------------------------------
E8UEP8_TAYEM          TLELRLVDDSPT------------------------------------------------
E0XSS7_9PROT          SLEIRLVDDSPE------------------------------------------------
D7N3K1_9NEIS          TLEVRMVEDDPA------------------------------------------------
D7DM25_METV0          TLEIRMVDEEKSD-----------------------------------------------
Q0AG53_NITEC          TLEVRMVDEE--------------------------------------------------
B6BWI8_9PROT          LLEMRLVDDEAS------------------------------------------------
B7J4R7_ACIF2          QLEFKMVDD---------------------------------------------------
Q0HXS6_SHESR          SLAFFEVK----------------------------------------------------
E1SV05_FERBD          SLAFYEVN----------------------------------------------------
B7VQL0_VIBTL          SLAFYHVE----------------------------------------------------
Q7MD23_VIBVY          SLAFYSVKSPS-------------------------------------------------
A1S8J5_SHEAM          SLSFHELK----------------------------------------------------
A4SLM7_AERS4          SLAFYQAQ----------------------------------------------------
Q15N36_PSEA6          SLDFYEMAQ---------------------------------------------------
Q3IL52_PSEHT          SLGFYQLK----------------------------------------------------
A8EY98_RICCK          KLTFHLVDE---------------------------------------------------
B3CTC4_ORITI          KLTFNIVDS---------------------------------------------------
B9KH60_ANAMF          KLTFHLLE----------------------------------------------------
A0A0H3M0Z2_EHRRW      KLTFHLLE----------------------------------------------------
B3CPT1_WOLPP          KLAFHLANT---------------------------------------------------
Q2GDE0_NEOSM          KLSFHMVVN---------------------------------------------------
D0RNY3_9PROT          KLSFKFLAN---------------------------------------------------
Q4FM00_PELUB          NLTFRFVTQ---------------------------------------------------
Q7VFM8_HELHP          HLQMMAVDEE--------------------------------------------------
C5ZWZ2_9HELI          HLQMMAVDES--------------------------------------------------
E7A9U3_HELFC          HLQMMAVDEE--------------------------------------------------
A0RNX0_CAMFF          HLQLMALDEK--------------------------------------------------
C3XE91_9HELI          QLEFMAVDEDLAR-----------------------------------------------
SECD_AQUAE            SLELKLVIDVSTD-----------------------------------------------
D3DH34_HYDTT          LLELKLVVGSGP------------------------------------------------
B4U9J1_HYDS0          QLELMEVVDASAS-----------------------------------------------
C1DVG5_SULAA          QLELKEVVDSAYS-----------------------------------------------
E8T6K3_THEA1          NLEFKEVVAEFRSPNQMIVNLGGKVPPGASVEV---------------------------
SECD_KORVE            MLEIRQVFGGPYS-----------------------------------------------
E8X5K0_GRATM          KLAVYAVVSGPYE-----------------------------------------------
C1F9I4_ACIC5          KLEFHLVEGGPWP-----------------------------------------------
Q029K4_SOLUE          VLEIVDVKEGPFP-----------------------------------------------
SECD_PETMO            FAEVLEVVESTTT-----------------------------------------------
C5CF36_KOSOT          FADVLAIETSDAT-----------------------------------------------
A6LP86_THEM4          FGQV--VDETTGN-----------------------------------------------
A0A1Q6S007_9FIRM      -NAIEAIEEISST-----------------------------------------------
D3R265_MAGIU          -DPAKAMKELGET-----------------------------------------------
B8I6M6_RUMCH          -DPQRSIEEIGKT-----------------------------------------------
B0SPU4_LEPBP          -NTETVEYRLEEP-----------------------------------------------
SECD_TREPA            FHLVDDDATQKLL-----------------------------------------------
Q73PW4_TREDE          FHIVDDEATQAFR-----------------------------------------------
E1R5K7_SEDSS          FHIVDQELSQKVV-----------------------------------------------
E0RQA9_SPITD          FHIVDDETTQKLI-----------------------------------------------
D5UAD5_BRAM5          FNLVDERATAALT-----------------------------------------------
SECD_LEPBD            KLEFRIKNKDG-------------------------------------------------
SECD_SEBTE            KLEFKIKTGDN-------------------------------------------------
A5TW61_FUSNP          LMEFKLMNEDG-------------------------------------------------
SECD_GEMAT            FLEFQITDKTQALEKVVPRFDEIAKTQGITVAS---------------------------
B2A263_NATTJ          QLEFYGPDLYRQIDVTEDEQIDLENK----------------------------------
SECD_ACIFV            MLEFK-------------------------------------------------------
D1BLM4_VEIPT          VLEFK-------------------------------------------------------
B8CXF7_HALOH          VLTFR-------------------------------------------------------
D9QVJ1_ACEAZ          QLKFK-------------------------------------------------------
D5XEJ6_THEPJ          VLQFK-------------------------------------------------------
Q2RHU6_MOOTA          QLEFK-------------------------------------------------------
Q3ABZ0_CARHZ          VLEFK-------------------------------------------------------
B0TF81_HELMI          LLTFR-------------------------------------------------------
C9R7V3_AMMDK          FLEFK-------------------------------------------------------
B1I4K5_DESAP          YLEFR-------------------------------------------------------
C8W4E1_DESAS          YLEFK-------------------------------------------------------
A4J544_DESRM          FLEFK-------------------------------------------------------
Q0AX22_SYNWW          ELEFW-------------------------------------------------------
Q892A4_CLOTE          ELKFV-------------------------------------------------------
D9SMV2_CLOC7          NLSFK-------------------------------------------------------
Q67LL8_SYMTH          VLKFI-------------------------------------------------------
D9TNU7_THETC          QLKFV-------------------------------------------------------
A4XIR1_CALS8          LIEFK-------------------------------------------------------
E3GFZ5_9FIRM          QLEFV-------------------------------------------------------
D9RXQ2_THEOJ          SLQFI-------------------------------------------------------
E3PRC6_ACESD          QLQFI-------------------------------------------------------
A6TQN4_ALKMQ          QLQFV-------------------------------------------------------
D4M8M0_9BACT          QMDFREVMDVTASTLSAPERKNYDSDLQFSQAQ---------------------------
E6SLR2_THEM7          RLEFR-------------------------------------------------------
SECD_DICTD            LLEFK-------------------------------------------------------
SECD_DEHMV            LLEFGELAADGEDYKWENSLGKW-------------------------------------
B3T9T5_9ZZZZ          QLRIVERVC---------------------------------------------------
SECD_THET1            LLEFIDAGD--TPLQVGTLVNTTLGPAITNGNQNQNSTK---------------------
B9KYU6_THERP          LLEIIDTKG--EFLPVGTIVNTTLGPASD--------VA---------------------
A9B5U9_HERA2          NLEFIDPQG--QYLPDGTEVCTTATPRYPITVQ---------------------------
A7NP80_ROSCS          KLEFIDTKG--EFLAPGAIVRTTGSPN-PIALR---------------------------
SECD_ANATU            LLEFVDLQDNPENLQEGNLILTDFGQT---------------------------------
SECD_PROMA            LLEFRKQKINTKSEMQRLQRIRSQVNNIDLYKKASK------------------------
B5IKE7_9CYAN          LLEFRAQRAGTEQEMQGLLQLKRQAEAVLGLARARQAALG--------------------
B4WJX6_SYNS7          QLEFRNQKPGTEGALAELQRIAQQQLAQQQLLLDGDGD----------------------
D3EPH0_ATETH          QLDFQEQRKGTEGQLSAEFKIRQQKNIELNTLKQKKPDL---------------------
SECD_ACAM1            QLDFRRPNNAILAQVNVRSSE-LQRLLQKLPEAEKAGD----------------------
Q2JY13_SYNJA          RLEFRKGLV---------------------------------------------------
Q7NDR6_GLOVI          QLEFRK------------------------------------------------------
Q1AWD0_RUBXD          QLGFYEVLAFEERAGVP-------------------------------------------
A0QWJ2_MYCS2          RLYIRPVIHAMAAQPP--------------------------------TEDGQPPAGAPG
A0A0H3MPV3_MYCLB      RLYIRPVLNSLPVQ------------------------------------RGQDPKPGSP
C0ZZ50_RHOE4          RLYIRPVTGSIDVATRDANR----------------------------TATPEVPAAETP
D0LCM8_GORB4          RLYVRPVIGE--------------------------------------------PQLARP
D5UNI7_TSUPD          RLLVRPVLSA---------------------------------------------VPATP
D9UX19_9ACTN          KLGIREVITSVPNTPAA---------------------------------PPSAPASGAP
C7MQZ9_SACVD          KLGFRQVLAAVPAAGPAQQ-------------------------------PESGAGSGED
A4FBB0_SACEN          ELNFRKVVPGMMVPATPPA-------------------------------PPNQAP----
C6WCM7_ACTMD          KLNFRKVIGAPLANQQAPST----------------------------ETPPSTSGSPAP
C8XE16_NAKMY          QLNIRPVVADSSGNPIVMYPAGYTPPQASTAT----------------TPSTATPATSGT
D2S9I0_GEOOG          QLRFRPVVQG---------------------------------------PEPAAPAAEET
Q4JVE1_CORJK          QLLFRPEAQPGQPTKDF---------------------------------PEAVKKMANR
C4LIX5_CORK4          QLLFRPVLNQQAAAQEVDRG----------------------------KLAQTVVDMANR
Q8NPZ9_CORGL          QLLFRPVGQAGMPDMTT--------------------------------LMPELEEMANR
D7BNQ2_ARCHD          VLRMRPVLSYANPKAISKED---LVKQLGDKAQ---------------------------
D6ZHF4_MOBCV          VMRFRTVLLSAPGNATNNEDPQALLGQLTGAAAPAGQGQPA----------------AGE
B2GIL6_KOCRD          QMAFRPVIV---------------------------------------------------
A9WSE2_RENSM          NMNFRSVIA---------------------------------------------------
E1VWF6_GLUAR          NMEFRPVLI---------------------------------------------------
C5CCH9_MICLC          DMQFRPVLQ---------------------------------------------------
B0REC2_CLAMS          KLELRPVLIGA----------------------------------------------AGT
E8NFI9_MICTS          QLQLRPVLF--------------------------------------------------T
D5UEN5_CELFN          QMEFRPVLVM---GAATPTTPAEDEP--------------------------------AA
D1BGW2_SANKS          QMQFRPVLSF---SMVAPTALPTEDPTTGPTAPTDV-----------------PTEDVAP
C5C5R0_BEUC1          VMRMRAVLVESGPGAIDPAALEPGEEPTDGSTADPT-----------------ADPTADP
C7R4G5_JONDD          QMQFRPVLYMGDPAPIEVETPADGETTN------------------------------DT
D1BSK1_XYLCX          QMRFRPVLTI--------------------------------------------------
Q83MZ7_TROWT          KMDMRAVLLTKPIQHAAMNE-------------------------------------GST
A6WCH6_KINRD          QLRMRVVLYAEPVTPPAAPTPTDGASAAPTDGATPTDGATATPTDGATPTDGATPTDGAT
E6SB77_INTC7          QLRFRAVFVQDFERAAPQAT-------PEGTPSGTATTG--------------TSSGTAT
C7NI44_KYTSD          RMTFREVLAVEGSATGPDTVDTLPGYEPSEEPSGEATPAGD-----------ATPSGDAT
C7MCC2_BRAFD          AMSFRPVLAMIAPEGAEEAQPSDGGG-------------------------------EAS
D6Y2C4_THEBD          ELRMRPVLAV---------APARPGP---------------------------------G
D2AWR2_STRRD          ELRFRQVMAV---------AAGSPPPP--------------------------------G
D1AEV4_THECD          QLQFRQVLVS---------AGP-------------------------------------G
A0LUK3_ACIC1          LLSIRQVYASND----PVMTGVTAPGL--------------------------------S
A8KZE4_FRASN          ELRFREVYQADV----AQSAPAPAATPA------------------------------PG
Q2JD92_FRACC          ELRFREVATSGQ----ATPVPTPTGA---------------------------------A
E2PV76_STRC2          QLYFRPVLQVAA--------GAPVPQQP------------------------------TP
E4N7T8_KITSK          KLYFRPVLAAEP--------SGAAAQQP------------------------------SP
C7QJQ1_CATAD          KLYFRVVVDPTTLQLPARTTPAPQPQTP------------------------------AP
D7GDS9_PROFC          QLGFRDVYSVTQ-------SSGPASGSS------------------------------SS
Q6A8K5_CUTAK          QLGFRMVYAEEP-------VSQKSPTPG------------------------------KA
D2PVF3_KRIFD          LLYFRVVYDAQA-------GAPLPAATP------------------------------TP
A1SJA9_NOCSJ          QLRFRTVACTSQ-------TPGPCATGA------------------------------AP
C4RGU0_MICS3          ELRFRKVLKAADGSGAAAAPAPTPTPAP-----------------------SGTAS--PA
A4X5X5_SALTO          ELRFRKVLQVTDGSGAAANPPPSPTSAP-----------------------SATPSESAA
D3PYP7_STANL          ELRFREVLAGPGEDYTQQDPEDFKKETQ-----------------------KDKDDKDKD
E1QZN3_OLSUV          HLEF--------------------------------------------------------
C7LYS6_ACIFD          VLQFRPVECTWAAYA---------------------------------------------
                                                                                  

B1YJQ7_EXIS2          ------------------------------------------------------------
D6XWY8_BACIE          ------------------------------------------------------------
E3E8W8_PAEPS          ------------------------------------------------------------
C0ZAP6_BREBN          ------------------------------------------------------------
SECD_ALIAD            ------------------------------------------------------------
SECD_ANADE            ------------------------------------------------------------
Q08P79_STIAD          ------------------------------------------------------------
A9F8D1_SORC5          ------------------------------------------------------------
Q6MKZ2_BDEBA          ------------------------------------------------------------
E1X0T6_HALMS          ------------------------------------------------------------
D0LJ86_HALO1          ------------------------------------------------------------
SECD_SYNFM            ------------------------------------------------------------
Q2LVH4_SYNAS          ------------------------------------------------------------
E1YHR5_9DELT          ------------------------------------------------------------
E1QIL8_DESB2          ------------------------------------------------------------
B8F9E3_DESAL          ------------------------------------------------------------
SECD_THEYD            ------------------------------------------------------------
D8PI89_9BACT          ------------------------------------------------------------
B6ANM3_9BACT          ------------------------------------------------------------
B5ECA4_GEOBB          ------------------------------------------------------------
Q3A3C4_PELCD          ------------------------------------------------------------
D5MHP3_9BACT          ------------------------------------------------------------
SECD_CALNY            ------------------------------------------------------------
SECD_DESIS            ------------------------------------------------------------
C4XSM5_DESMR          ------------------------------------------------------------
C7LN34_DESBD          ------------------------------------------------------------
Q1MSC1_LAWIP          ------------------------------------------------------------
SECD_MAGMM            ------------------------------------------------------------
SECD_RHOM4            ------------------------------------------------------------
D5HAA4_SALRM          ------------------------------------------------------------
B3EJI9_CHLPB          ------------------------------------------------------------
Q3ANT9_CHLCH          ------------------------------------------------------------
B3QTH7_CHLT3          ------------------------------------------------------------
B0VHR7_CLOAI          ------------------------------------------------------------
SECD_ELUMP            ------------------------------------------------------------
SECD_UNCTG            ------------------------------------------------------------
SECD_ACEP3            ------------------------------------------------------------
Q0BS58_GRABC          ------------------------------------------------------------
D3NUL2_AZOS1          ------------------------------------------------------------
D8JWH1_HYPDA          ------------------------------------------------------------
E3I016_RHOVT          ------------------------------------------------------------
E2CQN1_9RHOB          ------------------------------------------------------------
A7HXL0_PARL1          ------------------------------------------------------------
B0UI92_METS4          ------------------------------------------------------------
A7IND6_XANP2          ------------------------------------------------------------
A4U1K0_9PROT          ------------------------------------------------------------
D5BQT5_PUNMI          ------------------------------------------------------------
Q9A6U2_CAUVC          ------------------------------------------------------------
D9QLN2_BRESC          ------------------------------------------------------------
Q5NL89_ZYMMO          ------------------------------------------------------------
Q1GSE5_SPHAL          ------------------------------------------------------------
SECD_RHOCB            ------------------------------------------------------------
Q0C0W6_HYPNA          ------------------------------------------------------------
C6XJ02_HIRBI          ------------------------------------------------------------
Q0ANE6_MARMM          ------------------------------------------------------------
Q2RTI1_RHORT          ------------------------------------------------------------
SECD_ECOLI            ------------------------------------------------------------
C4K8M1_HAMD5          ------------------------------------------------------------
SECD_HAEIN            ------------------------------------------------------------
A1SWT8_PSYIN          ------------------------------------------------------------
Q493H1_BLOPB          ------------------------------------------------------------
Q7VQA9_BLOFL          ------------------------------------------------------------
B8GTQ2_THISH          ------------------------------------------------------------
Q31FZ7_HYDCU          ------------------------------------------------------------
D0KW97_HALNC          ------------------------------------------------------------
Q60B03_METCA          ------------------------------------------------------------
A1WXP8_HALHL          ------------------------------------------------------------
D3RSH9_ALLVD          ------------------------------------------------------------
D0U555_9BACT          ------------------------------------------------------------
Q5ZU07_LEGPH          ------------------------------------------------------------
A9KE82_COXBN          ------------------------------------------------------------
A0A0E1PNG4_ACIBA      ------------------------------------------------------------
Q0VS97_ALCBS          ------------------------------------------------------------
A4GHV3_9BACT          ------------------------------------------------------------
A4GK28_9BACT          ------------------------------------------------------------
Q1QTM7_CHRSD          ------------------------------------------------------------
A1TZN9_MARHV          ------------------------------------------------------------
C3K1N2_PSEFS          ------------------------------------------------------------
B8KXG6_9GAMM          ------------------------------------------------------------
Q21KW0_SACD2          ------------------------------------------------------------
B3PDJ8_CELJU          ------------------------------------------------------------
C7RB47_KANKD          ------------------------------------------------------------
B2FN02_STRMK          ------------------------------------------------------------
A5EWX7_DICNV          ------------------------------------------------------------
Q145I2_PARXL          ------------------------------------------------------------
D8INT3_HERSS          ------------------------------------------------------------
E6UXK2_VARPE          ------------------------------------------------------------
D6CKE5_THIA3          ------------------------------------------------------------
E8UEP8_TAYEM          ------------------------------------------------------------
E0XSS7_9PROT          ------------------------------------------------------------
D7N3K1_9NEIS          ------------------------------------------------------------
D7DM25_METV0          ------------------------------------------------------------
Q0AG53_NITEC          ------------------------------------------------------------
B6BWI8_9PROT          ------------------------------------------------------------
B7J4R7_ACIF2          ------------------------------------------------------------
Q0HXS6_SHESR          ------------------------------------------------------------
E1SV05_FERBD          ------------------------------------------------------------
B7VQL0_VIBTL          ------------------------------------------------------------
Q7MD23_VIBVY          ------------------------------------------------------------
A1S8J5_SHEAM          ------------------------------------------------------------
A4SLM7_AERS4          ------------------------------------------------------------
Q15N36_PSEA6          ------------------------------------------------------------
Q3IL52_PSEHT          ------------------------------------------------------------
A8EY98_RICCK          ------------------------------------------------------------
B3CTC4_ORITI          ------------------------------------------------------------
B9KH60_ANAMF          ------------------------------------------------------------
A0A0H3M0Z2_EHRRW      ------------------------------------------------------------
B3CPT1_WOLPP          ------------------------------------------------------------
Q2GDE0_NEOSM          ------------------------------------------------------------
D0RNY3_9PROT          ------------------------------------------------------------
Q4FM00_PELUB          ------------------------------------------------------------
Q7VFM8_HELHP          ------------------------------------------------------------
C5ZWZ2_9HELI          ------------------------------------------------------------
E7A9U3_HELFC          ------------------------------------------------------------
A0RNX0_CAMFF          ------------------------------------------------------------
C3XE91_9HELI          ------------------------------------------------------------
SECD_AQUAE            ------------------------------------------------------------
D3DH34_HYDTT          ------------------------------------------------------------
B4U9J1_HYDS0          ------------------------------------------------------------
C1DVG5_SULAA          ------------------------------------------------------------
E8T6K3_THEA1          ------------------------------------------------------------
SECD_KORVE            ------------------------------------------------------------
E8X5K0_GRATM          ------------------------------------------------------------
C1F9I4_ACIC5          ------------------------------------------------------------
Q029K4_SOLUE          ------------------------------------------------------------
SECD_PETMO            ------------------------------------------------------------
C5CF36_KOSOT          ------------------------------------------------------------
A6LP86_THEM4          ------------------------------------------------------------
A0A1Q6S007_9FIRM      ------------------------------------------------------------
D3R265_MAGIU          ------------------------------------------------------------
B8I6M6_RUMCH          ------------------------------------------------------------
B0SPU4_LEPBP          ------------------------------------------------------------
SECD_TREPA            ------------------------------------------------------------
Q73PW4_TREDE          ------------------------------------------------------------
E1R5K7_SEDSS          ------------------------------------------------------------
E0RQA9_SPITD          ------------------------------------------------------------
D5UAD5_BRAM5          ------------------------------------------------------------
SECD_LEPBD            ------------------------------------------------------------
SECD_SEBTE            ------------------------------------------------------------
A5TW61_FUSNP          ------------------------------------------------------------
SECD_GEMAT            ------------------------------------------------------------
B2A263_NATTJ          ------------------------------------------------------------
SECD_ACIFV            ------------------------------------------------------------
D1BLM4_VEIPT          ------------------------------------------------------------
B8CXF7_HALOH          ------------------------------------------------------------
D9QVJ1_ACEAZ          ------------------------------------------------------------
D5XEJ6_THEPJ          ------------------------------------------------------------
Q2RHU6_MOOTA          ------------------------------------------------------------
Q3ABZ0_CARHZ          ------------------------------------------------------------
B0TF81_HELMI          ------------------------------------------------------------
C9R7V3_AMMDK          ------------------------------------------------------------
B1I4K5_DESAP          ------------------------------------------------------------
C8W4E1_DESAS          ------------------------------------------------------------
A4J544_DESRM          ------------------------------------------------------------
Q0AX22_SYNWW          ------------------------------------------------------------
Q892A4_CLOTE          ------------------------------------------------------------
D9SMV2_CLOC7          ------------------------------------------------------------
Q67LL8_SYMTH          ------------------------------------------------------------
D9TNU7_THETC          ------------------------------------------------------------
A4XIR1_CALS8          ------------------------------------------------------------
E3GFZ5_9FIRM          ------------------------------------------------------------
D9RXQ2_THEOJ          ------------------------------------------------------------
E3PRC6_ACESD          ------------------------------------------------------------
A6TQN4_ALKMQ          ------------------------------------------------------------
D4M8M0_9BACT          ------------------------------------------------------------
E6SLR2_THEM7          ------------------------------------------------------------
SECD_DICTD            ------------------------------------------------------------
SECD_DEHMV            ------------------------------------------------------------
B3T9T5_9ZZZZ          ------------------------------------------------------------
SECD_THET1            ------------------------------------------------------------
B9KYU6_THERP          ------------------------------------------------------------
A9B5U9_HERA2          ------------------------------------------------------------
A7NP80_ROSCS          ------------------------------------------------------------
SECD_ANATU            ------------------------------------------------------------
SECD_PROMA            ------------------------------------------------------------
B5IKE7_9CYAN          ------------------------------------------------------------
B4WJX6_SYNS7          ------------------------------------------------------------
D3EPH0_ATETH          ------------------------------------------------------------
SECD_ACAM1            ------------------------------------------------------------
Q2JY13_SYNJA          ------------------------------------------------------------
Q7NDR6_GLOVI          ------------------------------------------------------------
Q1AWD0_RUBXD          ------------------------------------------------------------
A0QWJ2_MYCS2          APGAPGGAPGAPGLPGLP---------------------GLSGLPGMPGAPGAPGAPQEA
A0A0H3MPV3_MYCLB      AGTLPNFAPMPPDHPGAQ---------------------PRPYLQDPTSSPSSDPMPSPV
C0ZZ50_RHOE4          ATDAPAPEAPADGTPTPQ---------------------NRPFLAQDPTTPEATPAPETT
D0LCM8_GORB4          QAPKPEDQAPPPGQTQS-------------------------------------------
D5UNI7_TSUPD          QPNAPAPDLTNP------------------------------------------------
D9UX19_9ACTN          SAPATAPSKPAGGGG-------------------------AAGAPAQQ------------
C7MQZ9_SACVD          SDGEDGQGSESGEDGKD----------------TEQGSADEDGAADEDSDADSADSGDTQ
A4FBB0_SACEN          ------PQGPAGNSP--------------------------QGALNQQ------------
C6WCM7_ACTMD          TSGSQAPTSGAGAPPSEGASAPSTTGQGRPAPAYQQQPSGDAAQPSQSGQPQQSGAPESG
C8XE16_NAKMY          ETGASGSSAPGSAQTTVPAI-------------------GDTPAPTSAVVPAIGDTATAA
D2S9I0_GEOOG          PAGESAAPTDAAGESAAPA---------------------DPAAPSDPAAPS--DPAAPA
Q4JVE1_CORJK          WVENGIITPEFANERLSRM---------------------VKAFPQLGLKD---------
C4LIX5_CORK4          WVKTDVISPDNAQKALDEL---------------------KKQLEQYNSSGQAQGQEAFA
Q8NPZ9_CORGL          WVEYGVITEEQANASLEEM---------------------NTAVASTTAVEG----EEAT
D7BNQ2_ARCHD          --GLDPKTMTDEQYKDAVMK---------------------LADKNGDGQ------LSDA
D6ZHF4_MOBCV          TGGQQTQTTVGEGNNTVTIP---------------------PSAPTEKGQTQSLVLNSTD
B2GIL6_KOCRD          -TGPGEATPKDQR----------------------------------------------T
A9WSE2_RENSM          -AAPGTPTAPDKL----------------------------------------------T
E1VWF6_GLUAR          -TGGYAATPKEDR----------------------------------------------T
C5CCH9_MICLC          -SGPGEATPEDQR----------------------------------------------L
B0REC2_CLAMS          ASVAPTPTPTDGSAPADGTT---------------------PT--DGST--PAAEAPAAT
E8NFI9_MICTS          GSPATTFVGEDGN-----------------------------------------TTPYPT
D5UEN5_CELFN          EDGAQDPAVEDGAEDA------------------------------------AAAEDAAA
D1BGW2_SANKS          EDGATTDAPEEPATDATTEP---------------------AESGSGGG--VAAATDPAV
C5C5R0_BEUC1          TAEATDAAPDGALPRETTPT---------------------PSPSDEAT--SESGEEPTA
C7R4G5_JONDD          DDASDAQEPTADAQQDP----------------------------------AAESAEPVG
D1BSK1_XYLCX          --DYGFPLPEDESE--------------------------------------AADDETAD
Q83MZ7_TROWT          HAGSTASAAIGDKNATR-------------------------------------GSPKSS
A6WCH6_KINRD          PTDGATASPTQSADGAAAPA---------------------ALQAAGTA--TTAPAEPAP
E6SB77_INTC7          TTG--TPTPSASTTAASGVI---------------------PEGLRAA---TTAPTTSAT
C7NI44_KYTSD          PSGDASAEPSSSPTTAEGVW---------------------PAQATPSGEPTSSPSPSGS
C7MCC2_BRAFD          DGGGEAAEPSDAGGGADEET---------------------SEEPADPS--QHVFDGLVG
D6Y2C4_THEBD          PLPTPAPTAAAGQ------------------------------GPLPTA------APTPA
D2AWR2_STRRD          QMPTQAPTPAPSA------------------------------SPTATGKQNS-RAPKPG
D1AEV4_THECD          PLTGAGPSPSPSG------------------------------KEDKAGQ-----SPGPS
A0LUK3_ACIC1          ATPSASPPPAASS------------------------------SSSASPSP----SPSPS
A8KZE4_FRASN          TTPTPGATPAPGA------------------------------TPAPADIAPAPTATAPA
Q2JD92_FRACC          SAPTPGATGQPAP------------------------------TAGQSTPSIAPSSPAPA
E2PV76_STRC2          GASESGKPAEGKD------------------------------AKDAKDGDKASPSASTG
E4N7T8_KITSK          SASASGGASASPS------------------------------AGASAVAGSPSASASAP
C7QJQ1_CATAD          STPSPTGTATSPSGSASSTP---------------------SSTSSSKASSSPSSKASTP
D7GDS9_PROFC          S-PAATSNPTDVS-----------------------------TALPSS--------PAPK
Q6A8K5_CUTAK          K-PSAPSALPTVE-----------------------------PSASAS--------AAPD
D2PVF3_KRIFD          T-PTGKPSTTPKP-----------------------------SATPSAKPSSTLKPASPT
A1SJA9_NOCSJ          TLPNDGPSLAPTD-----------------------------GATGNSKNRPG-FLAKPS
C4RGU0_MICS3          PSGSAKPSGSASPSG-----------AKATASPSAG----------GQGGGAPAPSASAS
A4X5X5_SALTO          PSGSATPSGSATPSGSATPSGSATPSATGSASPTPSSSVQVTASPTGQGGGAPAPSASAT
D3PYP7_STANL          KESDKDSSDEEKADN-------------PSDDKSSK-----------DDKSESPSDDKSS
E1QZN3_OLSUV          ------------------------------------------------------------
C7LYS6_ACIFD          ------------------------------------------------------------
                                                                                  

B1YJQ7_EXIS2          ------------------------------------------------------------
D6XWY8_BACIE          ------------------------------------------------------------
E3E8W8_PAEPS          ------------------------------------------------------------
C0ZAP6_BREBN          ------------------------------------------------------------
SECD_ALIAD            ------------------------------------------------------------
SECD_ANADE            ------------------------------------------------------------
Q08P79_STIAD          ------------------------------------------------------------
A9F8D1_SORC5          ------------------------------------------------------------
Q6MKZ2_BDEBA          ------------------------------------------------------------
E1X0T6_HALMS          ------------------------------------------------------------
D0LJ86_HALO1          -----------------------------------------------------------D
SECD_SYNFM            ------------------------------------------------------------
Q2LVH4_SYNAS          ------------------------------------------------------------
E1YHR5_9DELT          ------------------------------------------------------------
E1QIL8_DESB2          ------------------------------------------------------------
B8F9E3_DESAL          ------------------------------------------------------------
SECD_THEYD            ------------------------------------------------------------
D8PI89_9BACT          ------------------------------------------------------------
B6ANM3_9BACT          ------------------------------------------------------------
B5ECA4_GEOBB          ------------------------------------------------------------
Q3A3C4_PELCD          ------------------------------------------------------------
D5MHP3_9BACT          ------------------------------------------------------------
SECD_CALNY            ------------------------------------------------------------
SECD_DESIS            ------------------------------------------------------------
C4XSM5_DESMR          ------------------------------------------------------------
C7LN34_DESBD          ------------------------------------------------------------
Q1MSC1_LAWIP          ------------------------------------------------------------
SECD_MAGMM            ------------------------------------------------------------
SECD_RHOM4            -----------------------------------------------------------T
D5HAA4_SALRM          -----------------------------------------------------------T
B3EJI9_CHLPB          ------------------------------------------------------------
Q3ANT9_CHLCH          -----------------------------------------------------------S
B3QTH7_CHLT3          -----------------------------------------------------------P
B0VHR7_CLOAI          ------------------------------------------------------------
SECD_ELUMP            ------------------------------------------------------------
SECD_UNCTG            ------------------------------------------------------------
SECD_ACEP3            ------------------------------------------------------------
Q0BS58_GRABC          ------------------------------------------------------------
D3NUL2_AZOS1          ------------------------------------------------------------
D8JWH1_HYPDA          ------------------------------------------------------------
E3I016_RHOVT          ------------------------------------------------------------
E2CQN1_9RHOB          ------------------------------------------------------------
A7HXL0_PARL1          ------------------------------------------------------------
B0UI92_METS4          ------------------------------------------------------------
A7IND6_XANP2          ------------------------------------------------------------
A4U1K0_9PROT          ------------------------------------------------------------
D5BQT5_PUNMI          ------------------------------------------------------------
Q9A6U2_CAUVC          ------------------------------------------------------------
D9QLN2_BRESC          ------------------------------------------------------------
Q5NL89_ZYMMO          ------------------------------------------------------------
Q1GSE5_SPHAL          ------------------------------------------------------------
SECD_RHOCB            ------------------------------------------------------------
Q0C0W6_HYPNA          ------------------------------------------------------------
C6XJ02_HIRBI          ------------------------------------------------------------
Q0ANE6_MARMM          ------------------------------------------------------------
Q2RTI1_RHORT          ------------------------------------------------------------
SECD_ECOLI            ------------------------------------------------------------
C4K8M1_HAMD5          ------------------------------------------------------------
SECD_HAEIN            ------------------------------------------------------------
A1SWT8_PSYIN          ------------------------------------------------------------
Q493H1_BLOPB          ------------------------------------------------------------
Q7VQA9_BLOFL          ------------------------------------------------------------
B8GTQ2_THISH          ------------------------------------------------------------
Q31FZ7_HYDCU          ------------------------------------------------------------
D0KW97_HALNC          ------------------------------------------------------------
Q60B03_METCA          ------------------------------------------------------------
A1WXP8_HALHL          ------------------------------------------------------------
D3RSH9_ALLVD          ------------------------------------------------------------
D0U555_9BACT          ------------------------------------------------------------
Q5ZU07_LEGPH          ------------------------------------------------------------
A9KE82_COXBN          ------------------------------------------------------------
A0A0E1PNG4_ACIBA      ------------------------------------------------------------
Q0VS97_ALCBS          ------------------------------------------------------------
A4GHV3_9BACT          ------------------------------------------------------------
A4GK28_9BACT          ------------------------------------------------------------
Q1QTM7_CHRSD          ------------------------------------------------------------
A1TZN9_MARHV          ------------------------------------------------------------
C3K1N2_PSEFS          ------------------------------------------------------------
B8KXG6_9GAMM          ------------------------------------------------------------
Q21KW0_SACD2          ------------------------------------------------------------
B3PDJ8_CELJU          ------------------------------------------------------------
C7RB47_KANKD          ------------------------------------------------------------
B2FN02_STRMK          ------------------------------------------------------------
A5EWX7_DICNV          ------------------------------------------------------------
Q145I2_PARXL          ------------------------------------------------------------
D8INT3_HERSS          ------------------------------------------------------------
E6UXK2_VARPE          ------------------------------------------------------------
D6CKE5_THIA3          ------------------------------------------------------------
E8UEP8_TAYEM          ------------------------------------------------------------
E0XSS7_9PROT          ------------------------------------------------------------
D7N3K1_9NEIS          ------------------------------------------------------------
D7DM25_METV0          ------------------------------------------------------------
Q0AG53_NITEC          ------------------------------------------------------------
B6BWI8_9PROT          ------------------------------------------------------------
B7J4R7_ACIF2          ------------------------------------------------------------
Q0HXS6_SHESR          ------------------------------------------------------------
E1SV05_FERBD          ------------------------------------------------------------
B7VQL0_VIBTL          ------------------------------------------------------------
Q7MD23_VIBVY          ------------------------------------------------------------
A1S8J5_SHEAM          ------------------------------------------------------------
A4SLM7_AERS4          ------------------------------------------------------------
Q15N36_PSEA6          ------------------------------------------------------------
Q3IL52_PSEHT          ------------------------------------------------------------
A8EY98_RICCK          ------------------------------------------------------------
B3CTC4_ORITI          ------------------------------------------------------------
B9KH60_ANAMF          ------------------------------------------------------------
A0A0H3M0Z2_EHRRW      ------------------------------------------------------------
B3CPT1_WOLPP          ------------------------------------------------------------
Q2GDE0_NEOSM          ------------------------------------------------------------
D0RNY3_9PROT          ------------------------------------------------------------
Q4FM00_PELUB          ------------------------------------------------------------
Q7VFM8_HELHP          ------------------------------------------------------------
C5ZWZ2_9HELI          ------------------------------------------------------------
E7A9U3_HELFC          ------------------------------------------------------------
A0RNX0_CAMFF          ------------------------------------------------------------
C3XE91_9HELI          ------------------------------------------------------------
SECD_AQUAE            ------------------------------------------------------------
D3DH34_HYDTT          ------------------------------------------------------------
B4U9J1_HYDS0          ------------------------------------------------------------
C1DVG5_SULAA          ------------------------------------------------------------
E8T6K3_THEA1          ------------------------------------------------------------
SECD_KORVE            ------------------------------------------------------------
E8X5K0_GRATM          ------------------------------------------------------------
C1F9I4_ACIC5          ------------------------------------------------------------
Q029K4_SOLUE          ------------------------------------------------------------
SECD_PETMO            ------------------------------------------------------------
C5CF36_KOSOT          ------------------------------------------------------------
A6LP86_THEM4          ------------------------------------------------------------
A0A1Q6S007_9FIRM      ------------------------------------------------------------
D3R265_MAGIU          ------------------------------------------------------------
B8I6M6_RUMCH          ------------------------------------------------------------
B0SPU4_LEPBP          ------------------------------------------------------------
SECD_TREPA            ------------------------------------------------------------
Q73PW4_TREDE          ------------------------------------------------------------
E1R5K7_SEDSS          ------------------------------------------------------------
E0RQA9_SPITD          ------------------------------------------------------------
D5UAD5_BRAM5          ------------------------------------------------------------
SECD_LEPBD            ------------------------------------------------------------
SECD_SEBTE            ------------------------------------------------------------
A5TW61_FUSNP          ------------------------------------------------------------
SECD_GEMAT            ------------------------------------------------------------
B2A263_NATTJ          ------------------------------------------------------------
SECD_ACIFV            ------------------------------------------------------------
D1BLM4_VEIPT          ------------------------------------------------------------
B8CXF7_HALOH          ------------------------------------------------------------
D9QVJ1_ACEAZ          ------------------------------------------------------------
D5XEJ6_THEPJ          ------------------------------------------------------------
Q2RHU6_MOOTA          ------------------------------------------------------------
Q3ABZ0_CARHZ          ------------------------------------------------------------
B0TF81_HELMI          ------------------------------------------------------------
C9R7V3_AMMDK          ------------------------------------------------------------
B1I4K5_DESAP          ------------------------------------------------------------
C8W4E1_DESAS          ------------------------------------------------------------
A4J544_DESRM          ------------------------------------------------------------
Q0AX22_SYNWW          ------------------------------------------------------------
Q892A4_CLOTE          ------------------------------------------------------------
D9SMV2_CLOC7          ------------------------------------------------------------
Q67LL8_SYMTH          ------------------------------------------------------------
D9TNU7_THETC          ------------------------------------------------------------
A4XIR1_CALS8          ------------------------------------------------------------
E3GFZ5_9FIRM          ------------------------------------------------------------
D9RXQ2_THEOJ          ------------------------------------------------------------
E3PRC6_ACESD          ------------------------------------------------------------
A6TQN4_ALKMQ          ------------------------------------------------------------
D4M8M0_9BACT          ------------------------------------------------------------
E6SLR2_THEM7          ------------------------------------------------------------
SECD_DICTD            ------------------------------------------------------------
SECD_DEHMV            ------------------------------------------------------------
B3T9T5_9ZZZZ          ------------------------------------------------------------
SECD_THET1            ------------------------------------------------------------
B9KYU6_THERP          ------------------------------------------------------------
A9B5U9_HERA2          ------------------------------------------------------------
A7NP80_ROSCS          ------------------------------------------------------------
SECD_ANATU            ------------------------------------------------------------
SECD_PROMA            ------------------------------------------------------------
B5IKE7_9CYAN          ------------------------------------------------------------
B4WJX6_SYNS7          ------------------------------------------------------------
D3EPH0_ATETH          ------------------------------------------------------------
SECD_ACAM1            ------------------------------------------------------------
Q2JY13_SYNJA          ------------------------------------------------------------
Q7NDR6_GLOVI          ------------------------------------------------------------
Q1AWD0_RUBXD          ------------------------------------------------------------
A0QWJ2_MYCS2          PPGMPVPGEAPGGEAPAPPAGEQPAPQPRPYPLEPAPTPGEPTPAPAPEPAPGENPPAAP
A0A0H3MPV3_MYCLB      PTGAALPGEVPSVEQPAPPD-------PR-------------------------------
C0ZZ50_RHOE4          TPAPPVDASSDGTDEG--------------------------------------------
D0LCM8_GORB4          ------------------------------------------------------------
D5UNI7_TSUPD          ------------------------------------------------------------
D9UX19_9ACTN          -----PPSTTPSAPAS-------------------------------------------G
C7MQZ9_SACVD          GGGSTPPGSAPTQQSDESDRD-----------------------------------DDDG
A4FBB0_SACEN          -----------PAPAD--------------------------------------------
C6WCM7_ACTMD          APQSGAPQSDAPNPATDPSQ------------------------------------VDCQ
C8XE16_NAKMY          PSAAATTPAAETPAATSPAGLRGD--------------------------------DAAL
D2S9I0_GEOOG          DPAAPSDPAVPSDGAVADPSLP--------------------------------------
Q4JVE1_CORJK          APKELKVTAKPPAEPKDSVEEQ--------------------------------------
C4LIX5_CORK4          IPESMKITAKPEAKPANSIEEN--------------------------------------
Q8NPZ9_CORGL          EPEPVTVSATPMDEPANSIEAT--------------------------------------
D7BNQ2_ARCHD          PEQTPANASDPA------------------------------------------------
D6ZHF4_MOBCV          PNATPAPTSDPGKPAPTPAAKQHPSAAIPF------------------------------
B2GIL6_KOCRD          KA-KDIP-KSDGKPS---------------------------------------------
A9WSE2_RENSM          PE-DQLP-KPTAAPT---------------------------------------------
E1VWF6_GLUAR          PE-KDLP-KPEGKPE---------------------------------------------
C5CCH9_MICLC          PE-DQLP-KPDGEPA---------------------------------------------
B0REC2_CLAMS          PDPSTLSDEPTAEPT---------------------------------------------
E8NFI9_MICTS          PD-ANLPSTPTASPT---------------------------------------------
D5UEN5_CELFN          AEDAAAEEPPSDEPG-------KAS-----------------------------------
D1BGW2_SANKS          EPTTDAATEPAVEPT-------TDATEPAV------------------------------
C5C5R0_BEUC1          EPTDGATDAPAATPEEIDEAAFAAADADGN------------------------------
C7R4G5_JONDD          GPLDELISDDAEAAE---------------------------------------------
D1BSK1_XYLCX          DATADDAAEESEAPV---------------------------------------------
Q83MZ7_TROWT          EHRKNIPKTPHDTSGMIP------------------------------------------
A6WCH6_KINRD          AEPAPAEPAPATTPPSLAELATPAATP-GP------------------------------
E6SB77_INTC7          GSPASTATTPASTEAPPAPTGAELEAAIAA------------------------------
C7NI44_KYTSD          ASPSGASNSPEPSGSGSGESPAPSPSGSGD------------------------------
C7MCC2_BRAFD          EDPDSAPSAAPAEGE---------------------------------------------
D6Y2C4_THEBD          AQAAGARERAEPGRG---------------------------------------------
D2AWR2_STRRD          QTATPSPTGSPAGRALSSALTNPSPGATQA----------------------------PS
D1AEV4_THECD          PSATPAPQATARPRALSRALTDPSAQP---------------------------------
A0LUK3_ACIC1          PSGAASPATPKPSASSAGLGVGRTPGIQLA----------------------------GF
A8KZE4_FRASN          S-QRPAALGPAPGIGEQPGLVAQPASFTSG----------------------------SG
Q2JD92_FRACC          ASNKPAALGDGTGRG----LIAQPVSLTA-------------------------------
E2PV76_STRC2          TSAQPGGSTPQGRAVTDALK-DPSPG--------------------------------AS
E4N7T8_KITSK          ASA-SASATKAGRALSGALQADPTAS--------------------------------AS
C7QJQ1_CATAD          ATPSGTATSTQHRVADSGLKDATGSGGSTATTTPSSTATATASSKST-----------AS
D7GDS9_PROFC          ATPRASGDSTGAADFD--------------------------------------------
Q6A8K5_CUTAK          ASASSKGGTTSSASQYNEKDPQSAAK----------------------------------
D2PVF3_KRIFD          ATPNGRAWSSVLADATPTPTPAPTAKP---------------------------------
A1SJA9_NOCSJ          AKPSQQPSQTASASESSSPTESPSESS---------------------------------
C4RGU0_MICS3          GFAVAERRRAVAERQRRAGAAGRR----GAAQG---------------------------
A4X5X5_SALTO          PSATPTPSASSSPSATPAASDSATPVPASVEEQ---------------------------
D3PYP7_STANL          KDDDKDKGEDPADVDNSVKEQRKKLEKKLGKEL---------------------------
E1QZN3_OLSUV          ------------------------------------------------------------
C7LYS6_ACIFD          ------------------------------------------------------------
                                                                                  

B1YJQ7_EXIS2          ------------------------------------------------------------
D6XWY8_BACIE          ------------------------------------------------------------
E3E8W8_PAEPS          ------------------------------------------------------------
C0ZAP6_BREBN          ------------------------------------------------------------
SECD_ALIAD            ------------------------------------------------------------
SECD_ANADE            ---VLDQVRTQLPQCQGDRQGLSLPLPESGCW-----------------------TVEPV
Q08P79_STIAD          ---AFFQQMFEKTAPP-ENSNITVTSEEG------------------------------F
A9F8D1_SORC5          ---DFFEPIARSAKEEDLPKGLTFSIENAPVG-----------------------PGKTK
Q6MKZ2_BDEBA          ----------KTPQELQVMIAEVEKAGNFNME-----------------------NTK--
E1X0T6_HALMS          ----------VSPVTIQDWITKAEASGITFKK-----------------------GDR--
D0LJ86_HALO1          ESGKQYQDYYLSAGDVDEWLPVAEAKERGCWN-----------------------ANKSE
SECD_SYNFM            ------------------------------------------------------------
Q2LVH4_SYNAS          ------------------------------------------------------------
E1YHR5_9DELT          ------------------------------------------------------------
E1QIL8_DESB2          ------------------------------------------------------------
B8F9E3_DESAL          ------------------------------------------------------------
SECD_THEYD            ------------------------------------------------------------
D8PI89_9BACT          ------------------------------------------------------------
B6ANM3_9BACT          ------------------------------------------------------------
B5ECA4_GEOBB          ------------------------------------------------------------
Q3A3C4_PELCD          ------------------------------------------------------------
D5MHP3_9BACT          ------------------------------------------------------------
SECD_CALNY            ------------------------------------------------------------
SECD_DESIS            ------------------------------------------------------------
C4XSM5_DESMR          ------------------------------------------------------------
C7LN34_DESBD          ------------------------------------------------------------
Q1MSC1_LAWIP          ------------------------------------------------------------
SECD_MAGMM            ------------------------------------------------------------
SECD_RHOM4            AASETSAVTDTATADTSLAALLGEQPSPER--------------------PRNPLLAVMQ
D5HAA4_SALRM          AAMEASTDTSGVTEGTELAASSGQEASGGQQQ----GTALTEPGESAQTGPQNSLLAAMQ
B3EJI9_CHLPB          ------------ENPDLPEGDGAEGETVAE-------------------KSSNPLYDNIV
Q3ANT9_CHLCH          AASAQSVSVSASATPSLPAKANVAPTSAVA-------------------PAPRSLSNLIV
B3QTH7_CHLT3          ISTEKLVAKTDSSDKDLMQAAMAASDSAVKAEDLFGGAQADSSKSKEQLRKENPLFSILG
B0VHR7_CLOAI          -----PVLAEMAKKDKSIMADTTSTDSLKT--------------------GEGIFSSLIR
SECD_ELUMP            ------------------------------------------------------------
SECD_UNCTG            ------------------------------------------------------------
SECD_ACEP3            ------------------------------------------------------------
Q0BS58_GRABC          ------------------------------------------------------------
D3NUL2_AZOS1          ------------------------------------------------------------
D8JWH1_HYPDA          ------------------------------------------------------------
E3I016_RHOVT          ------------------------------------------------------------
E2CQN1_9RHOB          ------------------------------------------------------------
A7HXL0_PARL1          ------------------------------------------------------------
B0UI92_METS4          ------------------------------------------------------------
A7IND6_XANP2          ------------------------------------------------------------
A4U1K0_9PROT          ------------------------------------------------------------
D5BQT5_PUNMI          ------------------------------------------------------------
Q9A6U2_CAUVC          ------------------------------------------------------------
D9QLN2_BRESC          ------------------------------------------------------------
Q5NL89_ZYMMO          ------------------------------------------------------------
Q1GSE5_SPHAL          ------------------------------------------------------------
SECD_RHOCB            ------------------------------------------------------------
Q0C0W6_HYPNA          ------------------------------------------------------------
C6XJ02_HIRBI          ------------------------------------------------------------
Q0ANE6_MARMM          ------------------------------------------------------------
Q2RTI1_RHORT          ------------------------------------------------------------
SECD_ECOLI            ------------------------------------------------------------
C4K8M1_HAMD5          ------------------------------------------------------------
SECD_HAEIN            ------------------------------------------------------------
A1SWT8_PSYIN          ------------------------------------------------------------
Q493H1_BLOPB          ------------------------------------------------------------
Q7VQA9_BLOFL          ------------------------------------------------------------
B8GTQ2_THISH          ------------------------------------------------------------
Q31FZ7_HYDCU          ------------------------------------------------------------
D0KW97_HALNC          ------------------------------------------------------------
Q60B03_METCA          ------------------------------------------------------------
A1WXP8_HALHL          ------------------------------------------------------------
D3RSH9_ALLVD          ------------------------------------------------------------
D0U555_9BACT          ------------------------------------------------------------
Q5ZU07_LEGPH          ------------------------------------------------------------
A9KE82_COXBN          ------------------------------------------------------------
A0A0E1PNG4_ACIBA      ------------------------------------------------------------
Q0VS97_ALCBS          ------------------------------------------------------------
A4GHV3_9BACT          ------------------------------------------------------------
A4GK28_9BACT          ------------------------------------------------------------
Q1QTM7_CHRSD          ------------------------------------------------------------
A1TZN9_MARHV          ------------------------------------------------------------
C3K1N2_PSEFS          ------------------------------------------------------------
B8KXG6_9GAMM          ------------------------------------------------------------
Q21KW0_SACD2          ------------------------------------------------------------
B3PDJ8_CELJU          ------------------------------------------------------------
C7RB47_KANKD          ------------------------------------------------------------
B2FN02_STRMK          ------------------------------------------------------------
A5EWX7_DICNV          ------------------------------------------------------------
Q145I2_PARXL          ------------------------------------------------------------
D8INT3_HERSS          ------------------------------------------------------------
E6UXK2_VARPE          ------------------------------------------------------------
D6CKE5_THIA3          ------------------------------------------------------------
E8UEP8_TAYEM          ------------------------------------------------------------
E0XSS7_9PROT          ------------------------------------------------------------
D7N3K1_9NEIS          ------------------------------------------------------------
D7DM25_METV0          ------------------------------------------------------------
Q0AG53_NITEC          ------------------------------------------------------------
B6BWI8_9PROT          ------------------------------------------------------------
B7J4R7_ACIF2          ------------------------------------------------------------
Q0HXS6_SHESR          ------------------------------------------------------------
E1SV05_FERBD          ------------------------------------------------------------
B7VQL0_VIBTL          ------------------------------------------------------------
Q7MD23_VIBVY          ------------------------------------------------------------
A1S8J5_SHEAM          ------------------------------------------------------------
A4SLM7_AERS4          ------------------------------------------------------------
Q15N36_PSEA6          ------------------------------------------------------------
Q3IL52_PSEHT          ------------------------------------------------------------
A8EY98_RICCK          ------------------------------------------------------------
B3CTC4_ORITI          ------------------------------------------------------------
B9KH60_ANAMF          ------------------------------------------------------------
A0A0H3M0Z2_EHRRW      ------------------------------------------------------------
B3CPT1_WOLPP          ------------------------------------------------------------
Q2GDE0_NEOSM          ------------------------------------------------------------
D0RNY3_9PROT          ------------------------------------------------------------
Q4FM00_PELUB          ------------------------------------------------------------
Q7VFM8_HELHP          ------------------------------------------------------------
C5ZWZ2_9HELI          ------------------------------------------------------------
E7A9U3_HELFC          ------------------------------------------------------------
A0RNX0_CAMFF          ------------------------------------------------------------
C3XE91_9HELI          ------------------------------------------------------------
SECD_AQUAE            ------------------------------------------------------------
D3DH34_HYDTT          ------------------------------------------------------------
B4U9J1_HYDS0          ------------------------------------------------------------
C1DVG5_SULAA          ------------------------------------------------------------
E8T6K3_THEA1          ----------------------------------------------------------EP
SECD_KORVE            ------------------------------------------------------------
E8X5K0_GRATM          ------------------------------------------------------------
C1F9I4_ACIC5          ------------------------------------------------------------
Q029K4_SOLUE          ------------------------------------------------------------
SECD_PETMO            ------------------------------------------------------------
C5CF36_KOSOT          ------------------------------------------------------------
A6LP86_THEM4          ------------------------------------------------------------
A0A1Q6S007_9FIRM      ------------------------------------------------------------
D3R265_MAGIU          ------------------------------------------------------------
B8I6M6_RUMCH          ------------------------------------------------------------
B0SPU4_LEPBP          ------------------------------------------------------------
SECD_TREPA            ------------------------------------------------------------
Q73PW4_TREDE          ------------------------------------------------------------
E1R5K7_SEDSS          ------------------------------------------------------------
E0RQA9_SPITD          ------------------------------------------------------------
D5UAD5_BRAM5          ------------------------------------------------------------
SECD_LEPBD            ------------------------------------------------------------
SECD_SEBTE            ------------------------------------------------------------
A5TW61_FUSNP          ------------------------------------------------------------
SECD_GEMAT            ------------------------------------------------------------
B2A263_NATTJ          ------------------------------------------------------------
SECD_ACIFV            ------------------------------------------------------------
D1BLM4_VEIPT          ------------------------------------------------------------
B8CXF7_HALOH          ------------------------------------------------------------
D9QVJ1_ACEAZ          ------------------------------------------------------------
D5XEJ6_THEPJ          ------------------------------------------------------------
Q2RHU6_MOOTA          ------------------------------------------------------------
Q3ABZ0_CARHZ          ------------------------------------------------------------
B0TF81_HELMI          ------------------------------------------------------------
C9R7V3_AMMDK          ------------------------------------------------------------
B1I4K5_DESAP          ------------------------------------------------------------
C8W4E1_DESAS          ------------------------------------------------------------
A4J544_DESRM          ------------------------------------------------------------
Q0AX22_SYNWW          ------------------------------------------------------------
Q892A4_CLOTE          ------------------------------------------------------------
D9SMV2_CLOC7          ------------------------------------------------------------
Q67LL8_SYMTH          ------------------------------------------------------------
D9TNU7_THETC          ------------------------------------------------------------
A4XIR1_CALS8          ------------------------------------------------------------
E3GFZ5_9FIRM          ------------------------------------------------------------
D9RXQ2_THEOJ          ------------------------------------------------------------
E3PRC6_ACESD          ------------------------------------------------------------
A6TQN4_ALKMQ          ------------------------------------------------------------
D4M8M0_9BACT          ------------------------------------------------------------
E6SLR2_THEM7          ------------------------------------------------------------
SECD_DICTD            ------------------------------------------------------------
SECD_DEHMV            ------------------------------------------------------------
B3T9T5_9ZZZZ          ------------------------------------------------------------
SECD_THET1            ------------------------------------------------------------
B9KYU6_THERP          ------------------------------------------------------------
A9B5U9_HERA2          ------------------------------------------------------------
A7NP80_ROSCS          ------------------------------------------------------------
SECD_ANATU            ------------------------------------------------------------
SECD_PROMA            -------------------------------------------------------DNKSE
B5IKE7_9CYAN          -----------------------------------------------------NGETPPE
B4WJX6_SYNS7          ------------------------------------------------------------
D3EPH0_ATETH          ------------------------------------------------------------
SECD_ACAM1            ------------------------------------------------------------
Q2JY13_SYNJA          ------------------------------------------------------------
Q7NDR6_GLOVI          ------------------------------------------------------------
Q1AWD0_RUBXD          ------------------------------------------------------------
A0QWJ2_MYCS2          APGADGDKADLAQRIATAKQWRQST-----------------------------------
A0A0H3MPV3_MYCLB      --------KDLAERIAEEKKWRQST-----------------------------------
C0ZZ50_RHOE4          --------DAAAAEIAAARALRQSS-----------------------------------
D0LCM8_GORB4          --------EQVQQAIAEQRKLRQAPANAD-------------------------------
D5UNI7_TSUPD          --------DTAKKALLDAKAARQST-----------------------------------
D9UX19_9ACTN          QNAGKN-------PIEEARAVRQAPALLPKDPKNQQEA----------------------
C7MQZ9_SACVD          DRDGRTEQEKAAEQIQEAKKWRQDPALLPTGPEDQ-------------------------
A4FBB0_SACEN          -------------PIEEAKKTRQ-------------------------------------
C6WCM7_ACTMD          AVFLGNYSEDTTKAITEARTCRQDPALT--------------------------------
C8XE16_NAKMY          AAAQTDATDPAATPAASDTAAATATGTAAPTTAATTAATTAASTVTWPTGSNPENPTQPL
D2S9I0_GEOOG          --------EPGAPPVTREEAAAQ-------------------------------------
Q4JVE1_CORJK          --------ERRDKQVEVLKADRQST-----------------------------------
C4LIX5_CORK4          --------KQREQTSAMLLKDRQSE-----------------------------------
Q8NPZ9_CORGL          --------QRRQEITDMLRTDRQST-----------------------------------
D7BNQ2_ARCHD          ------------------------------------------------------------
D6ZHF4_MOBCV          ------DELMKQAEKYPDTPAGESKVINDRK-----------------------------
B2GIL6_KOCRD          ------------------DSSDPRW-----------------------------------
A9WSE2_RENSM          ------------------NGSDQNW-----------------------------------
E1VWF6_GLUAR          ------------------NPSDTNW-----------------------------------
C5CCH9_MICLC          ------------------DAYDPNW-----------------------------------
B0REC2_CLAMS          ------------------GPSDVSW-----------------------------------
E8NFI9_MICTS          ------------------DGSDPAY-----------------------------------
D5UEN5_CELFN          ----------------PDSPSDVAYY----------------------------------
D1BGW2_SANKS          ------EPTTDAEVPLPSNPSDLAQ-----------------------------------
C5C5R0_BEUC1          ------GELSNTPATEPTSASDTAW-----------------------------------
C7R4G5_JONDD          ----------------AENPSDLAQ-----------------------------------
D1BSK1_XYLCX          ----------------IENPSDLAQ-----------------------------------
Q83MZ7_TROWT          -------------SPRPKNGSDMAW-----------------------------------
A6WCH6_KINRD          ------GQPTGTSSPAPTDASDQSWL----------------------------------
E6SB77_INTC7          ------QTSRGLLTLGWEQAKAD--Q----------------------------------
C7NI44_KYTSD          ------GGDTGNQGSSDPDARGQDIV----------------------------------
C7MCC2_BRAFD          ---------------LPYPAWAMDW-----------------------------------
D6Y2C4_THEBD          --------SPAASPS-----------PTPTG----ADPLAG-------------------
D2AWR2_STRRD          DKKPAKNASPSAEPSQSAAPTAQPTAPAMDP----NDPMAG-------------------
D1AEV4_THECD          --------SPSATPTPSASLPTDLQEQLDQL----IRRQDGQ------------------
A0LUK3_ACIC1          VRQAASAASSAATASPSPAPTASPAAPSPSPSPAANPGYYAV------------------
A8KZE4_FRASN          SSGPRIELAAATNQSASPAPATAPTASAPAATQPAATDPAATSPAVTDPNAAVDPNAAV-
Q2JD92_FRACC          -AGTPAVGAASASPVASASPAPAPAPAATGSTGSTGD-----------------------
E2PV76_STRC2          EPGKPAEGAKDGKDGKDAAKTPDPAPTGDVA-----------------------------
E4N7T8_KITSK          GSASAQPSASAQASAPAANPSAAPTPDAETL-----------------------------
C7QJQ1_CATAD          APSTPSSNPSSGASAPSSGATPAPSASASAP-----------------------------
D7GDS9_PROFC          --------------------SALKWTPSA-------------------------------
Q6A8K5_CUTAK          -----------------MVKAAEEWKPTP-------------------------------
D2PVF3_KRIFD          --STPAAPPATPSAPPANAGDPLQWQPDA-------------------------------
A1SJA9_NOCSJ          --SESPG-----AGSDDPAQMALDFMTDPGR-----------------------------
C4RGU0_MICS3          ------RRAEGRRRRVAGRQRPAGPGRPDRR-----------------------------
A4X5X5_SALTO          ------RRAVEQKVGATAWEAANGLQSPTDL-----------------------------
D3PYP7_STANL          ------IGAAEQFVAQAEAMVKQGQQLSPQM-----------------------------
E1QZN3_OLSUV          ------------------------------------------------------------
C7LYS6_ACIFD          ------------------------------------------------------------
                                                                                  

B1YJQ7_EXIS2          ------------------------------------------------------------
D6XWY8_BACIE          ------------------------------------------------------------
E3E8W8_PAEPS          ------------------------------------------------------------
C0ZAP6_BREBN          ------------------------------------------------------------
SECD_ALIAD            ------------------------------------------------------------
SECD_ANADE            ELPSGGSRAATMVAANTRTELEKVITEKLNPLLDPQKNVVGIGEGQVGQGPIKTTYYR--
Q08P79_STIAD          PQLQGPNREALLAYVNDKVP------EGREVLLECVANPLKKNE---------CLSYR--
A9F8D1_SORC5          PVHFARMVRAEHEEMRDTLKRLREWVGTLQVPADNEIGFGKLYEYDEEKDAIEEIGWR--
Q6MKZ2_BDEBA          -----------------YSDYVTRVNEALAGK--LPEKTVVYFEKAPNATTID-AGAI--
E1X0T6_HALMS          -----------------FSSYLNQLNEYLKNEKLLPAGWILAFEKTVNKLTNELESKI--
D0LJ86_HALO1          VQGEVQCTITGRQRIADYLDELFVADAEMAIDDEHQIGYQLVNPESVMRDQEREAYWR--
SECD_SYNFM            --------------------------PQDVKSGKAPAGTKIYPMKHTDRTTRQRTES---
Q2LVH4_SYNAS          --------------------------IDEALKGNVPEGSAITYGWNVDSQSGRRTEV---
E1YHR5_9DELT          --------------------------PEKALSEGAPPGTEILYETKEDPRTRRVMKQ---
E1QIL8_DESB2          --------------------------ANSATMDSIPPGSQLLQMYRKDPITGRTVKS---
B8F9E3_DESAL          --------------------------VRDYINRRPPPGTEILYSKHVDAQ-GRVSSR---
SECD_THEYD            -----------QLPSLIKAGEE--DTFLNQWKSKLPESDEIVFQKIVNKETGEVYKR---
D8PI89_9BACT          -----------DLPGRIQKGKEREDAFLKQVEGKVPEGDQILFERIVEKESGQEWLA---
B6ANM3_9BACT          -------------PDADK---------ILEKKAPVPTADEILFSHRTDTN-GQRIEL---
B5ECA4_GEOBB          ----------------------------SSSPYAMPDDAEILMEQQSNSATGAVQGV---
Q3A3C4_PELCD          ----------------------------AAAKGVLPPGTQLLYERQVDRRSGAVTQT---
D5MHP3_9BACT          ----------------------------EAVAGRISENDQLLYLRSTDEQQ-KMNKV---
SECD_CALNY            ---------------------------ETIKSGNIPPDDIILYGKKIDKVTGQIVSTI--
SECD_DESIS            ----------------------------DALDGFLPENSEVLYQRHMDPQTNTEVDRT--
C4XSM5_DESMR          ---------------------------EKAQKGILPPGDELSVLR--HRNPDGSYLER--
C7LN34_DESBD          ---------------------------QAAVAGTVPAESELAYMQ--DKR-GVSEVKT--
Q1MSC1_LAWIP          ---------------------------NTP----LPSGVRLFPQV--IFYPDGTSREI--
SECD_MAGMM            ----------------------------RALEGQVPADSELMYEERSANQ--GGKSAY--
SECD_RHOM4            PV--GQGVVFGIVAGPDTAQVNRLLRNPEVQALLPSGIELLYTANPVGTDEQGRPLYY--
D5HAA4_SALRM          PMPGQEQPIIGRAFASDTSRVNELLQDPSVQNMLPPGIEPMWTASPVLTTEDGREAFH--
B3EJI9_CHLPB          VLE----NGRVYAPDYSREYLTGLFQRESIQKLLPKDSEIRLSARSIEGS-DGAMFYD--
Q3ANT9_CHLCH          LMQ----NGMAYTEERNRAEVKALLERADVQALLPPDSELLLAAKPEVDA-EGKKFYP--
B3QTH7_CHLT3          VLP----NGMTYTTEYERKALEELLARADVQKRIPSDLDFLIGAKSFATAEDGTKLYY--
B0VHR7_CLOAI          PGE-----MDFEVQYSDVRLIQDLLADTLFAQMVPMGYQLALDKADTENP---RADRN--
SECD_ELUMP            ---------------------EDGNLIPSLAKLLPADTIVLKNKEG-----------G--
SECD_UNCTG            ---------------------ENSSAYPDIKAVMPEGASVFESRSN-----------M--
SECD_ACEP3            ------------------------SNPLHAT--YPPPGVSLVPMANPAEG---GP-----
Q0BS58_GRABC          ------------------------ASATPAA--VPPDDIALP---EEGTG---QK-----
D3NUL2_AZOS1          -----------------------NADPSTGR--APPGSEILPSAEGDRYQ---SK-----
D8JWH1_HYPDA          -----------------------SMSGDEAKMTKVPTGFKIYPGDKGESS---GE-----
E3I016_RHOVT          -----------------------SMSAEDAKDHGVPPDSQLLP-DQERPG---QF-----
E2CQN1_9RHOB          -----------------------SMSGDQAMQSRP-PVGTMVAFSIDDPP---IP-----
A7HXL0_PARL1          -----------------------AMSGQQALASRTVPSGTEILYTADEPR---AP-----
B0UI92_METS4          -----------------------SAAGDVDL--LPSRDS------NGQK-----------
A7IND6_XANP2          -----------------------SMSPQQALEGRPPPDSEVLQGQDGQP-----------
A4U1K0_9PROT          -----------------------TTTPDEAV-RGRVPSGSMLLPSVEQERGMPSH-----
D5BQT5_PUNMI          -----------------------RITPQEAVERGRVPPGSILLPSDSEDG---RN-----
Q9A6U2_CAUVC          -----------------------SVTPEDIAAGRIPPGSEALP---SDDR-YQAA-----
D9QLN2_BRESC          -----------------------ENSIQDALAGRVPPDAQLLV---GDD--GQTP-----
Q5NL89_ZYMMO          -----------------------SVKSADLAQGKVPIGTQVMIAQSGQP-----------
Q1GSE5_SPHAL          -----------------------NADPAEAAAGRVPVGSEIVPYAEGEGN-GAAF-----
SECD_RHOCB            -----------------------TTSNPNAP---VASGNELLPDAERQGL----Y-----
Q0C0W6_HYPNA          -----------------------SPAEIASAQAG--IVKPGYRLLEGPET---GP-----
C6XJ02_HIRBI          -----------------------TADASQYRLDE--PRLGKVKRQDAYSA---RE-----
Q0ANE6_MARMM          -----------------------NVDPGPNGQARTPPGVTVYPMADTGGT---QW-----
Q2RTI1_RHORT          ------------------------------------------------------------
SECD_ECOLI            -----------------------NVDQAAAASGRVPGDSEVKQTR--EGQPVV-------
C4K8M1_HAMD5          -----------------------KVTPEAAAIGRVPADTEIKKDR--DGRLVA-------
SECD_HAEIN            -----------------------NVTADAISRNMLPADSEVKYDR--QGHPVA-------
A1SWT8_PSYIN          -----------------------ETNINDALAGRLPSSSIVYKER--DGRPVV-------
Q493H1_BLOPB          -----------------------TISEFKINNNLIPEDSEIKLSN--NGYLVP-------
Q7VQA9_BLOFL          -----------------------ELNQFKINNNYIPEDSEIKLDD--NGNIVP-------
B8GTQ2_THISH          ---------------------EENDPFEAAATGRVPSASRLYRER--NGNPVL-------
Q31FZ7_HYDCU          ---------------------ERGDAYRAEKTGYAPNGSRLYHFR--DGRPIL-------
D0KW97_HALNC          ---------------------TPTDWVDAEQSGRVPPDARLYHEK--DGRPVL-------
Q60B03_METCA          ---------------------EHPVPAEGE---KAPLGSHLYRDR--QNRPVL-------
A1WXP8_HALHL          ---------------------ANFPFTGDP--DDPPEGSEVFPQR--DGGYVA-------
D3RSH9_ALLVD          ---------------------EGSVADAVA--GRPPVGSKLYYER--NGTPIL-------
D0U555_9BACT          ---------------------EKNDVQTAIQSGKTPAGSKIYKFK--DGRPLL-------
Q5ZU07_LEGPH          ---------------------QENDPFIAKQTGVVPVNDKLYMMD---GHPIL-------
A9KE82_COXBN          ---------------------VEHDAETASSTGTVPFGSKLYTFE---KQPVL-------
A0A0E1PNG4_ACIBA      ---------------------DPYTGKYNGQPLPPGTEVFAYQSL--DSGRQLL------
Q0VS97_ALCBS          ---------------------SVSSARLRSGMAPPGLEFFPFKGQ--E-GRIVA------
A4GHV3_9BACT          -----------------------------MDTPRSRKTSYPYRNG--MGAPAF-------
A4GK28_9BACT          -----------------------------DNSLASRVESFPYR-----GLKTR-------
Q1QTM7_CHRSD          -----------------------------PDTPEREIETLPFRND--EGRS---------
A1TZN9_MARHV          -----------------------------QDAPSAETEQFPFRDN--PQRT---------
C3K1N2_PSEFS          -----------------------------PGATRATSEEFEFREG--NRPP---------
B8KXG6_9GAMM          -----------------------------TNAPITERQRFEYRSA--DRAGIY-------
Q21KW0_SACD2          -----------------------------KDGLASQKEHFEFRDE--IKQARYGG-----
B3PDJ8_CELJU          -----------------------------PDTPITNREEFPYKDE--IMQMQRGN-----
C7RB47_KANKD          -----------------------EADIVAAQQGRVPAGSKLFESE----RGPIV------
B2FN02_STRMK          -----------------------GNAQDAIDSGRIPPEAKVYQRR--DGGGPIL------
A5EWX7_DICNV          ---------------------TPADIANAVRLKRPPFGDKLGFFE--DGTPIL-------
Q145I2_PARXL          ------------------------THPNPS--DPVPPGDELFTQG--NQTPVL-------
D8INT3_HERSS          ------------------------RGTEET--TAIPFGSELFKIG--KGAPVV-------
E6UXK2_VARPE          ------------------------GRAAEQGTGPVPFGSEKFLDR--SGRAVI-------
D6CKE5_THIA3          ------------------------AQAALAGQGPLPAGDQIFPDR--DGGKLV-------
E8UEP8_TAYEM          ------------------------ALASLA-SGVVPFGLEKFKGT--DGRDIL-------
E0XSS7_9PROT          ------------------------TFSAIS-EGKIPKRIEIFLDK--NGNELA-------
D7N3K1_9NEIS          ------------------------KVQAAL-GGNVPSGYELLYSAGENPAPTL-------
D7DM25_METV0          -----------------------AATLEKAEKGQAPIGDDVFKNR--DGRAVL-------
Q0AG53_NITEC          ------------------------GDIDAALRGSVPPGTELFTER--GGGPLL-------
B6BWI8_9PROT          -----------------------PADIDQAIDGNIPFGRDLFYDR--NQNPLL-------
B7J4R7_ACIF2          -----------------------QANMTEALKGELPAGTALFYGV--HGTPYV-------
Q0HXS6_SHESR          -----------------------ESGSVNAQVLKDKSGNPVYVAR---------------
E1SV05_FERBD          -----------------------QGEPVQGKTLPFNQGGTVSVKR---------------
B7VQL0_VIBTL          -----------------------PNVSARTKSINDQDGRPVILHR---------------
Q7MD23_VIBVY          -----------------------DARSGDDLVLQDADGRSVVLEK---------------
A1S8J5_SHEAM          -------------------------EGGTALQTPFGDGR-VGLNP---------------
A4SLM7_AERS4          --------------------------PESRFFMADRNGQAVGMAR---------------
Q15N36_PSEA6          ------------------------SGTVGAKTFTDENGRRLRLAP---------------
Q3IL52_PSEHT          --------------------------AVGGQTFNLQTGGTIKLDP---------------
A8EY98_RICCK          -----------------------NANIEEAVKGHVPVGSMLIKGD--SESHGEYY-----
B3CTC4_ORITI          -----------------------GTVAQDQ---HISKDLMLVK----EQNNPENK-----
B9KH60_ANAMF          -----------------------EVKSLSDID---PVVTSLLS------DTAGNV-----
A0A0H3M0Z2_EHRRW      -----------------------NVTQISSIN---PLTTVLLK------DVRGNT-----
B3CPT1_WOLPP          -----------------------NVAKMQDID---HDTTIMLK------DSLGNS-----
Q2GDE0_NEOSM          -----------------------DTATILG--------KFFLK------DKLGRN-----
D0RNY3_9PROT          -----------------------NDANSNS--------FDILD-----SKSRLEK-----
Q4FM00_PELUB          -----------------------NNNDTFG--------TEMLQ-----FEDGTSE-----
Q7VFM8_HELHP          ---------------------RNARVSTMSELEAQKYNDVILPFVHSSEVQALQNTLAHL
C5ZWZ2_9HELI          ---------------------RNARVHTMTELEAESYGDVILPFVNNP------------
E7A9U3_HELFC          ---------------------KNPYLAELSPEEIHKLGDVVLPYAPQSGG----------
A0RNX0_CAMFF          ---------------------RQDQANKMTEAEATAYGDVLYPDVKNP------------
C3XE91_9HELI          ---------------------RMMNGEVISDEEAMRYNSVLLPYAENE------------
SECD_AQUAE            ----------------------RKELEKK-----------LTPDREILPSRD--------
D3DH34_HYDTT          ----------------------KEVLEQK-----------LNKDTELLPSRN--------
B4U9J1_HYDS0          ----------------------LDALQKE-----------LKPDEKILPSKD--------
C1DVG5_SULAA          ----------------------KEELLKKYPNGIPDDLELLEGQEEVVNGQT--------
E8T6K3_THEA1          SPTGPKFFLVEEGRKEPIKVKNLEELVKKFGGNVPEDEQLLLQEIKNKEGRVV-------
SECD_KORVE            ----------------------KE--SEAAQGQMQQPDTVVLPGKSESDPG---------
E8X5K0_GRATM          ----------------------SEQAAMTTLNNVIPPDATLVHGQSTPNSP---------
C1F9I4_ACIC5          ----------------------DQQSALQAIGGSVPYDSELVQSVIGASGPGS-------
Q029K4_SOLUE          ----------------------SREAALSQKGGILPLGTKLARTKPRGTQD---------
SECD_PETMO            -------------------------PEITRNRTIQINGEEIE------------------
C5CF36_KOSOT          -------------------------PGMPSGMAYEISKLKLQGVEP--------------
A6LP86_THEM4          -------------------------PNIDPELVNEAKREKAQ------------------
A0A1Q6S007_9FIRM      -------------------------AQLTFRPGDGHETTDVDSNG---------------
D3R265_MAGIU          -------------------------AHLTFK-----------------------------
B8I6M6_RUMCH          -------------------------ALLTFQEVDESKK----------------------
B0SPU4_LEPBP          -------------------------NSFTYKKIISDSESRLMDLGQREKTDIFLFQELVK
SECD_TREPA            -------------------------DHYRNNPQGTFDAAHQLHDLSLVPEHTSVLGVYR-
Q73PW4_TREDE          -------------------------EYYRNNPGKTFDADYNLLNPEIIPEDCMVLGVYH-
E1R5K7_SEDSS          -------------------------QYFQQNPTKAYDDQGHVITPDFVPAGYIVRGFYE-
E0RQA9_SPITD          -------------------------EYQRQ--TGITDPAILAERVDFVPAGTKIAGYYT-
D5UAD5_BRAM5          -------------------------TNDML--------MGVFTNMAKVPEYGKLLYFYSE
SECD_LEPBD            ------------------------------------------------------------
SECD_SEBTE            ------------------------------------------------------------
A5TW61_FUSNP          ------------------------------------------------------------
SECD_GEMAT            -GTAAAAGDSAKSTSVNSLLTQNADSAKDSTAAAGTTGADTTIKAPVVTGGLFSTNVQPG
B2A263_NATTJ          ------------------------------------------------------------
SECD_ACIFV            ----------------------------------DMEGNTVLT-----------------
D1BLM4_VEIPT          ----------------------------------NDQGQTVMT-----------------
B8CXF7_HALOH          ----------------------------------NSDGEVLMT-----------------
D9QVJ1_ACEAZ          ----------------------------------DPNGEVVMT-----------------
D5XEJ6_THEPJ          ----------------------------------TSDGKVVVS-----------------
Q2RHU6_MOOTA          ----------------------------------TSDGQVVVS-----------------
Q3ABZ0_CARHZ          ----------------------------------SPEGEVIVS-----------------
B0TF81_HELMI          ----------------------------------TADGQTVIE-----------------
C9R7V3_AMMDK          ----------------------------------TESGEVIVT-----------------
B1I4K5_DESAP          ----------------------------------TEDGTTVLT-----------------
C8W4E1_DESAS          ----------------------------------AENGQTVLT-----------------
A4J544_DESRM          ----------------------------------TEDGKTILT-----------------
Q0AX22_SYNWW          ----------------------------------DESGKVLVT-----------------
Q892A4_CLOTE          ----------------------------------GPDKKVILT-----------------
D9SMV2_CLOC7          ----------------------------------DPEGNVILT-----------------
Q67LL8_SYMTH          ----------------------------------DPEGNEVLT-----------------
D9TNU7_THETC          ----------------------------------GPDGKVILT-----------------
A4XIR1_CALS8          ----------------------------------GPQGDLIVS-----------------
E3GFZ5_9FIRM          ----------------------------------GPDGEVILT-----------------
D9RXQ2_THEOJ          ----------------------------------GPDQKVILT-----------------
E3PRC6_ACESD          ----------------------------------LPDGNVVVS-----------------
A6TQN4_ALKMQ          ----------------------------------DPEGNVILT-----------------
D4M8M0_9BACT          ------------ERWRAAVEAQSNSSADLAARARGIEGAIVAPSEEEEGEAARFYLL---
E6SLR2_THEM7          ----------------------------------GPDGSVVVT-----------------
SECD_DICTD            ------------------------------------DET---------------------
SECD_DEHMV            ---------------------KPATATIDGVEYTLTSAYFKDSTYVNRDQ----------
B3T9T5_9ZZZZ          ---------------------QDAACTQFEDRDTGLSGEDIASANAGQGT----------
SECD_THET1            ------------------NGTPTPGTTPTPESTPQANQTPVAANVTPTPEDPQFQQAL--
B9KYU6_THERP          ------------------PTPTASASTPASATEPAAASETAAATPGATPT----------
A9B5U9_HERA2          ------------------LPSSVTGTTGVTTTDSLSNTNPLSSTNNLTTTTP--------
A7NP80_ROSCS          ------------------PTATLTEAETITSTETISPTAPEGPIYESITD----------
SECD_ANATU            --------------------STSTQPTETTTAPATEGQESLASTTVYHTI----------
SECD_PROMA            LIENKKIGEQVNDLRVALGL-ANSSLNEHDQIDQIRQKVNSEIVELFEP-----------
B5IKE7_9CYAN          VAEASFPAEQLAAALRQLGVEVPDGASEADQLELLLDTVNTRIVELYEP-----------
B4WJX6_SYNS7          -------------------------EAAIAANQAAITETQADILNLFEE-----------
D3EPH0_ATETH          -----------------------ETKKRIVELVESIDVSNQAILKLFDP-----------
SECD_ACAM1            -------------------------AAALAKLQGEVQQKQKQLTELQDQFFV--------
Q2JY13_SYNJA          ------------------------PVSALPRNERGEITAGEDPDALFER-----------
Q7NDR6_GLOVI          ----------------------------------------EAPNGEFEK-----------
Q1AWD0_RUBXD          ---------------------EGRVDEAKRDIRESLRQDDAYREGKTKILFEESPNPGGE
A0QWJ2_MYCS2          -------DPTMQILGLQVQANLCGE--DDILAGNDDPNLPLITCSTDGS-----------
A0A0H3MPV3_MYCLB      -------KQSIQFLALQFESTHCDK--DDILAGNDDPNLPLATCSTDHN-----------
C0ZZ50_RHOE4          -------DPTVQQQA--VANLDCSV--ADPLRGNDDPTLPLVACSQDGL-----------
D0LCM8_GORB4          -------QQTIARLQAQMAQMNCAEGTSDPLMGNDLPDQYLVACSQDGS-----------
D5UNI7_TSUPD          -------DPAAQQKA--ASQLNCDA--TDPLAGNDDPKLPLVTCGKLENDPKNPQPR---
D9UX19_9ACTN          -------AAAQAAQQKALAALTCAPNVADPLEGNDLPNQPLVTCGDKNA-----------
C7MQZ9_SACVD          -------AEAQQLQQQALARLTCDPDTLDPLAGNDDPNLPLVTCNQDGT-----------
A4FBB0_SACEN          -------STDPNVQMAALQALDC--NAEDPLRGNDDPKLPLVACDREGK-----------
C6WCM7_ACTMD          -------TLDASTVQQALAAFTC--PTNDPLLGNDDPAQPLLTCDQDMV-----------
C8XE16_NAKMY          GTDQAAFTAWQTSAQTVMPTISCAD--LEPYRGLDDPSKPLIACSDTGD-----------
D2S9I0_GEOOG          -----------------YATLTCDP--EDTTPEVDLPESHVAACTEDGS-----------
Q4JVE1_CORJK          ---------DGNKQQAAGALLDCEKN--DPMAGSDDADKPLVTCS--DQ-----------
C4LIX5_CORK4          ---------DPTTLQAAGSLLECKGS--DPLAGQDDPAKPLVTCDQ-DK-----------
Q8NPZ9_CORGL          ---------DPTVQIAASSLMQCTTDEMDPLAGTDDPRLPLVACDPAVG-----------
D7BNQ2_ARCHD          -------WITEQVVYNSLILECGSKDQAIASN-ADDPAKALVSCE--PGR----------
D6ZHF4_MOBCV          -------HITVRDMFIFNHLDCTDPASLKGGS-LDDPKKNLVACS--KEG----------
B2GIL6_KOCRD          --------ITPQLFQSYQALDCTAPQPQKDRA-AQPQDKAVVACD--PES----------
A9WSE2_RENSM          --------VDAALYKEFESYSCVTPITEPDPQ-QDP-AKPSVACD--PGT----------
E1VWF6_GLUAR          --------ITPELFQEFEGYDCETELKDRGGD-AADPAKPMISCD--TDM----------
C5CCH9_MICLC          --------VTPALLAEFQATDCTAP-RDPAAP-PPPSDRAIVACQ--PSAELADGAVTP-
B0REC2_CLAMS          --------VTPRLQAEFAAYDCATAPESDGQ--AAPADRAIIACS--DDG----------
E8NFI9_MICTS          --------ITPALQAQFLAYDCANPP-SNPA--QAPAKDPMITCG--LND----------
D5UEN5_CELFN          --------VTPAVQAEFDALDCTLPENRTGGV-PGDPEKAVVACD--LEG----------
D1BGW2_SANKS          --------ITPELLAEFQALTCSPDASAAGTA-PKDPASPIAVCS--VDG----------
C5C5R0_BEUC1          --------ITEQVTYDFYRLDCSLPENRTGGG-GDDPDAPLVACT--TDG----------
C7R4G5_JONDD          --------ITRDVVEEFYALDCTSPDSLTGGGGVADPNAVLVTCS--EEG----------
D1BSK1_XYLCX          --------ITDEIQQQFDDLDCTAEGALVGRG-GDDPDAPLVTCS--TDG----------
Q83MZ7_TROWT          --------ITKYWRDRFDSHNCKDNAGDSTPD-----NLPLVVCD--QYG----------
A6WCH6_KINRD          --------STPDLAAVYANLDCSDPAQRSGGV-VDDPARPLVTCS--QDG----------
E6SB77_INTC7          --------AAAKVAKEYVGLNCLEPGAVDRATDL--KDAPMATCG--EDG----------
C7NI44_KYTSD          --------IPPEVQSRFEEMDCSDEKAQDAAQKAG-DDEFVVACD--PDG----------
C7MCC2_BRAFD          --------LTPEIESELMSADCVDPAAQQEKVADAAADEPVVACD--PDG----------
D6Y2C4_THEBD          --QDLTGI-DPALLDRFRTLDCTARNRGQGTQD-DPDRQ-IVACS--ADGS---------
D2AWR2_STRRD          --VDPAGI-DPAVLKQFQELDCAKDN-GQGAQD-DPNKQ-FVGCS--QDSS---------
D1AEV4_THECD          --LDYAGIGDKAVITQFERLDCTAQDKKAPGAD-DPAKQWVAACG--EDGS---------
A0LUK3_ACIC1          --PNAETAPTPQEIAAYQALDCTKPENQKGGIT-DDPAKFLVTCGNVDGGW---------
A8KZE4_FRASN          --DPNAPTPPADVADKFANLTCSATGVRSTSVSLDRPEDWIAACD--RNGT---------
Q2JD92_FRACC          -------SPPADVFARYESLTCAAADVRKASVSTDRPQDWTAACD--RTGT---------
E2PV76_STRC2          -----------ALQTAFATLNCEDQKARAAVTESARPENPMVSCG--KNS-AGQWE----
E4N7T8_KITSK          -----------ALQQKYAALDCSDKAQRLNYQKTNDPTAPAIACS--YNDEQGLWY----
C7QJQ1_CATAD          -----------AKAPDGTVKETQPSDQSVELYETIDCNHPPTNLG--SMFAANQFAVGCD
D7GDS9_PROFC          -----------QDSTDFAAWNCGEPE-----NVA--PDQPLFACD--EQGQ---------
Q6A8K5_CUTAK          -----------EDQKAFEDYKCAKSV-----DSP--GDKPLVTCD--RERT---------
D2PVF3_KRIFD          -----------ASQQAFAAYTCDKPA-----PVDD-PAKPLISCD--REKT---------
A1SJA9_NOCSJ          -----------AAIEAFNAYTCPTTK-----PVDDNPDKFLVTCG--TEAEG--------
C4RGU0_MICS3          -------PVAGREAQAVRHAHAARGR---RAAGEMQFTVPTITCAQLDKRPP--------
A4X5X5_SALTO          -------AADPSLVEKLTPFASLDDREVAVLPAQMQFTVPQITCAQLDARPP--------
D3PYP7_STANL          -------FPQLGYTEDFAKFGKLSPDEVAVLAPSWQYYIPNIGCGQLNGRTP--------
E1QZN3_OLSUV          -----------------VRLDEIGDADALAKIKAGTQGVSLQDGS---------------
C7LYS6_ACIFD          -------------PTKGQHVSATRPPTSCPTSAAGLAAEAAVPTTPTQVALHSQT-----
                                                                                  

B1YJQ7_EXIS2          ------------------------------------------------------INDKVL
D6XWY8_BACIE          ------------------------------------------------------TENELL
E3E8W8_PAEPS          -----------------------------------------------------GQYSKIE
C0ZAP6_BREBN          ------------------------------------------------------ENGKIM
SECD_ALIAD            -----------------------------------------------------IVPVGPP
SECD_ANADE            ---------------------------------------------------TYLLRAKTE
Q08P79_STIAD          ---------------------------------------------------SYLVEKESP
A9F8D1_SORC5          ---------------------------------------------------TYFLFSKAE
Q6MKZ2_BDEBA          ---------------------------------------------------PYLLKTDTD
E1X0T6_HALMS          ---------------------------------------------------PYLVEENSA
D0LJ86_HALO1          ---------------------------------------------------TYYLNRPVE
SECD_SYNFM            ---------------------------------------------------QIVLNDRTL
Q2LVH4_SYNAS          ---------------------------------------------------PYLLKSKTL
E1YHR5_9DELT          ---------------------------------------------------PYLVKKLTL
E1QIL8_DESB2          ---------------------------------------------------PIVVRARRA
B8F9E3_DESAL          ---------------------------------------------------PYLVKKKVL
SECD_THEYD            ---------------------------------------------------PYIVKKDVL
D8PI89_9BACT          ---------------------------------------------------PYLVKKRVM
B6ANM3_9BACT          ---------------------------------------------------PYLLVHGAL
B5ECA4_GEOBB          ---------------------------------------------------PIVVKKKAI
Q3A3C4_PELCD          ---------------------------------------------------PLVVYDKTV
D5MHP3_9BACT          ---------------------------------------------------PIVVQKRAV
SECD_CALNY            ---------------------------------------------------PYVLKKDAV
SECD_DESIS            ---------------------------------------------------PFVLYRDVI
C4XSM5_DESMR          ---------------------------------------------------PIALKADAV
C7LN34_DESBD          ---------------------------------------------------PIVLKSEVV
Q1MSC1_LAWIP          ---------------------------------------------------LIPLEREPV
SECD_MAGMM            ---------------------------------------------------PLLVFKRTI
SECD_RHOM4            ---------------------------------------------------LLGVRKEVE
D5HAA4_SALRM          ---------------------------------------------------LLAVRAEPE
B3EJI9_CHLPB          ---------------------------------------------------VYLLKKTPE
Q3ANT9_CHLCH          ---------------------------------------------------LYLIKKTPE
B3QTH7_CHLT3          ---------------------------------------------------VYPLKKQAE
B0VHR7_CLOAI          ---------------------------------------------------LYVLSSAAQ
SECD_ELUMP            ---------------------------------------------------FSFLEKEVK
SECD_UNCTG            ---------------------------------------------------DYYVLDKAL
SECD_ACEP3            ----------------------------------------------------LPVFDHVD
Q0BS58_GRABC          ----------------------------------------------------LVVKRRAD
D3NUL2_AZOS1          ----------------------------------------------------YVIRKKVE
D8JWH1_HYPDA          ----------------------------------------------------YLLREQPV
E3I016_RHOVT          ----------------------------------------------------VLVHKEVI
E2CQN1_9RHOB          ----------------------------------------------------YLLEETPL
A7HXL0_PARL1          ----------------------------------------------------VLVERRIM
B0UI92_METS4          ----------------------------------------------------VPVERRVM
A7IND6_XANP2          ----------------------------------------------------YLVEKQVR
A4U1K0_9PROT          ----------------------------------------------------YVVKKRVE
D5BQT5_PUNMI          ----------------------------------------------------FVIEKRVM
Q9A6U2_CAUVC          ----------------------------------------------------YVVRKRAL
D9QLN2_BRESC          ----------------------------------------------------YLVKKRIL
Q5NL89_ZYMMO          ----------------------------------------------------VAVQRRAI
Q1GSE5_SPHAL          ----------------------------------------------------EVLRRQVM
SECD_RHOCB            ----------------------------------------------------HLLDEVPV
Q0C0W6_HYPNA          ----------------------------------------------------LLVREIPE
C6XJ02_HIRBI          ----------------------------------------------------YVVHEDPI
Q0ANE6_MARMM          ----------------------------------------------------LAVETRQR
Q2RTI1_RHORT          -------------------------------------------------------GEGGT
SECD_ECOLI            ------------------------------------------------------LYKRVI
C4K8M1_HAMD5          ------------------------------------------------------LYKKVI
SECD_HAEIN            ------------------------------------------------------LFKRAV
A1SWT8_PSYIN          ------------------------------------------------------VKKQII
Q493H1_BLOPB          ------------------------------------------------------LYKQIV
Q7VQA9_BLOFL          ------------------------------------------------------IYKKVI
B8GTQ2_THISH          ------------------------------------------------------LRRQVM
Q31FZ7_HYDCU          ------------------------------------------------------LKRSII
D0KW97_HALNC          ------------------------------------------------------LKRQVI
Q60B03_METCA          ------------------------------------------------------LERKII
A1WXP8_HALHL          ------------------------------------------------------LERQRI
D3RSH9_ALLVD          ------------------------------------------------------LKRRVI
D0U555_9BACT          ------------------------------------------------------LKTNVI
Q5ZU07_LEGPH          ------------------------------------------------------LKRQVV
A9KE82_COXBN          ------------------------------------------------------LKQQVV
A0A0E1PNG4_ACIBA      ------------------------------------------------------LQRNRI
Q0VS97_ALCBS          ------------------------------------------------------LNKSSI
A4GHV3_9BACT          ------------------------------------------------------LQDAII
A4GK28_9BACT          ------------------------------------------------------LEKKVI
Q1QTM7_CHRSD          ----------------------------------------------------ADLMRDII
A1TZN9_MARHV          ----------------------------------------------------ARLERDVI
C3K1N2_PSEFS          ----------------------------------------------------ALIERGLI
B8KXG6_9GAMM          ----------------------------------------------------EWLERDLI
Q21KW0_SACD2          ----------------------------------------------------AWLEKRPF
B3PDJ8_CELJU          ----------------------------------------------------AVLERQII
C7RB47_KANKD          ------------------------------------------------------VFDEVQ
B2FN02_STRMK          ------------------------------------------------------LNKRVI
A5EWX7_DICNV          ------------------------------------------------------LKRRVV
Q145I2_PARXL          ------------------------------------------------------LRKQII
D8INT3_HERSS          ------------------------------------------------------LNKEPV
E6UXK2_VARPE          ------------------------------------------------------VKKQVL
D6CKE5_THIA3          ------------------------------------------------------VKRDVL
E8UEP8_TAYEM          ------------------------------------------------------LRRQVI
E0XSS7_9PROT          ------------------------------------------------------LKKEIL
D7N3K1_9NEIS          ------------------------------------------------------VSKQVE
D7DM25_METV0          ------------------------------------------------------VKKSVV
Q0AG53_NITEC          ------------------------------------------------------VKKQIL
B6BWI8_9PROT          ------------------------------------------------------LKKDVI
B7J4R7_ACIF2          ------------------------------------------------------LYTNTV
Q0HXS6_SHESR          ---------------------------------------------------------TPV
E1SV05_FERBD          ---------------------------------------------------------LPV
B7VQL0_VIBTL          ---------------------------------------------------------NSI
Q7MD23_VIBVY          ---------------------------------------------------------RPV
A1S8J5_SHEAM          ---------------------------------------------------------APV
A4SLM7_AERS4          ---------------------------------------------------------KPV
Q15N36_PSEA6          ---------------------------------------------------------KPI
Q3IL52_PSEHT          ---------------------------------------------------------VPI
A8EY98_RICCK          ----------------------------------------------------VVIKKKVV
B3CTC4_ORITI          ----------------------------------------------------LLVRRQPT
B9KH60_ANAMF          ----------------------------------------------------YPVLKKVE
A0A0H3M0Z2_EHRRW      ----------------------------------------------------YPILRKVE
B3CPT1_WOLPP          ----------------------------------------------------YPIFRKTE
Q2GDE0_NEOSM          ----------------------------------------------------LPLERTPS
D0RNY3_9PROT          ----------------------------------------------------FNVEKTLV
Q4FM00_PELUB          ----------------------------------------------------AMVSKRII
Q7VFM8_HELHP          QEKLNELKEHPQNSMSSQERTNTLFAERIKIEGEIAKIQQELEAKKTKLNQVILLKAVPI
C5ZWZ2_9HELI          -------------------------------------------------NQKILLKAIPI
E7A9U3_HELFC          -------------------------------------------------RGQLLLRAIPI
A0RNX0_CAMFF          -------------------------------------------------KFKYLIKDIPV
C3XE91_9HELI          -------------------------------------------------MAKLPLKAVPI
SECD_AQUAE            ------------------------------------------------GREWFLVEKAPV
D3DH34_HYDTT          ------------------------------------------------PQEWFLVEKLPV
B4U9J1_HYDS0          ------------------------------------------------GHEWYLVKKKPI
C1DVG5_SULAA          ------------------------------------------------VKEWFLVKKTPV
E8T6K3_THEA1          ------------------------------------------------AYNFFLVKREPI
SECD_KORVE            ------------------------------------------------TQVFYLVARSSA
E8X5K0_GRATM          ------------------------------------------------DQV-WLLNRASE
C1F9I4_ACIC5          ------------------------------------------------PAAWYEVTKVPV
Q029K4_SOLUE          ------------------------------------------------GEQWYLVAKNAV
SECD_PETMO            -------------------------------MYSYVKDSNNPNLWYRVKNVFEFGDAPFQ
C5CF36_KOSOT          -------------------------FWTKSFHYGKIENGVENRIWYYISPKINIGGRYVE
A6LP86_THEM4          ----------------------------------WLLDR-EGKKWYLVKKEIA-NISNLK
A0A1Q6S007_9FIRM      --------------------------------------------GYVYKTPSGDTAKTIL
D3R265_MAGIU          -----------------------------------------------------DESGKVV
B8I6M6_RUMCH          ------------------------------------------------DSNGYLPTGKII
B0SPU4_LEPBP          NKAGKKAQDEFLAGLEKKY------NIPKDYKVYAMWARGNSAKSTLLPRSFVVLERKIA
SECD_TREPA            -------------------------------------KDSYGLDVRDG---FLVVKKEPA
Q73PW4_TREDE          -------------------------------------KDAYGIDERDDREPFLVVKKQAG
E1R5K7_SEDSS          -------------------------------------KDSYGIDQLRR---WVVVREEVG
E0RQA9_SPITD          -------------------------------------KDKYGVDKLVR---SIAIYEEVG
D5UAD5_BRAM5          -------------------------------------KDDFGRRIRGA---PVIVNKEPS
SECD_LEPBD            ------------------------------------------------------SYGPVL
SECD_SEBTE            ------------------------------------------------------SYGPTV
A5TW61_FUSNP          ------------------------------------------------------TLGETL
SECD_GEMAT            QMPGQYIVPESAFPAIERALQHPAILAAVPPGKVIRWGVDSLVSGAARFRALYVLDARPI
B2A263_NATTJ          -------------------------------------------------------DVSPF
SECD_ACIFV            ------------------------------------------------------------
D1BLM4_VEIPT          ------------------------------------------------------------
B8CXF7_HALOH          ------------------------------------------------------------
D9QVJ1_ACEAZ          ------------------------------------------------------------
D5XEJ6_THEPJ          ------------------------------------------------------------
Q2RHU6_MOOTA          ------------------------------------------------------------
Q3ABZ0_CARHZ          ------------------------------------------------------------
B0TF81_HELMI          ------------------------------------------------------------
C9R7V3_AMMDK          ------------------------------------------------------------
B1I4K5_DESAP          ------------------------------------------------------------
C8W4E1_DESAS          ------------------------------------------------------------
A4J544_DESRM          ------------------------------------------------------------
Q0AX22_SYNWW          ------------------------------------------------------------
Q892A4_CLOTE          ------------------------------------------------------------
D9SMV2_CLOC7          ------------------------------------------------------------
Q67LL8_SYMTH          ------------------------------------------------------------
D9TNU7_THETC          ------------------------------------------------------------
A4XIR1_CALS8          ------------------------------------------------------------
E3GFZ5_9FIRM          ------------------------------------------------------------
D9RXQ2_THEOJ          ------------------------------------------------------------
E3PRC6_ACESD          ------------------------------------------------------------
A6TQN4_ALKMQ          ------------------------------------------------------------
D4M8M0_9BACT          ------------------------------------------------------------
E6SLR2_THEM7          ------------------------------------------------------------
SECD_DICTD            ------------------------------------------------------------
SECD_DEHMV            ------------------------------------------------------------
B3T9T5_9ZZZZ          ------------------------------------------------------------
SECD_THET1            ---------------------------------------------QATPPEQLQRTYTTV
B9KYU6_THERP          ---------------------------------------------PAATPTPTGTVYETI
A9B5U9_HERA2          ---------------------------------------------TTTTERPCESPYTTI
A7NP80_ROSCS          ------------------------------------------------------------
SECD_ANATU            ------------------------------------------------------------
SECD_PROMA            ----------------------------------------------------------SS
B5IKE7_9CYAN          ----------------------------------------------------------AA
B4WJX6_SYNS7          ----------------------------------------------------------SQ
D3EPH0_ATETH          ----------------------------------------------------------AG
SECD_ACAM1            ---------------------------------------------------------KTD
Q2JY13_SYNJA          ----------------------------------------------------------VG
Q7NDR6_GLOVI          ----------------------------------------------------------TD
Q1AWD0_RUBXD          ----------------------------------------------GLYVAGYVVRERPD
A0QWJ2_MYCS2          ---------------------------------------------------TVYLLNKSI
A0A0H3MPV3_MYCLB      ---------------------------------------------------MAYLLAPSI
C0ZZ50_RHOE4          ---------------------------------------------------NIYLLGPSI
D0LCM8_GORB4          ---------------------------------------------------QVYLLGPEI
D5UNI7_TSUPD          ---------------------------------------------------MVYTLAPSI
D9UX19_9ACTN          ---------------------------------------------------TKYVLGPEI
C7MQZ9_SACVD          ---------------------------------------------------EKYVLSPVF
A4FBB0_SACEN          ---------------------------------------------------QKYVLEPVF
C6WCM7_ACTMD          ---------------------------------------------------TKYVLGPVT
C8XE16_NAKMY          ---------------------------------------------------AIYLLEPTI
D2S9I0_GEOOG          ---------------------------------------------------AKYLLGPAI
Q4JVE1_CORJK          ---------------------------------------------------GPMVLGPAP
C4LIX5_CORK4          ---------------------------------------------------SVHLLDAAP
Q8NPZ9_CORGL          ---------------------------------------------------GVYVLDPAP
D7BNQ2_ARCHD          --------------------------------------------------GTKYILGPAE
D6ZHF4_MOBCV          --------------------------------------------------YEKYILGPEV
B2GIL6_KOCRD          --------------------------------------------------KTKFILGPVE
A9WSE2_RENSM          --------------------------------------------------GYKYILGPVE
E1VWF6_GLUAR          --------------------------------------------------GVKYILGPQE
C5CCH9_MICLC          --------------------------------------------------AQKYILGPVV
B0REC2_CLAMS          --------------------------------------------------AAKYVLGPVE
E8NFI9_MICTS          --------------------------------------------------GTKYILGPVE
D5UEN5_CELFN          --------------------------------------------------LSKFILGPVE
D1BGW2_SANKS          --------------------------------------------------TMKYILGPME
C5C5R0_BEUC1          --------------------------------------------------AAKYILGPAE
C7R4G5_JONDD          --------------------------------------------------DTKYILGPME
D1BSK1_XYLCX          --------------------------------------------------LFKYILGPVE
Q83MZ7_TROWT          --------------------------------------------------TTKYLLGPVE
A6WCH6_KINRD          --------------------------------------------------LTKYVLGPAE
E6SB77_INTC7          --------------------------------------------------VSKYVLGPVE
C7NI44_KYTSD          --------------------------------------------------QVKYLLGPTR
C7MCC2_BRAFD          --------------------------------------------------SVKYLLGPEV
D6Y2C4_THEBD          ---------------------------------------------------LRYILDKAA
D2AWR2_STRRD          ---------------------------------------------------TKYVLDKAA
D1AEV4_THECD          ---------------------------------------------------AKYILGPVR
A0LUK3_ACIC1          ---------------------------------------------------YKFLLYPTL
A8KZE4_FRASN          ---------------------------------------------------TKYLLQPAA
Q2JD92_FRACC          ---------------------------------------------------TKYLLKPAT
E2PV76_STRC2          ----------------------------------------------------KYLLGPAE
E4N7T8_KITSK          ----------------------------------------------------KFVLGGVA
C7QJQ1_CATAD          Y-----------------------------------------------TTKVPYLLAPAD
D7GDS9_PROFC          ---------------------------------------------------LKYLLGPEL
Q6A8K5_CUTAK          ---------------------------------------------------MKYLLSPVA
D2PVF3_KRIFD          ---------------------------------------------------TKYLLGPAI
A1SJA9_NOCSJ          ------------------------------------------------DAGVKYLLSPAA
C4RGU0_MICS3          --------------------------------------------------ASIKDEKQKA
A4X5X5_SALTO          --------------------------------------------------ASISAVDQQA
D3PYP7_STANL          --------------------------------------------------GAISEIKEQV
E1QZN3_OLSUV          ------------------------------------------------------YTAFMD
C7LYS6_ACIFD          --------------------------------------------------AVLDLRQGTQ
                                                                                  

B1YJQ7_EXIS2          LD-----------------GSDLKAKGAKVGYDPQTNAP--------LVELTMKSKE---
D6XWY8_BACIE          MD-----------------GGDLVEGGAQQTFDPETNRP--------IVQVTVDDPS---
E3E8W8_PAEPS          LR-----------------GNDFVENGAVVGYD-QLNQP--------EISIKVKDKA---
C0ZAP6_BREBN          LQ-----------------GSDLAPNGAAVGYD-DLKRP--------LVTLKFSDPK---
SECD_ALIAD            LA-----------------TGADLKSNAHWVVDQQTGQN--------AVAIEFKNAS---
SECD_ANADE            LT-----------------GDYIADAAVAIDQSDTLQR----GRPVVSFKMSPEGAR---
Q08P79_STIAD          LT-----------------GESLSSADARFSELN---------EPEVNITFDAAGAR---
A9F8D1_SORC5          IT-----------------GDMVRDAQALPDQSEG-GL----GGWYVSMDFTPTGAD---
Q6MKZ2_BDEBA          LG-----------------GGALDDAFVGYDQYGS---------PQVSLQFNSAGAQ---
E1X0T6_HALMS          LT-----------------GEALQDARVQIDQQKNE--------PYVSLEFKSSGAK---
D0LJ86_HALO1          LS-----------------GSSIADAYKYWDPTTNR--------PSVLIVFNRYGGR---
SECD_SYNFM            MS-----------------GEYITNAQVEIDRQHSSSY--------VALDFDAQGAK---
Q2LVH4_SYNAS          LT-----------------GDALENAQVKISDRFGEPH--------VALTFNSRGAA---
E1YHR5_9DELT          LT-----------------GASLSGASVQIDSQYNEPY--------VSIDFDNKGAK---
E1QIL8_DESB2          MT-----------------GENITDARVRPDPDYPGNY----L---VLVAFNSRGAA---
B8F9E3_DESAL          LT-----------------GEYLEKAYANMQGQFSEPV--------VSIEFNKKGGF---
SECD_THEYD            LT-----------------GDLLAEAHVSIDQRFNEPY--------VSLRFNDAGAK---
D8PI89_9BACT          LA-----------------GDVLSDARVSIGQ-FNEPY--------VSVTFDAKGAR---
B6ANM3_9BACT          MS-----------------GDLISDARVAFGQ-FNEPY--------VSLTFNSAGAK---
B5ECA4_GEOBB          IT-----------------GDLLTDAQVKIDSQNNEPY--------VAIDFNSTGAR---
Q3A3C4_PELCD          LT-----------------GDLVSDAQVRIDPRFNEPY--------VSIDFNAVGAK---
D5MHP3_9BACT          LT-----------------GDLLTSAQVQIDSQTNQPV--------VSIEFDQEGTR---
SECD_CALNY            LT-----------------GDYLLEAEVRISSQFNEPY--------VSIKFDPAGSK---
SECD_DESIS            FT-----------------GDRLLDARVRFDPQFNTPY--------VSITLDGEGAR---
C4XSM5_DESMR          MT-----------------GESIADARANFDP-NNQAY--------VALTFTPSGAR---
C7LN34_DESBD          LT-----------------GEYITDANVQFDS-YGQAY--------VGMNFNARGSR---
Q1MSC1_LAWIP          MT-----------------GENISDARPNFDDKNNKAY--------VALSFNSQGAK---
SECD_MAGMM            LS-----------------GQHIQNAQTTFNE-YNEPI--------VSVKFDAVGGR---
SECD_RHOM4            LT-----------------GEVITDARVEFDE-------LNR--PQVSMTMNSEGAR---
D5HAA4_SALRM          LT-----------------GEVVTEASVQFDR-------QTN-EPKVSITMNSDGAR---
B3EJI9_CHLPB          LT-----------------GGVITEAKATFGA-------SAV-QPEVTMKMNSDGTA---
Q3ANT9_CHLCH          LT-----------------GGVITEAKATFGS-------QGI-QPEVTMAMNTEGTS---
B3QTH7_CHLT3          LT-----------------GGVITEAKATFSS-------EGM-RPEVTMKMDGEGTR---
B0VHR7_CLOAI          LT-----------------GGDLAKAKVEYGSATSTDPRIAN-KPYISIEMKREGAR---
SECD_ELUMP            VT-----------------GADLENAQVNVGG-------DYG-YPEVSFTFSAEGAK---
SECD_UNCTG            LT-----------------GAALANAKVEFGG-------EYG-QMMVSIEFNRDGGK---
SECD_ACEP3            VD-----------------GTDLTNAGAVI--DQQ-TG-----EWAVSFSFDSVGTR---
Q0BS58_GRABC          VD-----------------GADLTDARPVP--NQQRAG-----AWSVSFTFNGVGAR---
D3NUL2_AZOS1          VD-----------------GATLQNASAGT--NPQ-TG-----EWVVNFEFNSAGAN---
D8JWH1_HYPDA          VQ-----------------GADLADAQPGFDSRNG--------EPVINFRFNQIGAR---
E3I016_RHOVT          VS-----------------GDDLVNAYAGYDSRAGGVG-----ERAVDFEFNSRGAA---
E2CQN1_9RHOB          LG-----------------GEDLVDAQVSFDQRNN--------EPVVNFRFNTSGAR---
A7HXL0_PARL1          VG-----------------GDRLVDAQPGFDQRNG--------QPVVNFRFDSSGAR---
B0UI92_METS4          AD-----------------GADLTDAQPGFDQKTN--------EPIVNFKFNLRGAQ---
A7IND6_XANP2          VS-----------------GEDLVDAQPGFDHNSR--------EPIVSFRFNNNGAR---
A4U1K0_9PROT          VG-----------------GDMLTDAQPTFR-DGR---------PVVSFRFSVAGGK---
D5BQT5_PUNMI          VS-----------------GEMLENATASFDQNNQ---------PAVSFQLDSAGAK---
Q9A6U2_CAUVC          VS-----------------GDELVDSRQSFDDRGA---------PAVSFKFNGSGSR---
D9QLN2_BRESC          VS-----------------GENLTKAEVSADQSGR---------PAIGFRFDGQGAR---
Q5NL89_ZYMMO          VT-----------------GVDLVHADQTMD-QNSLP--------AVSISFNADGGR---
Q1GSE5_SPHAL          IS-----------------GEQLINAQQSYDPQTSEP--------VVSIRFDSAGSS---
SECD_RHOCB            VT-----------------GDDLTDARPTTDDNGA---------PAVSFRFNVSGAR---
Q0C0W6_HYPNA          VV-----------------GSDIATASQGNDEAN---------RPQINFRLNANGAR---
C6XJ02_HIRBI          LT-----------------GADFATASQGFDENN---------RPQINFTLKGRGPK---
Q0ANE6_MARMM          LT-----------------GENLNSSNVTTHPSYV--------GPVVGFRLDTQGAL---
Q2RTI1_RHORT          ID-----------------GDRLTSAQATVQNGKP----------LISLRFDGVGER---
SECD_ECOLI            LT-----------------GDHITDSTSSQDE-YN--Q------PQVNISLDSAGGN---
C4K8M1_HAMD5          MT-----------------GDHITDAFFGIDE-YN--R------PQVNISLDSLGSA---
SECD_HAEIN            LG-----------------GEHIINSSSGLDQ-HS--S-----TPQVSVTLDSEGGE---
A1SWT8_PSYIN          LT-----------------GNHIVDAQSGSDD-MG--R------PQVSISLDSQGGS---
Q493H1_BLOPB          LS-----------------GDNIINSNVGLDE-YN--R------PQVNISLDKTGSI---
Q7VQA9_BLOFL          LT-----------------GDHVINANMSFDE-YH--R------PQVNISLDSFGNT---
B8GTQ2_THISH          LT-----------------GDYIVDAASGIAQ-DS--G-----GPAVFINLDAQGAR---
Q31FZ7_HYDCU          VS-----------------GDNVINAQSGIET-ES--G-----SAQVTVTLDGAGGR---
D0KW97_HALNC          VT-----------------GDRITGASSGFDQ-RS--G-----SPAVFVNLDGQGAR---
Q60B03_METCA          VT-----------------GDQVVDAASGIDQ-QS--G-----QPAVYVTLNSVGAK---
A1WXP8_HALHL          LS-----------------GDRIIDASSGFDQ-ES--G-----SPEVNIRLSGTGGR---
D3RSH9_ALLVD          VT-----------------GDQITDASAGFDS-QS--G-----SPAVFVNLDGQGAR---
D0U555_9BACT          TT-----------------GENIVDASSSMD--EN--N-----QPSVSIVLDSSGGR---
Q5ZU07_LEGPH          LS-----------------GDSITSAVSSFDQ-QT--A-----SPSVQIQLGGGGES---
A9KE82_COXBN          LK-----------------GTSIINASSVIGE-D---G-----RPAVRVRVSGSDVP---
A0A0E1PNG4_ACIBA      LT-----------------GERVQNASSGFSQ-DS--G-----GAEVNITLDSAGGK---
Q0VS97_ALCBS          AT-----------------GDQVIDAKMGFDQ-QN--G-----QPEVNVTLDSDGAR---
A4GHV3_9BACT          LG-----------------GDQVATAQASFD--EN--G-----LPQVNITLDGEGGS---
A4GK28_9BACT          IS-----------------GDRVSDASVGFD--EN--G-----FPQVNISLDSDGGA---
Q1QTM7_CHRSD          VT-----------------GDHVSSASRSFD--EN--N-----RPQVNINLDGTGGS---
A1TZN9_MARHV          AT-----------------GNNVANAQQAFD--EN--G-----QPQVNITMDSVGGD---
C3K1N2_PSEFS          IT-----------------GDQVTDAKAGFG--EH--G-----TPEVNIRLDGHGGE---
B8KXG6_9GAMM          IS-----------------GERVSGANAGFD--QN--N-----QPNVSISLDGEGGM---
Q21KW0_SACD2          VT-----------------GQNVTGATPGFDD-QS--N-----SPMVSISLDSKGAG---
B3PDJ8_CELJU          VT-----------------GDHVANAQSSFDP-ES--N-----QPQVNITLDGLGGE---
C7RB47_KANKD          VS-----------------GDHLTDAFSSFHP-QT--N-----QPIVSVRLDGEGGA---
B2FN02_STRMK          VT-----------------GDQMVGAQAVTDS-TS--G-----APAVSVTLNNVGGQ---
A5EWX7_DICNV          MS-----------------GDHIIDASAVYG---Q--G-----QPQVNVVLDSAGGA---
Q145I2_PARXL          FT-----------------GDRIIDASAGFD-EHQ--------RPSVNIRLDSAGGR---
D8INT3_HERSS          LT-----------------GDYISNASASFD-ENH--------QPAVSIDLNGDGGR---
E6UXK2_VARPE          VT-----------------GENLTDAQPGFE-QQT--N-----QPKVDLTMDSKGGN---
D6CKE5_THIA3          LT-----------------GDNLTDAQPGFD-QQT--N-----EPAVFLTLDSKGSR---
E8UEP8_TAYEM          LT-----------------GENLEDAQAGLD-PND--N-----SPAVNLSLDSKGSR---
E0XSS7_9PROT          LT-----------------GESLTDAQAGFDSQNP--I-----EPAVHLTLDGKGKR---
D7N3K1_9NEIS          LT-----------------GDNINDAQPSFD--EM--G-----SPAVSINLDGSGGT---
D7DM25_METV0          LT-----------------GDYITDAGPGVDS-QS--G-----RSTVNVTLDARGAR---
Q0AG53_NITEC          LT-----------------GDRITDAQPGFD--QD--H-----QPAVHLTLDNNGSR---
B6BWI8_9PROT          LT-----------------GENINNAGPGVDN-QT--G-----QSIVSLNLDSKGAN---
B7J4R7_ACIF2          LT-----------------GRYLSNASAGVDN-NS--G-----QAVVNVSFNNEGTR---
Q0HXS6_SHESR          LG-----------------GDHIVDARANIGE--M--G-----MAEVNIHLDRIGGQ---
E1SV05_FERBD          LT-----------------GEHIIDARAGLDE--M--S-----QPQVNIVLDAAGGR---
B7VQL0_VIBTL          LG-----------------GEHIIDARASLGE--L--G-----TPEVNITLDSTGGR---
Q7MD23_VIBVY          LT-----------------GEHIVNARAGVDK--M--G-----MSEVNISLDHAGGK---
A1S8J5_SHEAM          LG-----------------GEHIVDARSGSDE--M--G-----RPAVNIVLDTEGGK---
A4SLM7_AERS4          LT-----------------GEHIVDARAGMGE--M--G-----QPQVSIVLDTLGGS---
Q15N36_PSEA6          FT-----------------GSNIENATSGRDE--M--G-----IALVNLALDGIGGK---
Q3IL52_PSEHT          FT-----------------GEHINNAHAGRDD--W--S-----KPLVQLSLDSQGGD---
A8EY98_RICCK          LG-----------------GDQLTTASVSFDQN----S-----QAVVTFSFNNLGSK---
B3CTC4_ORITI          IG-----------------GDLLTNANVSFNKY----S-----QPVVSFTFNSLGTK---
B9KH60_ANAMF          IS-----------------GDSLVDASAGLNSL----G-----RPVVYFKFDSVATK---
A0A0H3M0Z2_EHRRW      IS-----------------GDSLVDVSSGINSL----G-----NVVVNFKLNNAAAK---
B3CPT1_WOLPP          IG-----------------GDSLVNASVRFGNL----G-----KPTVHFKFDSIASK---
Q2GDE0_NEOSM          LT-----------------GDLLDDASVAFSQR----G-----VPVVRFKFNAYGTK---
D0RNY3_9PROT          LS-----------------GEHLTDAQPGFDNIN---N-----SSVVNFKLDNFGAK---
Q4FM00_PELUB          LN-----------------GENLLDAQPQMNNQT---N-----ETVVSFTLDRVGAK---
Q7VFM8_HELHP          LD-----------------GSMLTDARAAFD----QNN-----QPIVSFSLDSKGAK---
C5ZWZ2_9HELI          LD-----------------GAMLTDARAAYD----QNG-----QPIINFTLNAQGGK---
E7A9U3_HELFC          LD-----------------GEMLTDAQVAYD----KNN-----QPVVSFSLDSRGAK---
A0RNX0_CAMFF          LD-----------------GNMLVDARVAFDN---QTN-----SPIISFTLNAEGAR---
C3XE91_9HELI          LD-----------------GSSIVKADSTID----ENK-----NDAVSFVLDSKGAE---
SECD_AQUAE            IT-----------------GQDLKTAYVGVDNLGQ---------PAVNFELKGEAAE---
D3DH34_HYDTT          IT-----------------GADLKTAYTSTDEFGA---------PAVTFELTDRGAR---
B4U9J1_HYDS0          IT-----------------GADLKTAYESTDSFNN---------PAVSFELNSKGAE---
C1DVG5_SULAA          IT-----------------GAMLKDARTALDQGGN---------PAVNFELTSEGAE---
E8T6K3_THEA1          LT-----------------GAYLKDAYPSQDENGL---------PAVSFVLNSQGAK---
SECD_KORVE            VA-----------------GHDLRQARVGRDQNGG---------ANVQFNLTRDGGV---
E8X5K0_GRATM          VE-----------------GTDFRDASGGTDVNGR---------PNIHFTLTTEAGD---
C1F9I4_ACIC5          VG-----------------GTDIRDAQPGTNPNTNE--------PQVNFYLTTSAGD---
Q029K4_SOLUE          IS-----------------GREMRNARPGQDEFRK---------WETNFSLSQDGGR---
SECD_PETMO            IT-----------------GLDVTDAVASLNSQ---GA----G-FVVNLNFSNEGRQ---
C5CF36_KOSOT          LD-----------------GSTITDAKALVNPRPQPGQ----GKFMVSLEFNRDGRD---
A6LP86_THEM4          LV-----------------SPKIVEAIPQVDRN---NV----AGYVVTFKMDKEYVD---
A0A1Q6S007_9FIRM      MD-----------------GSYVESATAGMTTDKTTGK----NSYVVQLKLKSSGDKNGK
D3R265_MAGIU          LE-----------------GSDVKKASHEVNTQN--GE----N--VVSLELTPEGAK---
B8I6M6_RUMCH          LE-----------------GSDVKEASAEVDGEN--------GGYCVALTLTSEGGK---
B0SPU4_LEPBP          LS-----------------GNDMTNAQPSYNSNS--------YGWMVSFTLTPNGAE---
SECD_TREPA            LE-----------------GRHIRDATVSSG-RANEP--------LVLFDLDHEGAR---
Q73PW4_TREDE          LE-----------------GKHLVSVDTSTDQRSNNP--------LVNFSLDAEGAK---
E1R5K7_SEDSS          LD-----------------GSHIQNATVGNHPVTGKP--------VINFTLDQEGGE---
E0RQA9_SPITD          LD-----------------GTYLTSAQVSRDPLTGKP--------VVLFSLNSEGSD---
D5UAD5_BRAM5          LE-----------------GSSLVNAQVGGG-QFGEV--------TVEFELNNEGAE---
SECD_LEPBD            LE-----------------GSALKSAGVSRDQVGM---------PSVSFELNSQGAN---
SECD_SEBTE            LD-----------------GSAIKNAYVQQDQFGK---------PMIGFELNDEGAV---
A5TW61_FUSNP          LT-----------------GSALKKADVSYDNLGR---------PQISFEMTPEGAQ---
SECD_GEMAT            IT-----------------GEVLTDARPATDPVEG---------NVVQFTLNNEGAR---
B2A263_NATTJ          VT-----------------GEHVEDAGVGYTPQGQ---------PYVNVHFTSQGAD---
SECD_ACIFV            -------------------GKDLKDSK-----ASA-DQSGQ---PVVTLQFNEDGAK---
D1BLM4_VEIPT          -------------------GDDLKDAK-----EEL-GQNKQ---PLVAIELSDEGAK---
B8CXF7_HALOH          -------------------GDYVVDAR-----PDY-DLYHR---PVVTFKLNDEGAR---
D9QVJ1_ACEAZ          -------------------GGHLVDAQ-----ATYGTQFNQ---PVIQFELDSVGKD---
D5XEJ6_THEPJ          -------------------GSDLKDAQ-----AAKNPTTGE---IYVALEFNKEGTK---
Q2RHU6_MOOTA          -------------------GKDLKDAK-----AIIDQQTRE---PQITLQFNAEGTK---
Q3ABZ0_CARHZ          -------------------GKDLRDAI-----EAKDPNTGL---AEVDLTFNAEGAK---
B0TF81_HELMI          -------------------GKDLKEAK-----EALEPGSNM---AIVHLTLNSEGAK---
C9R7V3_AMMDK          -------------------GRDLKEAR-----EAIDPATNQ---PVVNLTFNAEGAE---
B1I4K5_DESAP          -------------------GADLSDAR-----EAINPNTRE---PEVNLTWNPEGAK---
C8W4E1_DESAS          -------------------GRDLKDAE-----ESKAPDSSA---AQVNLTFTPAGAK---
A4J544_DESRM          -------------------GADLKNAV-----ESSDPVTNV---VEVGLEFNKEGTQ---
Q0AX22_SYNWW          -------------------GKHLKEAQ-----ARAGSEGQG---FEVAIDFDKEGAK---
Q892A4_CLOTE          -------------------GKDVKDAS-----PQQHQETKQ---PIISFELTNEGTK---
D9SMV2_CLOC7          -------------------GSDIKDAY-----PQYNQNSNQ---PEIGLELNDEGRQ---
Q67LL8_SYMTH          -------------------GNDVEKAG-----VAQNPSGSG---FIVTLKLKGEGPD---
D9TNU7_THETC          -------------------GADVKDSKAV--YQTSQTGVQE---PVVTLDLNSKGAK---
A4XIR1_CALS8          -------------------GRDVVDA-------YAQQTAAG---YVVALKFNKEGTK---
E3GFZ5_9FIRM          -------------------GKDVVDSKAV--QQKSSSGLEE---AVVTLKFNDEGTQ---
D9RXQ2_THEOJ          -------------------GDNVSDAK------AVYDNLNR---PLVSLKLDSEGAK---
E3PRC6_ACESD          -------------------GAEVTKAD-----VMIDSRNNQ---PFVSLEFNSEGSK---
A6TQN4_ALKMQ          -------------------GNNIRGSE-----VKFPSGQAN---PIVSLDLDSEGAR---
D4M8M0_9BACT          -------------------GKSLLSGKDLETASVNPDRLGR---MGVSLSFSPEGAK---
E6SLR2_THEM7          -------------------GDQLVAGG----IQVAADQAGR---PVVQLQFNPQGTE---
SECD_DICTD            -------------------GKTILTGSALKNAKVEFDQVGQ---PMVRVEMNPEGAK---
SECD_DEHMV            -------------------------------------------YGNILLVFEWDDIG--A
B3T9T5_9ZZZZ          -------------------------------------------VGEPILLFELKRGA--A
SECD_THET1            IT-----------------GNDIANARP---DFDP-------TTGEPVVSFELKPEA--A
B9KYU6_THERP          VT-----------------GADLKDAYP---TTD--------QFGNLVVGFELKPEA--A
A9B5U9_HERA2          AR-----------------GSDLDTSQVALTTDQA-------GRPAVFFRFQTNSDS--A
A7NP80_ROSCS          GK-----------------DLDLNSVQPPQIAGQS-------LQNQFAVPFAFTGES--A
SECD_ANATU            MT-----------------GKDLKSVVV---SRNP-------NTGEVVIDFTLSDEG--A
SECD_PROMA            LT-----------------GSDLVSAGRRQEQNL--------TSWEVTLAFNQDGGE--K
B5IKE7_9CYAN          FT-----------------GKELVTAGRQQQQSG--------SGWEVTLSFTQTGGE--Q
B4WJX6_SYNS7          LT-----------------GDKLSDAIAGTNGA---------GAWQVDITFDSEGAD--L
D3EPH0_ATETH          LS-----------------GKNLKNARYGPSQG---------IEWQVIIDFDNEGEE--K
SECD_ACAM1            LT-----------------GEDLNDAGYAISQSQP-------NKWDVTLRFDVDGGK--K
Q2JY13_SYNJA          LT-----------------GDLLRNAYPQAPRRGS-------QTWEVLLEFKPAGAE--K
Q7NDR6_GLOVI          LT-----------------GADLTNAFPQALQSGN--------GWEVALEFTGPGGE--K
Q1AWD0_RUBXD          MT-----------------GDAVESANLGRDPAGR---------LQVEINLTGRGGD---
A0QWJ2_MYCS2          MS-----------------GEEIKNATSGLDQQQGQ--------YVVDVEFKSG----GA
A0A0H3MPV3_MYCLB      IS-----------------GDQIQNSTSGMNQRGVG--------YVVDLQFKSA----AA
C0ZZ50_RHOE4          ID-----------------GQEIADASSVFNSQQSR--------HEISLSFKTT----GS
D0LCM8_GORB4          ID-----------------GRDIKEASAETDSQTGE--------WIVSLTFKGD----AA
D5UNI7_TSUPD          ID-----------------GQSIKNASSGIPQNQAQ--------YVVTLEFTGD----AA
D9UX19_9ACTN          IP-----------------GTEIANANSGYDQQRGQ--------WIVDLSFKSA----GG
C7MQZ9_SACVD          LE-----------------GTSISNASAVYDTQGGG--------WVVNLSFDSE----GA
A4FBB0_SACEN          LE-----------------GKEIDSAQASPPNPTNGNP-----GWSVDLKFKSA----GA
C6WCM7_ACTMD          PPADGSVPDSDYSMYSRLTGEDIDNAVSGTDPQGAG--------FVVSLTFKGS----GG
C8XE16_NAKMY          IS-----------------GTQIETASSGQSTQGAG--------WVVNMTFKSD----GY
D2S9I0_GEOOG          IE-----------------GTQVSDASAGTQQATGE--------WVVLLDFDSD----AE
Q4JVE1_CORJK          LLKG----ETDEKNGERLTGEMIDTNSQITGGLQPNSA-----QMAITFKFKTGEQTPGG
C4LIX5_CORK4          VLVG----QEGKKDPQRLTGEEIDTNSPITGGYDSNSG-----QMAITFKFKTSNKDKGG
Q8NPZ9_CORGL          LLNG----ETDEENGARLTGNEIDTNRPITGGFNAQSG-----QMEISFAFKSGDGEEGS
D7BNQ2_ARCHD          LE-----------------GSQISSASSGPSVNQQGQP---DGGFAVHMNFNSE----GS
D6ZHF4_MOBCV          LS-----------------GTDLVSASSGMGTNQQGNA---TGQWEVALKLDAD----GA
B2GIL6_KOCRD          IP-----------------GTEIADASYAQATNSQGHA---TGGYAVNLQFDEQ----GT
A9WSE2_RENSM          VA-----------------GKEITDASYGLQQGAQGTT---TNKWAVNLAFNQD----GA
E1VWF6_GLUAR          IS-----------------GDKIKDAYAQLARGVNGSV---TGEWVVVIEFDAE----GT
C5CCH9_MICLC          IP-----------------GTQIKGASNGMAQAQGGVS---TNQWVVNIEFDEE----GA
B0REC2_CLAMS          VD-----------------GSTISDATSGLQQSSQGVS---TGTWSVNLVFDGD----GT
E8NFI9_MICTS          LD-----------------GDDIADATNGQEQN--------TGRWAVNLVFNDQ----GT
D5UEN5_CELFN          IP-----------------GSEIATATSGLGTTQTGAS---TGQWVVNLEFTSK----GT
D1BGW2_SANKS          IA-----------------GTEIDSASSGLQVNSQGVA---LNTWAVNLRFTAA----GT
C5C5R0_BEUC1          LS-----------------GSDLTSAQMVYQTTSTGAA---TNIPVVQMNFTSE----GG
C7R4G5_JONDD          IS-----------------GNDIAQASSGLKQLQGGAM---TNDWIVNIAFNSQ----GT
D1BSK1_XYLCX          VE-----------------GTHIKQATSGLMPGPNNTV---TNEWGVSLTLDSV----GA
Q83MZ7_TROWT          VS-----------------GTDISRAVADPVSSHFAGA---SIGWGVTITFNAH----GG
A6WCH6_KINRD          LE-----------------GTDLTSAVSAQATNSQGFN---TGAWVVRLKFNGP----GA
E6SB77_INTC7          ID-----------------GSEIGDATSGYQPGPTGQP---TSIVEVRLSFKDS----GR
C7NI44_KYTSD          IQ-----------------GSSIADASSGPATNAQGQP---TGEIAVNLELDDA----GA
C7MCC2_BRAFD          VA-----------------GAAIASSSVSADVTPTGQA---TGYYVVNMGFTGE----GG
D6Y2C4_THEBD          VQ-----------------GTEIAGATA---GADRT-----IGEWAVQVSFKPR----GA
D2AWR2_STRRD          VT-----------------GTSIDTATA---GVDQT-----TGEWLVQLSFKGE----GP
D1AEV4_THECD          VE-----------------GRQIDEAEAVPPNMQEG-----RSTWSVQLKFKSQ----GA
A0LUK3_ACIC1          IE-----------------GKEIASASA--QLDPQT-----GTQWTVQLTMKSG----AA
A8KZE4_FRASN          LV-----------------GTDVSTASAGLLSSGGGSTSVTTGQWVVNVDFTGS----GQ
Q2JD92_FRACC          VV-----------------GTDVKTASAGLQG-GGGTTGITTGQWVVNVEFTGP----GQ
E2PV76_STRC2          VD-----------------GKDVDDAKGQFDQNRG--------IWIVTMDFTDK----GS
E4N7T8_KITSK          VN-----------------GQDVTKAQAVYDTQTGK-------GWMVDLSFNDT----GS
C7QJQ1_CATAD          VD-----------------GKDLSSASANPVTAGGQNQ-FLTGEWQVDLSFNSK----GA
D7GDS9_PROFC          IN-----------------GQRITDSSAAIPQGEVA--------WVVTMKFDGT----GA
Q6A8K5_CUTAK          IT-----------------GTQVVSADSGIPQGQLS--------YVVNLKFNSI----GT
D2PVF3_KRIFD          LK-----------------GTDLADASAGIPQGGFQ--------WQVNLNFNNE----GG
A1SJA9_NOCSJ          VE-----------------GTDLNSADAVVPSQSVS--------WIVQLSLGGE----GK
C4RGU0_MICS3          VACE----------DGVQKYLLDVAKVLGTDVGDANAVLDQTSSWVVSLDFKG----DGQ
A4X5X5_SALTO          VACE----------FGSIKYLLDQAKVVGTDINDANAVLDQTSQWVVSLDFTG----SGQ
D3PYP7_STANL          VACN----------RPSDADIKAAKKQKQSAYTKYLMAEAKVVGEDISNATVQP---DQQ
E1QZN3_OLSUV          -------------------GSHISSVNVAQDSSSATGQ------YAVNVTLDGE----GT
C7LYS6_ACIFD          VVGRY------------LVGPALLDGNAIKSVYAAPDTTSSTGSWLVDFTLTPKASP---
                                                                                  

B1YJQ7_EXIS2          -KFYEVTQQVSKMQP------------PANRLVIWLDYEKGDTYEKEIQKENS-------
D6XWY8_BACIE          -MFGDITSEISQRQP------------PDNIMAIWMDYEEGDDYWEEMQKEDS-------
E3E8W8_PAEPS          -KFAEITKRLMNKE-----------------LAIFLDDE---------------------
C0ZAP6_BREBN          -KLEEATRANLHKP-----------------MAIFLDET---------------------
SECD_ALIAD            -LWTSITKRYLQKP-----------------IYVFLNGQ---------------------
SECD_ANADE            -LMDKLTSEN-----------------MRRRMATVLDDKV--------------------
Q08P79_STIAD          -EFERLTEAG-----------------VGRRMAIILDDYV--------------------
A9F8D1_SORC5          -RFEDITGRN-----------------VKRRFAIILDEKV--------------------
Q6MKZ2_BDEBA          -KFADLTGNN-----------------VGKQMAIVLDKIV--------------------
E1X0T6_HALMS          -LFETITGEN-----------------IGRQLAIILDGNV--------------------
D0LJ86_HALO1          -RFGDMTSVN-----------------IGKKMAIILDETV--------------------
SECD_SYNFM            -LFEKITEAN-----------------VKKQLAIVLDGVV--------------------
Q2LVH4_SYNAS          -DFERITGEN-----------------VKKRLAIVLDGVV--------------------
E1YHR5_9DELT          -SFERITEEN-----------------VKKRLAIVLDNKV--------------------
E1QIL8_DESB2          -DFAEVTTKN-----------------VKRRLAIVLDGKV--------------------
B8F9E3_DESAL          -KFARITGEN-----------------VGKPLAIVLDGRV--------------------
SECD_THEYD            -IFEDITGKY-----------------VKRRLAIILDGNL--------------------
D8PI89_9BACT          -EFDRITGEN-----------------VKKRMAIVLDNTI--------------------
B6ANM3_9BACT          -LFDTITREH-----------------VKERLAIVLDNVV--------------------
B5ECA4_GEOBB          -LFDQVTAAN-----------------VGKRFAIVLDGNV--------------------
Q3A3C4_PELCD          -RFDQITASN-----------------VGKRMAIVLDDTV--------------------
D5MHP3_9BACT          -LFGEATAAN-----------------VGRRLAIVLDDTI--------------------
SECD_CALNY            -IFEEITAEN-----------------VNKRMAIVLDDNV--------------------
SECD_DESIS            -LFADVTGRN-----------------VGRRLAIVLDGHV--------------------
C4XSM5_DESMR          -QFERVTAEN-----------------VKKQLAIVLDGKV--------------------
C7LN34_DESBD          -IFEEVTGAN-----------------IKKRLAIVLDGTV--------------------
Q1MSC1_LAWIP          -MFERITAEN-----------------IKKRMAIVLDGKI--------------------
SECD_MAGMM            -KFSQITGEH-----------------IKERLAIVLDGKV--------------------
SECD_RHOM4            -IWARLTGAN-----------------VGKHIAIVLDNVV--------------------
D5HAA4_SALRM          -RWDRITAAN-----------------IGNRVSIVLDDIV--------------------
B3EJI9_CHLPB          -KWARITGAN-----------------IGRRIAIVLDGAV--------------------
Q3ANT9_CHLCH          -RWARITGAN-----------------IGKRIAIVLDGAV--------------------
B3QTH7_CHLT3          -VWARVTGAN-----------------IGKQIAIVLDKTV--------------------
B0VHR7_CLOAI          -KFERVTADN-----------------VGKRLAIVLDGVV--------------------
SECD_ELUMP            -KFGSLTGSN-----------------IGKQLAIVLDNTV--------------------
SECD_UNCTG            -IFEYITERN-----------------IGKSLAIVLDGIV--------------------
SECD_ACEP3            -AFSSVTQTN-----------------VGKR-FAIVLDNK--------------------
Q0BS58_GRABC          -KVADITAAH-----------------QGER-FAIVLDNR--------------------
D3NUL2_AZOS1          -RFAEVTKQN-----------------VGRP-FAIVLDNK--------------------
D8JWH1_HYPDA          -KFANFTKDH-----------------VGRP-FAIVLDDK--------------------
E3I016_RHOVT          -AFARVTREN-----------------IGRP-FAIILDGK--------------------
E2CQN1_9RHOB          -KFSVITQQN-----------------VGRP-FAIVLDEE--------------------
A7HXL0_PARL1          -QFGEVTRNN-----------------VGRP-FAIVLDDK--------------------
B0UI92_METS4          -RFGQATSEN-----------------VGRP-MAIVLDNE--------------------
A7IND6_XANP2          -RFAATTQDA-----------------VGRP-FAIVLDNQ--------------------
A4U1K0_9PROT          -RFADTTSAA-----------------SGKL-LAIVLDDK--------------------
D5BQT5_PUNMI          -RFGRVTGAN-----------------IGRP-FAIVLDGK--------------------
Q9A6U2_CAUVC          -KFGDATARN-----------------VGKR-FAIVLDGR--------------------
D9QLN2_BRESC          -RFGEATAAN-----------------IGKP-FAIILDGK--------------------
Q5NL89_ZYMMO          -RFAEVTQKN-----------------PGKR-FAIILDNV--------------------
Q1GSE5_SPHAL          -TFAKVTAQN-----------------VGKR-FAMVLDGK--------------------
SECD_RHOCB            -AFGDYTAGH-----------------IGEP-FAIVLDGK--------------------
Q0C0W6_HYPNA          -KFYETTRNN-----------------SGQL-FAIVLDDV--------------------
C6XJ02_HIRBI          -VFGDFTSEH-----------------INDS-FAIVLDGQ--------------------
Q0ANE6_MARMM          -IFGELTRAN-----------------RGRR-FAIVLDNE--------------------
Q2RTI1_RHORT          -RIIQMRGGE-----------------GGERGLEATIDGE--------------------
SECD_ECOLI            -IMSNFTKDN-----------------IGKPMATLFVEYKDSGKKDANGRAV--------
C4K8M1_HAMD5          -IMSDFTKDN-----------------IGKLMASLYVEYKDSGNKDINGRPI--------
SECD_HAEIN            -IMSQTTKKY-----------------YKKPMATLYVEYKDNGKKDENGKTI--------
A1SWT8_PSYIN          -MMSRFTKNN-----------------IGKPMATLFIEYLPTGKKKPNGKAI--------
Q493H1_BLOPB          -SISNFTKNN-----------------IGKAIATLFVEYKDSGKKDSKGHAI--------
Q7VQA9_BLOFL          -IISKFTKDN-----------------IGKIMATLFIEYKDTGKKDAQGHSI--------
B8GTQ2_THISH          -IFSRVTGEN-----------------IGRLMGTVFIETKTETVEENGEMVR--------
Q31FZ7_HYDCU          -KMLATTKEN-----------------IGHRMAVVYIENRVETIEKNGEKVK--------
D0KW97_HALNC          -RMADITGQN-----------------IGKQMGVVFIEHRTETKIVDGKPVK--------
Q60B03_METCA          -KMGDTTREN-----------------VGRAMAVVYIENKSETKEVDGQKVT--------
A1WXP8_HALHL          -IMNRATRDR-----------------VGDHMAVLFQERISETQMVDGEPER--------
D3RSH9_ALLVD          -RMRDVTTEN-----------------VGKPMAVVFIENRTTTQMVDGEPVK--------
D0U555_9BACT          -SMLDTTKEF-----------------IGYRMAVVFIENKVETVLEDGIAVK--------
Q5ZU07_LEGPH          -LFTKVTREN-----------------IGKRMAIVFVETKTTTQTINGEEKR--------
A9KE82_COXBN          -SFNRITGEN-----------------VGKPLAVVYVETQTTRHLVDGKVVT--------
A0A0E1PNG4_ACIBA      -LMSDATRNA-----------------VGKRMAVLFIENKQKISYVTDPKTGA--QTEVR
Q0VS97_ALCBS          -RMQRVTGKN-----------------VGNPMGVLFIETKTDVKKVID-EDGN--SVEQM
A4GHV3_9BACT          -KMHRATRGN-----------------IGKRLGVLFVEQKTRTVYERDVEGKQ---IPVQ
A4GK28_9BACT          -QMHRATRNN-----------------VGTRMAVLFVERKILSDVDSGINSI--------
Q1QTM7_CHRSD          -MMSRATRAN-----------------IGRNMAVVFIEHK--TRTRTVMEDG--EEVEKR
A1TZN9_MARHV          -LMNRATRNS-----------------IGRRMAVLFIEYR--TETETREVNG--EIVETE
C3K1N2_PSEFS          -LMSRATRSN-----------------VGRSMAVIFIEQRPVTTYTKQMVNGVEKDVPVQ
B8KXG6_9GAMM          -LMSRATRDN-----------------IKRRMGVLFIERKYRTRYEMD-ENG--DEKIVK
Q21KW0_SACD2          -LMHRKTRKH-----------------VNESMAIVLIEYDTKVREEVNEAGE---TVIVT
B3PDJ8_CELJU          -KMHRITRNN-----------------VGRQMGILFIEYKNRTEITRNAQGE---EVHRN
C7RB47_KANKD          -RMLRTTTAN-----------------RGNSLAMILKESVPVFEIKDGKRELVKS-----
B2FN02_STRMK          -RMFDFTSAN-----------------VNKPMAVVYTERVPTVTLVDGQ-EVRGF-----
A5EWX7_DICNV          -TMSEITRNN-----------------IGKPMATMYVEYLPVEKTDAAGETQT-------
Q145I2_PARXL          -AVASVSRDN-----------------IGKPMAMVLFEKG--------------------
D8INT3_HERSS          -KMREATRDK-----------------VGKAMAIVLFEKG--------------------
E6UXK2_VARPE          -IMRQVSIEN-----------------YKKRMAMLIFEKG--------------------
D6CKE5_THIA3          -IFQQVTREN-----------------VGKRTAMILFDRG--------------------
E8UEP8_TAYEM          -IFRDVTRDN-----------------INKRMAIVLFEKG--------------------
E0XSS7_9PROT          -VFRDVTRKN-----------------VGKRLAILLVEKG--------------------
D7N3K1_9NEIS          -IFGELTAAN-----------------VGKRMAMVLIDQG--------------------
D7DM25_METV0          -IFQQVTREN-----------------VGKRMAILLIEKG--------------------
Q0AG53_NITEC          -IFKQLTRNN-----------------VGKRMAILLVEKN--------------------
B6BWI8_9PROT          -IFKKITRDN-----------------IGKRIAILLIEKD--------------------
B7J4R7_ACIF2          -IFGDLTTKN-----------------VGKRMAILL------------------------
Q0HXS6_SHESR          -KMSEFSRAN-----------------IGKPMATSYSEYSRDEQG---------------
E1SV05_FERBD          -IMSDFTRNK-----------------IGYPMATAFSEYRQDAAG---------------
B7VQL0_VIBTL          -LMTNHSRSN-----------------IGNPMATLYSEYSQSETG---------------
Q7MD23_VIBVY          -KMSDFSATH-----------------IGKPMATVYREYTTQENG---------------
A1S8J5_SHEAM          -RMSDFSRGH-----------------IGEPMATRYSEYRASAEG---------------
A4SLM7_AERS4          -KMNQFSRQH-----------------VGSAMATVFTEYKTNAQG---------------
Q15N36_PSEA6          -KMSDFSKDN-----------------IGNPMVTIFSEYHKNSAD---------------
Q3IL52_PSEHT          -AMSAFSKAN-----------------IGKPMATVYSEYSQNAKG---------------
A8EY98_RICCK          -IFGEITKNN-----------------TGKRLAIVLDNKL--------------------
B3CTC4_ORITI          -LFADITKEY-----------------QGRRLAIILDSKL--------------------
B9KH60_ANAMF          -KLAEITKNH-----------------AGKQFAAVLDNVV--------------------
A0A0H3M0Z2_EHRRW      -KFAKITKEN-----------------FNKPFAIVLDGVV--------------------
B3CPT1_WOLPP          -KFAKITKEN-----------------VGKPFAIVLDNTV--------------------
Q2GDE0_NEOSM          -KLEQLSKAN-----------------VGRAMAIVLDDLI--------------------
D0RNY3_9PROT          -KFAYATKNN-----------------IGRRLAIVIDNQV--------------------
Q4FM00_PELUB          -RFGKATSTG-----------------IGKQLAIVLDGKI--------------------
Q7VFM8_HELHP          -IFGDFSGAN-----------------VGKRMAIVLDGKV--------------------
C5ZWZ2_9HELI          -IFGDFSGKN-----------------VGNRMAVVLDGKV--------------------
E7A9U3_HELFC          -IFGDFSGNN-----------------VGKRMAVVLDNKV--------------------
A0RNX0_CAMFF          -IFGDFTGSN-----------------VGKRLAIVLDGKV--------------------
C3XE91_9HELI          -IFGDFTGRN-----------------IKKRLAIVLDKRI--------------------
SECD_AQUAE            -KFGKFTEQN-----------------IGKRLAIVLDRKV--------------------
D3DH34_HYDTT          -AFGDATEKN-----------------IGRRLAIVLDKKV--------------------
B4U9J1_HYDS0          -IFGNFTQSH-----------------IDKRLAIVLDNRV--------------------
C1DVG5_SULAA          -IFGEATQKM-----------------IGKRLAIVLDGKV--------------------
E8T6K3_THEA1          -IFRNYTKHH-----------------IGTRLAIVLDNKV--------------------
SECD_KORVE            -RFSQFTSAH-----------------VGDKLGVILDGKV--------------------
E8X5K0_GRATM          -RFYKYTDAHKTGSP------------TPGSMAIVLGNKV--------------------
C1F9I4_ACIC5          -KFGRFTTAN-----------------KGKPLGIVLDNRL--------------------
Q029K4_SOLUE          -RFGRYTEAN-----------------IGNKLGVLLDNQL--------------------
SECD_PETMO            -KFELATA-----------------NLVNERIAIILDDEV--------------------
C5CF36_KOSOT          -TFRDITASKSGLPE----------NDIKKRLAIVLDDKV--------------------
A6LP86_THEM4          -IFRRITEKLYVPEELLNQGGVAYSQAMKKRLAIVLDNRV--------------------
A0A1Q6S007_9FIRM      ERFADITK-----------------EYLNQQVSIWMDDIM--------------------
D3R265_MAGIU          -KFAVATK-----------------ENLGKNLSINMDEKM--------------------
B8I6M6_RUMCH          -KFSEATG-----------------RLIGKPIAIFMDNDL--------------------
B0SPU4_LEPBP          -KFFDLTS-----------------ENRGRNLAIVWGDKV--------------------
SECD_TREPA            -IFSELTT-----------------KEIGRRLAIVSDGKI--------------------
Q73PW4_TREDE          -IFAELTT-----------------NNVGKRLAIVSDNKI--------------------
E1R5K7_SEDSS          -IFFQLTS-----------------TNQKGTLAILMDDKV--------------------
E0RQA9_SPITD          -IFYKLTS-----------------ANVDRSLAIVLDDKV--------------------
D5UAD5_BRAM5          -QFALVTA-----------------QNIDRMLAIVLDDKV--------------------
SECD_LEPBD            -TFAKITREN-----------------IGKQLAIMLDNKE--------------------
SECD_SEBTE            -KFAEITRTN-----------------MGKQLAIMLDGKE--------------------
A5TW61_FUSNP          -TFAKITREN-----------------IGRQLAITLDGVV--------------------
SECD_GEMAT            -RFKTETGKH-----------------VRDNMAIVLDQRV--------------------
B2A263_NATTJ          -RMREATQEH-----------------MRDHLVIVLDGEL--------------------
SECD_ACIFV            -KFADLTAR-----------------NVGRQIAILLDGKV--------------------
D1BLM4_VEIPT          -KFADLTSK-----------------NIGRRIAITLDGKE--------------------
B8CXF7_HALOH          -KFEAITTQ-----------------YLNRRIGIYLDDEL--------------------
D9QVJ1_ACEAZ          -KFAQLTKK-----------------HVGERIAIHLDEEL--------------------
D5XEJ6_THEPJ          -KFADVTSELVQKYSET---------DPRRRIGIYLDQQQ--------------------
Q2RHU6_MOOTA          -KFADVTKKLASSYPYG---------DPKRAIGIYLDQQL--------------------
Q3ABZ0_CARHZ          -KFADFTTK-----------------NVNRNLGIYLDGKL--------------------
B0TF81_HELMI          -KFADVTRA-----------------NVGKQIGIYLDEDL--------------------
C9R7V3_AMMDK          -KFKKATEE-----------------NLGRPIGIYLDGKL--------------------
B1I4K5_DESAP          -TFAEVTAA-----------------HVGRRLGIYLDGHM--------------------
C8W4E1_DESAS          -TFGDFTAR-----------------NVGRNLGIYLDGKL--------------------
A4J544_DESRM          -KFAEATSA-----------------NVGKRIAIILDGNV--------------------
Q0AX22_SYNWW          -LFADATTA-----------------NVNKPLMIVIDGKV--------------------
Q892A4_CLOTE          -KFAEATNKFKGQ-----------------QIAIYMDEEL--------------------
D9SMV2_CLOC7          -KFADATAKLIGK-----------------TIAVYMDEEK--------------------
Q67LL8_SYMTH          -KFYEATRKYVGK-----------------PIFILLDDEI--------------------
D9TNU7_THETC          -AFADATGKFVGQ-----------------QIAIVLDNKT--------------------
A4XIR1_CALS8          -KFAEGTRKYLGQ-----------------NIGIYLDGKL--------------------
E3GFZ5_9FIRM          -LFADATQKYLNQ-----------------QISIKLDDEV--------------------
D9RXQ2_THEOJ          -KFEEATKKFLNK-----------------PIAIVLDGEI--------------------
E3PRC6_ACESD          -KFAEATRSLAPT---------------NEPIFIVLDGEV--------------------
A6TQN4_ALKMQ          -IFAEVTGRLAQIPNSQ---------VDDKIIYIVLDDEI--------------------
D4M8M0_9BACT          -LFEEATAR-----------------LVGKQIAIVLDNVV--------------------
E6SLR2_THEM7          -KFAEATRK-----------------FLGSPISIVLDDQV--------------------
SECD_DICTD            -IFADFTSK-----------------NVGKQVFIVLDGKV--------------------
SECD_DEHMV            QLSKEITTRL-----------------LNQQLGIFEGDEA--------------------
B3T9T5_9ZZZZ          RAFAELTTRI-----------------FNSNPDSPDQLAY--------------------
SECD_THET1            KKFADFTTQN-----------------VGKYLAIALDKKI--------------------
B9KYU6_THERP          DRFYQYTSTH-----------------IGQPMSIVVDKQV--------------------
A9B5U9_HERA2          TQIASFTSQN-----------------IGRPMSIVVDNRV--------------------
A7NP80_ROSCS          RRLEQFTAAN-----------------IQRPMCIVLDNQV--------------------
SECD_ANATU            KIFDEYTSNN-----------------IGKILAIVLDKKI--------------------
SECD_PROMA            FASLTKSIAG-----------------SDRLLGIILDGES--------------------
B5IKE7_9CYAN          FARLTKEIAG-----------------SGRLLGIVLDGRS--------------------
B4WJX6_SYNS7          FAELTRNIAG-----------------TGRGLGIFLDNQL--------------------
D3EPH0_ATETH          FANLTKQVAG-----------------TGRSIGIFLDNIL--------------------
SECD_ACAM1            FAALTKSLAG-----------------TGQPLGIFLDGKS--------------------
Q2JY13_SYNJA          FTQLTRELAG-----------------TGRPIGIFLDDVL--------------------
Q7NDR6_GLOVI          FARITRELAG-----------------TGRRLGVFLDEKP--------------------
Q1AWD0_RUBXD          -QFFDLTRQIVDNALERG-------EPGTGRLAIVLDQDV--------------------
A0QWJ2_MYCS2          QTWADFTAANVGTQ-----------------TAFTLDSKVVSAPE---------------
A0A0H3MPV3_MYCLB      DVWADFTAAHIGTQ-----------------TAFTLDSEVVSVPV---------------
C0ZZ50_RHOE4          NTWAEFTSANIGKQ-----------------AAFTLDSKVVSAPT---------------
D0LCM8_GORB4          SFWPQYTASHVGTA-----------------TAFTLDTRVVSAPV---------------
D5UNI7_TSUPD          KAWADYTSNNRGKQ-----------------AAFVLDSQVITAPQ---------------
D9UX19_9ACTN          KTWGDFTSANIGKQ-----------------AAFVLDTDVVSAPT---------------
C7MQZ9_SACVD          DTWADFTAQNIGER-----------------AAFVLDTEVVSAPS---------------
A4FBB0_SACEN          KVWADFTSANVQQN-----------------AAFVLDTEVVSAPT---------------
C6WCM7_ACTMD          DKWGKFTSANVNQQ-----------------VAVVLDSQVVSAPN---------------
C8XE16_NAKMY          STWSSYTAAHVGTL-----------------TAMTLDGQVISAPR---------------
D2S9I0_GEOOG          ATWAAYTAANVGNN-----------------VAFTLDGRVISAPT---------------
Q4JVE1_CORJK          ETWFALGQQMMGKR-----------------VAITLDSKVISAPE---------------
C4LIX5_CORK4          DTWAEVTQKYQGQQ-----------------VAITLDSEVISAPT---------------
Q8NPZ9_CORGL          ATWSSLTSQYLQQQ-----------------IAITLDSQVISAPV---------------
D7BNQ2_ARCHD          KKFAEVTGRISKLKSP------------QNQFAIVLDGKTVSAP----------------
D6ZHF4_MOBCV          KKFDAVAKVLYPNQTQG-----SNRNPDNNRFAIVLDSLVVSAP----------------
B2GIL6_KOCRD          ATFKELSERLYGLGQKG-------QQDPRSQFAIVLDGSVVSAP----------------
A9WSE2_RENSM          TKFKEVTTRLNGFYLAN-------QQDPKAQFAIVLDGKIVSAP----------------
E1VWF6_GLUAR          KIFADTTQRLIAL------------QGSQNQFAIVLDGETISAP----------------
C5CCH9_MICLC          KTFTEVTQKLTPYP----------EGDPRKQFAILLDGDVISAP----------------
B0REC2_CLAMS          KQFGDMSTRLITLE------------SPRNQFAFVLDNEVISAP----------------
E8NFI9_MICTS          EKFGQISQRLYGKQ------------APFNQFAFVLDGSVLSAP----------------
D5UEN5_CELFN          PRFTEVTTRLAT------------STPPLNQFAVVLDALVISAP----------------
D1BGW2_SANKS          DKFADVTTRLATLPTYAQWISTENPTLAPNMFAMVLDNQVIGAP----------------
C5C5R0_BEUC1          EKFAEITTRLAGLA----------AQPPLNQFAIVLDGNVISAP----------------
C7R4G5_JONDD          RDFETVTSRLSQLPEYEQWIYAP-TSSAPNMFAIVLDNLVLSSP----------------
D1BSK1_XYLCX          EQFAVTSQRLYDFG----------DGNPQNQFAIVLDGNVVSAP----------------
Q83MZ7_TROWT          EKFKDVSNRLISLA------------APRNQFAAVLDGVVITAP----------------
A6WCH6_KINRD          DAFSALTTRISTLE------------PPRNQFAAVLDGLVVTAP----------------
E6SB77_INTC7          ATFAEVTKRLVGLQ----------GQPPLDQFAVVLDKRVITAP----------------
C7NI44_KYTSD          DIFADLSAMMAAQP----------EGSPYNQFAMLLDGDVISAP----------------
C7MCC2_BRAFD          QAFGEMTTALYNGE------------GATGAFGIVLDGLVISAP----------------
D6Y2C4_THEBD          AQLAEVTRRISGLPA------------PRNRLASVLDGVVIVAP----------------
D2AWR2_STRRD          TQWSKVTTTAFNSQP------------PRNQVAMVLDGVVISAP----------------
D1AEV4_THECD          RQFAELTEEAYRASVSS----------PRRQIAIVLDGRVVSAP----------------
A0LUK3_ACIC1          SRWAKFTAANVNKDT-----------------AIVLDGLVMSAE----------------
A8KZE4_FRASN          TKFTNLTEKTIGKQV-----------------AIVLDGIVQSAP----------------
Q2JD92_FRACC          NKFTKLTESTIGKQV-----------------AIVLDGVVQSAP----------------
E2PV76_STRC2          KKFQKITSKLSQQQSP------------ANQFAIVLDGEVVSAP----------------
E4N7T8_KITSK          KAFAATTGQLATQSSP------------ANQFAIVLDGQVVSHP----------------
C7QJQ1_CATAD          KDFANVSSQLV---GT------------GGQFAVDLDGLVYSAP----------------
D7GDS9_PROFC          DQFQKATTQLATQSSP------------KNQFAIVLDGKVVSAP----------------
Q6A8K5_CUTAK          TSFSDATTYLCSKMSP------------QNQFAVVLDGKVISSPQL--------------
D2PVF3_KRIFD          EKFLQATTALSQRGQG------------QNLFAIVLDGETMSTP----------------
A1SJA9_NOCSJ          GVFADLSRAMSGTGQ---------------QFAVVLDGVVISSP----------------
C4RGU0_MICS3          EKWTNLTREAFNNEGQ-ACDQTALGQDGKCRVAVVLDNKVVSSPE---------------
A4X5X5_SALTO          EKWTALTGEAFRNEGN-ACDPSALGDSGNCRVAVVLDNQVVSSPE---------------
D3PYP7_STANL          QAGAYAVGISFTDSGA-SKWKKLATATVGKNVSIVLDNEVVSAPT---------------
E1QZN3_OLSUV          KTFADVTRELAPTHGR---------------IAIVLDGVINSAP----------------
C7LYS6_ACIFD          -LFNQIAKTF-----------------YQRQLAIVLDGTV--------------------
                                                                                  

B1YJQ7_EXIS2          ------KIVSDASVQQPINSDKAIISGG-DITAE------YGKQLSSILNAGALPVKLDE
D6XWY8_BACIE          ------KIVSAPRVQQRLNQSTVVITG--DFTVD------SAQDLAGILNAGALPVSLEE
E3E8W8_PAEPS          -------LLSAPTVRSELTDGSASITG--SYTRD------EANKLADTINLGALPLKLTE
C0ZAP6_BREBN          -------MQTNPTIQSVISGGSAQITG--NYTQE------SAQELADLLNSGAMPAKLVE
SECD_ALIAD            -------LLTNPVVEQVMYTGQSEISGGNLTTPQ------ACIDLANELNAGALPYPLTL
SECD_ANADE            --------ETAPYIQGRISS-NGQITLGS--GRNQQDMFDEANGIALVLKAGALPAPVTI
Q08P79_STIAD          --------QSAPRINEKIAGGSARITMGNPGGKSREEWFSEAQTLALVLKAGALPAPVTT
A9F8D1_SORC5          --------ESAPVIQTKIGGGRAQITMGS---QNPDQQLQDARKLELVLRSGALPAPISP
Q6MKZ2_BDEBA          --------KSAPSVRDRIAGGSAVITLGGGR--DRNGMMEEAKMISTSLRAGALPASLEQ
E1X0T6_HALMS          --------YSAPNIQTRIGGGRAQITIGSG---GFNKVMKEARDLALVLRAGALPVQLDF
D0LJ86_HALO1          --------NSAPVIQDAITGGRSTITMGGS---SNAAIEAEADDLVSVLKTGSLPAPLQE
SECD_SYNFM            --------YSAPVIQETIGGGKATITGSFT--------DQEARDLAIVLRAGALPAPVKI
Q2LVH4_SYNAS          --------HSAPVIQEKISGGQAQITGSFT--------MEEARDLAIVLRAGALPAPVKI
E1YHR5_9DELT          --------YSAPVIQEKISGGHARITGSFT--------AEEARDLAIVLRAGALPAPVKI
E1QIL8_DESB2          --------QSAPTIQEPITGGEARITGDFG--------LDEAKDLAVVLRSGALPAPIVV
B8F9E3_DESAL          --------FSAPVIQEKISGGQAVITGIGN--------MQEASDLAIILQAGALPVSLKI
SECD_THEYD            --------YSAPVIQEKIEGGNAQISGSFT--------LEEAKDLAIVLRAGALPAPVKL
D8PI89_9BACT          --------YSAPVIQERISGGRAQITGTFS--------MEEANNLSIVLRAGALPAPLKI
B6ANM3_9BACT          --------YSAPVIQEEIAGGQAQITGNFT--------LKEAKDLSIVLRSGALPAPVHI
B5ECA4_GEOBB          --------YSAPVIRERISGGSAQISGNFN--------EKEAADLAIVLRAGSLPAPVKI
Q3A3C4_PELCD          --------YSAPFIRERISGGSAQISGSFD--------EQEATDLAIVLRAGSLPAPVTI
D5MHP3_9BACT          --------YSAPVIREKIPGGKAQISGSFT--------MEDARDLAIVLRAGALPAPVNI
SECD_CALNY            --------YSAPVIRERIAGGEAQISGSFT--------LEEAKDLAIVLRAGSLPAPVKI
SECD_DESIS            --------HSAPVINERIPSGQASISGQFT--------MEQATDLSIVLRSGSLPAPVDI
C4XSM5_DESMR          --------YSAPTIQEKIGGGRASITGRFS--------TEEARDLAIVLRAGALPAPVTI
C7LN34_DESBD          --------HSAPVIQDRIGGGRASITGQFT--------TEEAHDLAVVLRAGSLPAPVNI
Q1MSC1_LAWIP          --------YSAPTIQERISGGKASISGNFT--------MAEAQDLSIILRAGSLPAPVTI
SECD_MAGMM            --------QSAPVIQDKIAGGRATISGSFT--------REEAHDLAIVLRAGALPAPLVI
SECD_RHOM4            --------YSYPVVNERIP-SGRSSITGLD-------SREEAQDIVTVLKSGALPAPVDI
D5HAA4_SALRM          --------YSSPNIQSRIS-GGRTEITGLE-------SRQEAQDIVTVLQSGRLQTDLNI
B3EJI9_CHLPB          --------YSAPVVESKIP-GGSSVINGID-------GIEEAQDLEIVLKAGALPAPVRI
Q3ANT9_CHLCH          --------YSAPVVQSKIP-NGNSVINGIE-------SLEEAKDLEIVLKAGALPAPVRI
B3QTH7_CHLT3          --------YSAPVVQSKIP-NGSSVINGID-------NIAEAQDLEIVLKAGALPAPVKI
B0VHR7_CLOAI          --------YSAPNIQERIA-GGRAQITGRF-------TATEANELAIVLNTGNLIAPIKP
SECD_ELUMP            --------QSAPSIQSRITRDGR--ISGRF-------TMDEARRLAITLRAGALPAPVKI
SECD_UNCTG            --------QSAPVIRTRISRGERASIEGNF-------NSEDAKVLAAVLRAGALPVPVRL
SECD_ACEP3            -------VIEAPVIRTPITGGNGQIT-GGFDAQK-------ATDLALMLRAGALPAPLSV
Q0BS58_GRABC          -------IISAPVIQSVIPDGRGEIT-GNFTAKT-------AQDLAVLLRAGALPAPLSV
D3NUL2_AZOS1          -------VISAPVIREPITGGRGQIS-GNFTAAN-------ANDLAVLLRAGALPAPLKV
D8JWH1_HYPDA          -------VLSAPVIREPILGGSGQIS-GSFTVEG-------TNTLAVQLRSGSLPTKLTI
E3I016_RHOVT          -------VISAPVIRSEIPGGRGQIT-GNFGVEE-------TNRLALLLRSGALPAALSI
E2CQN1_9RHOB          -------VISAPVIREPITGGSGQIS-GSFTVEG-------ANDLAVLLRAGALPAKLTV
A7HXL0_PARL1          -------VISAPRINEPIMGGSGQIS-GSFTVQA-------ANDLAILLRAGALPAPLNV
B0UI92_METS4          -------VVSAPRILQPITGGQGQIS-GRFTVQQ-------ANDLSVLLRAGALPAKLNI
A7IND6_XANP2          -------VISAPVIREPILGGSGQIS-GSFTVQQ-------ANDLAILLRAGALPAPLKV
A4U1K0_9PROT          -------VISAPRINEPILGGAGEIS-GSFSVQG-------AQDLALLLRAGALPAPLVV
D5BQT5_PUNMI          -------VVSAPTIQSQIFG-SGQIT-GNFTVAE-------TNELSLVLRAGALPAPLIV
Q9A6U2_CAUVC          -------IISAPTINGAILGGSGIIT-GSFTAES-------ASDLALLLRSGALPAPLKV
D9QLN2_BRESC          -------VISAPTINGAILGGSGIIE-GTFTIAQ-------ASELVNLLNGGALPAPLKV
Q5NL89_ZYMMO          -------ILSAPSINEPILGGSAIIT-GSFTIDS-------ANQMAIALRSGSLPVALKV
Q1GSE5_SPHAL          -------VLSAPSINEPILGGSAQIS-GSFSVAS-------ANNLAISLRSGALPVKMTV
SECD_RHOCB            -------VISAPTIQAHIAGGSGIIT-GRFSIEE-------ATDLALLLRAGALPAGMTF
Q0C0W6_HYPNA          -------IMSAPRINEPIPGGSVRIT-GTFTMTE-------AQDLAAIIAAGEMPAKVQF
C6XJ02_HIRBI          -------VISAASVRSPILSGSGRIT-GSFEIQE-------ANAIAIVLRAGELPAKLQV
Q0ANE6_MARMM          -------IITAPTINEPILSGSGVIG-GSYTYET-------ANQLVILLNAGALPASLTP
Q2RTI1_RHORT          -------AVAVRLLRQPGSGGIGLLLDGAFSTRA-------AQDLALMLRVGALPTPFRI
SECD_ECOLI            -LVKQEEVINIANIQSRL-GNSFRITGINNPNE--------ARQLSLLLRAGALIAPIQI
C4K8M1_HAMD5          -LVKQEEVINAANISSRF-GGRFQITGIGTPSE--------ARQLALLLRAGALIAPIQI
SECD_HAEIN            -LEKHEEVINVATIQGRF-GSNFQITGVDSIAE--------AHNLSTLLKSGALIAPIQI
A1SWT8_PSYIN          -IEKREEVANVATIQAQL-GRSFRITGLDNAAE--------AHNLALLLRAGALIAPIQI
Q493H1_BLOPB          -LIKHEKVINIATIQSQL-SDNFRISGINNLNE--------ARHLSLLLRMGNLAAPIHI
Q7VQA9_BLOFL          -IYRRDKVINVATIQSQL-NHNFCITGMNNLNE--------VRRLSSLLRMGSLVTPIYV
B8GTQ2_THISH          RTTRTEEVINVARIQDQL-GRRFQITGLESTRE--------ARNLALLLRAGALAAPMTI
Q31FZ7_HYDCU          KRITTKDVINAAVIRGQF-ANRFQITGLDSPQE--------AQDLALLLRAGALAAPMEI
D0KW97_HALNC          DKKVIQQVINVATIQDQL-ANRFQITGLDSPEE--------ARDLALLLRAGALRAPMDI
Q60B03_METCA          TKKKVEEVINIATIRDRF-SKRFQITGLDSTEE--------ARNLALLLRAGALAAPVDI
A1WXP8_HALHL          VIRELEEVISVARIREGL-GSRFRITGLDSSQE--------ASNLALLLRAGALAAPIDI
D3RSH9_ALLVD          TTRKVEEVISVATIREPF-GRRFQTTGLDSSNE--------AHDTALLLRSGALAAPIEI
D0U555_9BACT          KRSKTQDIINAATIQGTF-SNRFQITGLDSSRE--------ATNLALLLRAGSLSAPVEI
Q5ZU07_LEGPH          VTKKEERVISAPVIQNAL-GSNFQITGLTDSKE--------ASNLALLLRAGALPAAIYP
A9KE82_COXBN          QHRQIERIINIATIQTAL-GNDFQITNLSTMDY--------AKNLALLLRSGAYPVPVDF
A0A0E1PNG4_ACIBA      TPYTESVVINAATVQAVL-GSTFRITGLSSPQE--------ASELALMLRAGALAAPMYF
Q0VS97_ALCBS          TSSTDKYVINVATIQSTL-GSRFRITGLDNPAE--------ASELALLLRAGSLAAPVSI
A4GHV3_9BACT          ESYEVKEIISLATIRAAL-GTTFRITGLDSPSE--------SSELALLLRAGALAAPMTF
A4GK28_9BACT          KNFYDKRIISLATIQSAL-ANQFRITGLDSPAE--------ASELALLLRAGALAAPMNF
Q1QTM7_CHRSD          EAYTERGIISLATIQSTL-GNRFRITGLESASE--------AGDLALLLRSGSLAAPIYF
A1TZN9_MARHV          NRVVEKGIISLATVQSAL-GSSFRITGLDSIPE--------AAELALLLRAGALAAPMYF
C3K1N2_PSEFS          TFKEEKKIISLATIQSPL-GAQFRITGLNGQGE--------SSELALLLRAGGLAAPMYF
B8KXG6_9GAMM          IPYDEKKLLTAPVIQSAL-GAQFQITGLDSTAE--------ASELALMLRAGALAAPITF
Q21KW0_SACD2          EQVPNPKMVSLANINEAL-SKRFQITGLDSPEE--------ASELALYIRAGALAAPMSF
B3PDJ8_CELJU          IQYVEKKVISLATIQSAL-GVQFRITGLDKPGE--------ASELALLLRAGALAAPMHF
C7RB47_KANKD          --SVVETLVSAPRINGAF-GTDFFIEGPDFTPAN-------TKDLATQLRSGALIAPTFI
B2FN02_STRMK          --KVNEEVISVANINGVF-GKNFQTTG--LQKKE-------ADDLAKLLKSGSLAAPMDF
A5EWX7_DICNV          DVEKRETVANSATIQGQF-SSNFQITGVTPFER--------AQKLAATLRAGSLIAPVYI
Q145I2_PARXL          ----KGEVLTVATIQSEL-GDRFQITGQATPQG--------AADLALLLRAGSLAAPMDI
D8INT3_HERSS          ----KGEVLTVATIRSEL-GSRFQITGMGSPEA--------ASDLALLLRAGSLAAPMDI
E6UXK2_VARPE          ----KGEVLTAPSINGEL-GNRFQVSGAMTVSE--------ANDLALLLRAGSLAAPMEI
D6CKE5_THIA3          ----RGEIITAPVIRSEIAGGRVQISGHMTVQE--------ANDTALLLRAGALAAPMNI
E8UEP8_TAYEM          ----KGQVVTSPTIRSEIPNGQVMISGHMTSTE--------AADIALLLRAGSLAAPMSI
E0XSS7_9PROT          ----KSEVITAPVIRSEIPGGRVQISGQMSTVE--------AADTALLLRAGSLAAPMEI
D7N3K1_9NEIS          ----KSEVVTAPVIRSAITGGRVQISGSMTTAE--------ANDTSLLLRAGSLAAPMEI
D7DM25_METV0          ----STEVITAPTINEEIGGGRVQISGMANTQE--------ATDIALLLRAGALAAPMDI
Q0AG53_NITEC          ----LTEVVTAPVIREEIGGGRVQISGKMSSIE--------ARDVALLLRAGALAAPMEI
B6BWI8_9PROT          ----ITEIITAPVIKSEIGGGRVQITGMKNAQE--------ATDVSLLLRAGSLAAPMEI
B7J4R7_ACIF2          ----DNKVVTAPVIREAITEGRAQITGFSGLKD--------ASNAAIELRAGALPAPVHI
Q0HXS6_SHESR          KAKQTQEIISVATIQSQL-GDRFRITGAGTYQE--------AQQLALLLRAGSMTAPVTI
E1SV05_FERBD          RSVVDTEVISVATIQSQL-GSRFVITGSGSMAE--------AQQLALLLRAGSLTAPVVI
B7VQL0_VIBTL          QSIEQSEVISVATIQSTL-GNRFRITGAGSMAD--------AQNLALLLRAGSLTAPVTI
Q7MD23_VIBVY          DIARSERVISVATIQSQL-GSQFRITGAGSMDE--------AQQLALLLRAGSLTAPVSI
A1S8J5_SHEAM          TVK-DSRVISVATINSQL-GNRFSITGLGSHEE--------AQELAMLLRAGSMTAPVTI
A4SLM7_AERS4          KLRAQSEVINVATIQTAL-GNQFRITGLASVPE--------AQELAMLLRAGALTAPLKI
Q15N36_PSEA6          EMVKSSKVISVATIQSQL-GNRFSITNLDSPQA--------ASDLALLLRAGSLDAPITI
Q3IL52_PSEHT          EVVKKSEVINVANIAQHL-SSRFSITNMQSPQA--------AADLALLLRAGSLSAPVTI
A8EY98_RICCK          --------LSAPMINGAIMGGSGIITGNFTVES--------AHELALLLRAGSLPAPLNI
B3CTC4_ORITI          --------LSAPVISEPILGGAGMISGNFTIES--------AKELSLLLKSGALPAALSV
B9KH60_ANAMF          --------LTAPTIREPILGGNGEISGRFSMSE--------AKELAVLLKSGSLPAPLRI
A0A0H3M0Z2_EHRRW      --------LTAPVIRDPILTGSGEISGNFTVES--------AKELSILLKSGALPAPLKV
B3CPT1_WOLPP          --------LTVPTIREPILNGEGEISGNFTEKQ--------ASELAILLKSGALPAPLKI
Q2GDE0_NEOSM          --------LTAPVIRDPIINGRGEISGNFDVKE--------AKELALLLKSGSLPAELTV
D0RNY3_9PROT          --------VSAPTIRDAITAGSGQISGGFSVEE--------ANNLAIVLRSGALPAPMSI
Q4FM00_PELUB          --------VSAPVIRDTIASGNGQISGNFTFQS--------ATDLALLLRSGALPAPLNI
Q7VFM8_HELHP          --------YSAPVIRERIGGGSGQISGGFSVAE--------ASDLAIALKSGALPAPMEV
C5ZWZ2_9HELI          --------YSAPVIRERIGGGSGQISGGFSVQE--------ASDIAIALRSGALPAPITL
E7A9U3_HELFC          --------YSAPYIRERIGGGSGQISGSFSVEQ--------ASDLAITLRSGVLSAPISV
A0RNX0_CAMFF          --------YSAPVINERIGGGSGQISGGFSVEE--------AHDVAIALRSGALLAPVNM
C3XE91_9HELI          --------ISAPSINQRIGGGNGIITGSFDRKA--------ASDLAIALRSGALLAPVSV
SECD_AQUAE            --------VSAPVIRSKI-SDRGQITGN-FTAQE-------ARDLALILRTGSLPSPLKF
D3DH34_HYDTT          --------MSAPVIRSRI-TDRGQITGQ-FTPEE-------AKELAIVLRAGALPTNVKF
B4U9J1_HYDS0          --------MSAPVIRSRI-SDQGQITGN-FTPDQ-------VRDLAAILRAGALPTTLHI
C1DVG5_SULAA          --------MSAPVIRSRI-TSSGQITGR-FSTEE-------ANDLAVILRAGALPAPVSI
E8T6K3_THEA1          --------QSAPVIRSEI-GARGQISGQ-FTYQE-------ARDLAIVLRAGALPAPVKI
SECD_KORVE            --------MEVANIKSEI-SDSGEIEGR-FTDQQ-------ASDLALILNSGALPASIKY
E8X5K0_GRATM          --------REVASINGAI-RDQGEITGT-FTQAE-------VDNLSLMLRTGALPASISY
C1F9I4_ACIC5          --------QEVATINDTI-RDQGTISGGGISMQE-------AKDLSLMLRTGALPASIKY
Q029K4_SOLUE          --------VSVATIQSKI-EDSGRITGL-GSEEE-------AVDLSRYLRSGSLPAGVVY
SECD_PETMO            --------IIAPVVRERISQGRAEISGIESME--------EAQNIAVLIKSGNLPVDLVK
C5CF36_KOSOT          --------IIAPIVSSTISDGKAVIEGLQTID--------EAREIAILVSSGNLPVELKP
A6LP86_THEM4          --------QFAGFVTAKITDGSALIKGNFTLD--------EAKQLAAILKSGALPARLEK
A0A1Q6S007_9FIRM      --------LSAPKVEAEITDGNAVISGDFTAK--------EAQDLASKINAGALPFQLET
D3R265_MAGIU          --------LSNPRVNSVISEGRAMISPMESPK--------AAVDLAGKINAGSLPFDIEA
B8I6M6_RUMCH          --------ISAPNVQTQISGNSARITLGGTASNEQR---DEAKNLAGLIKSGSLPFKLEA
B0SPU4_LEPBP          --------ISNPVINDPIAGGRAEISGSFSEQ--------EAIRLANVISEGALPIPLSV
SECD_TREPA            --------RSAPAIREPITAGSGSISGFSA---------EEAQNLKTALRSAWLNVALEI
Q73PW4_TREDE          --------KSAPNLKEPITGGSGSISGMSA---------TEANNLKTVLRTAWLNVPLQL
E1R5K7_SEDSS          --------KSMAVINEPIRERV-QMSGFDR---------KEANDLALVLRTAAMPVDLKI
E0RQA9_SPITD          --------KAYATIQEPIRGNV-QITGFST---------EEAQNISLILRTAALPVDLVI
D5UAD5_BRAM5          --------ISAPNINDEIRGGRGVITGRFTL--------EEAQDLARILKEGALPLNVSI
SECD_LEPBD            --------QSAPTINSEINGGSGIITGRFSMEE--------ANNLANLLKSGALPVEIKI
SECD_SEBTE            --------QSAPVIQSEIPGGKGSISGSFTYES--------AQNLANLLKAGALPVNIQI
A5TW61_FUSNP          --------QTAPKINSEIPSGNGVITGNYTVEE--------AKGTAALLNAGALPIKAEI
SECD_GEMAT            --------VTAPTLNSAIGRNGQITLGGGTLQS--------AQDLALVLRAGALPVPLKV
B2A263_NATTJ          --------VSAPEIRDVIHDQG-MIDGMGSVEE--------AQNVALMLRSGALPVSLTE
SECD_ACIFV            --------LTAPRVSEPITGGNAQITG-SKDAKE-------AEHLAILLRSGSLPVKLEV
D1BLM4_VEIPT          --------LTNPVVQQAITGGKATISG-SQSLEE-------AKDLAILLRSGALPVKINV
B8CXF7_HALOH          --------LNNPRVSNVIRG-EGQITG-YKTIEE-------AQKDAILIREGSLPVPVKV
D9QVJ1_ACEAZ          --------LTNPQVQDPIPGGEGIITG-YETLEE-------AQEDALLLRAGALPMPVKV
D5XEJ6_THEPJ          --------LQNPVVREPIPNGRAQING-YNTLEE-------AAKMAVLLRSGALPVNMEK
Q2RHU6_MOOTA          --------LTNPQVKEAIPNGQAIISGGFANFEE-------AANLAALLRGGALPVPVQI
Q3ABZ0_CARHZ          --------LQNPVIKEPITNGKARITG-YKDLEE-------AHRIAVLLRSGALPLKLEI
B0TF81_HELMI          --------LQNPTVSEAITGGQARITG-YGSLED-------ARRIAMLLNSGALPVKMEM
C9R7V3_AMMDK          --------IQNPVVKSVIPDGKAQITG-YRSLEE-------AHRVAVLLQSGALPVKLEI
B1I4K5_DESAP          --------LQNPEIKQPIPDGKAVITG-YESLQE-------ANRVAVLLRSGALPVKLDI
C8W4E1_DESAS          --------IQNPSIETPIQNGQARITG-YATLQD-------AHNIAILLRSGALPVKMDV
A4J544_DESRM          --------LQTPVVNEPITGGKARITG-YANLEE-------AHTIAVLLKSGALPLKTEV
Q0AX22_SYNWW          --------ISAPTVSGPITDGSARITG-NFTAKE-------AENLAVLLRSGALPVSFKI
Q892A4_CLOTE          --------LTNPVVNSVIPDGKGIIEG-SKSLEE-------AKRQADIIKSGALPVVVKP
D9SMV2_CLOC7          --------LIEPTVNVAITDGRATITG-SESYEE-------ATTRANIIKSGALPVALSV
Q67LL8_SYMTH          --------ISAPMVQEPIPGGEATITG-NFTVEE-------AGTLANLINGGALPVKLVE
D9TNU7_THETC          --------ISAPVVKEQITGGEAVING-MKDFTE-------AKNLANLIRGGALPVTLKQ
A4XIR1_CALS8          --------ISNPTVEEEITNGEAIIRG-MKDLEE-------AKTLAQQIKAGALPFALNV
E3GFZ5_9FIRM          --------ISSPKVNVAITNGEAVIEG-MADMEE-------AGNLAELIRGGALPVKLSP
D9RXQ2_THEOJ          --------ISAPVVMAVITNGEAVIEG-ISSIDE-------AAQLAALIRGGALPIDLEQ
E3PRC6_ACESD          --------ISSPRVNEEIPNGQAQVTG-NFTIES-------ASELAGLIRAGALPVDFEE
A6TQN4_ALKMQ          --------ISSPVVNDRIPDGQATISG-NFTPES-------ASNLATLIRAGALPVDLTE
D4M8M0_9BACT          --------ISAPVVQDRISGGEAQITG-RFTAEE-------ASRLAIMLKAGALPVAVEI
E6SLR2_THEM7          --------ISSPKVNDVITNGRAEITG-IPTFEE-------AQRLAVALRYGALPVDLQV
SECD_DICTD            --------ISNPVIKEPITEGTGVITG-RFTIDE-------AQKLAILLRAGALPVPVKV
SECD_DEHMV            --------LSG-DNGIPIAPVINNVIETSG-VIEGL-SYNEAEMLSNQLNAGRLPVPLEP
B3T9T5_9ZZZZ          --------VLD-EITLVSATVRSPILAGSGQISGGF-TPEEVRDLAIQIESGRLPIPISV
SECD_THET1            --------ISSPQIRDPITNG-------RGVITGV--TREEARTLAIQIRSGSLSVPLDI
B9KYU6_THERP          --------INTATIRDAIRD--------RGIIQGL--TAQEVRDLALQLKSGALAVPLEV
A9B5U9_HERA2          --------ISSPQINGSLPGEGIITMGSTGTTVAE--QNSQAQALQNQLKYGALPVTLIE
A7NP80_ROSCS          --------FSCPIVEAALVG-------GRGEITTS--TRQDAEQIYTQLKYGALPVPLQV
SECD_ANATU            --------ISAPRVQGRIPSG-------QGQITGNF-TLETANNLAIQMRYGALPIPFKV
SECD_PROMA            --------ISEASVGEQFKVAG--ITGGSATISGNF-TAESARELEVQLRGGSLPLPVSI
B5IKE7_9CYAN          --------ISEASVGPEFQAAG--ITGGSASITGNF-SAEEARDLEVQLRGGSLPLPVRV
B4WJX6_SYNS7          --------ISAPRVDVQYAQTG--IAGGRATISGNF-DVEAARDLEIQLRGGSLPLPVEI
D3EPH0_ATETH          --------ISAPVVSPQFAVTG--ITGGSAVITGNF-TAESANEMAVQLRGGSLPFPVEV
SECD_ACAM1            --------ISQATVSDRFKANG--ITGGAAIITGNF-ELEDAKLLANQLKGGSLPVPVKV
Q2JY13_SYNJA          --------ISAPIVGPEFARTG--ITGGTAVITGNF-TVETATDLAVKLKAGALPVPIRV
Q7NDR6_GLOVI          --------ISTPTVGVEFVDRG--ITGGKAVITGNF-SAQEASELGIKLKAGALPVPVEI
Q1AWD0_RUBXD          --------VSAPVVDEPIPGGQVVIQNTSSPTGLPE---QEARELEIVLQTGALPVNMRV
A0QWJ2_MYCS2          ------------IREAIPGGN-TQITG----QFTADS----AKELANVLKYGSLPLSFES
A0A0H3MPV3_MYCLB      ------------INEAILGGR-TQISGG-DPPFTAAT----ARQLANVLKYGSLPLSFEP
C0ZZ50_RHOE4          ------------IQGATPAGSATSITG----SFTAES----AKELANTLKYGSLPLSFAA
D0LCM8_GORB4          ------------INQAIPGGS-TRISGGSADPFTEAS----AGDLANVLKYGSLPLSFDA
D5UNI7_TSUPD          ------------INEPITGGQ-TQISG----SFNQQS----AADLANVLKYGSLPLSFKA
D9UX19_9ACTN          ------------VQNAILGGN-TQITG----KFTQTD----AKNLADILKYGSLPLSFDS
C7MQZ9_SACVD          ------------INEAIAGGD-TRISG----QFTQSE----AQNLADVLKYGSLPLSFES
A4FBB0_SACEN          ------------IQAPLLGGN-ANITG----QFNQQS----ATDLANILKYGSLPLAFDQ
C6WCM7_ACTMD          ------------INEPILGGS-TQISG----QFGQRE----ADNLANVLKYGSLPLSFEA
C8XE16_NAKMY          ------------IDGAITTPG-TEISG----SFSQAS----AASLANSLKFGALPLAFDR
D2S9I0_GEOOG          ------------IQGAITSNP-TTITG----SFDQES----AEELANQLRYGALPLTFTQ
Q4JVE1_CORJK          ------------IQSPTPPGEVSQITG----SFSEKE----AQDLANNLRYGALPLSFVG
C4LIX5_CORK4          ------------IQSPTPAGSTTQITG----KFSEAE----AKDLANNLKYGALPISFAG
Q8NPZ9_CORGL          ------------IQSATPVGSATSITG----DFTQTE----AQDLANNLRYGALPLSFAG
D7BNQ2_ARCHD          ------------KTDNPITGGQAQITGS----FKAKE----AANLANQLNFGSLPLFFE-
D6ZHF4_MOBCV          ------------GVNAPAFGGSASISGS----LTRES----SATLANQLQFGSLPLNFE-
B2GIL6_KOCRD          ------------SMNSVITDGKAQITG----NFTEDE----AKFLSQQLKYGALPVSFS-
A9WSE2_RENSM          ------------SSQAVITDGKSQITG----NFTETS----AKSLSDKLKFGALPISFD-
E1VWF6_GLUAR          ------------TTNAVISDGRPQISG----GFTQES----SQALAEQLKYGALPISFD-
C5CCH9_MICLC          ------------QSNVVITNGSAQISGP---TLNEQT----TKQLAEQLNYGSLPISFS-
B0REC2_CLAMS          ------------VTQGVVTNGKPSITG----NFTQES----AKALADQLKFGALPLSFT-
E8NFI9_MICTS          ------------SMNGIILDGRPSITG----SFTQES----SKALADQLKYGALPLSFN-
D5UEN5_CELFN          ------------SVNEVIPNGQAQISGS----FTRET----AATLANQLNFGSLPISFE-
D1BGW2_SANKS          ------------GVTATIPDGRAEITGS----YTRET----ATALANQLNFGALPLTFE-
C5C5R0_BEUC1          ------------GVDEPIPNGEATISGPETNPFTRSQ----AQTLANQLNFGSLPITFD-
C7R4G5_JONDD          ------------GVTEVFRTGEAFIEGT----FTNES----ANKLANQLSFGALPLTFE-
D1BSK1_XYLCX          ------------GINTPIRDGRAQISGS----FTRES----AATLANQLSFGALPIQFE-
Q83MZ7_TROWT          ------------EVRGVTSN--PQITGN----FNQTT----ATALASQLSFGSLPVSFE-
A6WCH6_KINRD          ------------SVDQRFGADVDIEGD-----FTRES----AEALAQQLQFGALPVSFT-
E6SB77_INTC7          ------------QAKAVISDGRASITGS----FTIDS----AQRLAEQLKFGALPMSFA-
C7NI44_KYTSD          ------------GMRQTITNGEASITGN----FTAEE----GKALADQLKFGALPFSFN-
C7MCC2_BRAFD          ------------EVQGATTNGEAQISGN----FSQEE----ASQLSDQLRFGALPLEFE-
D6Y2C4_THEBD          ------------AIKEAIPGGTARIFG----DLTQRS----ATELAEQLKYGALPLTFR-
D2AWR2_STRRD          ------------VIQEPITGGRAQISG----SFTQVT----ADELAGQLKFGALPLKFK-
D1AEV4_THECD          ------------QINEPITGGTASIDGPAE-TFTQTY----AIDLANKLKYGALPLKFE-
A0LUK3_ACIC1          ------------YIAEAIPNGKTQISG----NFTHKT----ASELANVLKYGALPLRFE-
A8KZE4_FRASN          ------------QTNERIA-GSAQISG----SFSQSD----AEDLANVLRFGALPLAFE-
Q2JD92_FRACC          ------------QTNERIP-GSAQISG----GFSQSD----AEDLANVLRYGALPLAFE-
E2PV76_STRC2          ------------QVNQTLTA-NAEISG----SFNQKS----AQELGNMLSYGALPLTFQ-
E4N7T8_KITSK          ------------YVQESITGGNAVING----TFTSDE----AKSLANVLSYGALPLDFV-
C7QJQ1_CATAD          ------------TVQQPITDGNAQITG----NFTQKT----AQNLADVLKYGALPITFN-
D7GDS9_PROFC          ------------SVSTAISGGNAEINGA---NINETS----AKELANQLKFGALPVSFD-
Q6A8K5_CUTAK          --------NGNTGTSCPINGGEAQISG----HFTQNS----AADLANVLKYGALPLSFD-
D2PVF3_KRIFD          ------------SVENPIPGGQAQISG----SFSESE----ARDLANVLKYGALPVSFD-
A1SJA9_NOCSJ          ------------VFTGVIPNGDAQITG----NFTKSS----AQSLATSLKYGALPIAFDK
C4RGU0_MICS3          ------------IQGVLTGDS--QITGS----FDNKT----ASALASQLRYGALPVTFEA
A4X5X5_SALTO          ------------ILGVLTSNS--QITGN----FTQQD----ASDLASTLRYGALPVTFEP
D3PYP7_STANL          ------------IEQGAGSGGSVEITGG----FSSDD----ANLLAEQLKYGSLPASFTV
E1QZN3_OLSUV          ------------AVQSEITGGQVSITGG----FTLEQ----AKSLKTVLDSGSLPVTLTY
C7LYS6_ACIFD          --------ISAPQITSTSFNGQGQITGNFTEAQ--------ANNLALVLRYGALPVQLVQ
                                                                      :  .        

B1YJQ7_EXIS2          ------IYSTSVSAAFGQDALDQTLFASMIGVAAVFLFMLLFYR-VSGFVSIITLLFYIY
D6XWY8_BACIE          ------VYSNSVGASLGERAMDLAIFAGYIGVALIFGYMLLYYR-FMGIIAVLTLSLYTY
E3E8W8_PAEPS          ------KYSQSVGATLGQLSLDQTIRAGLIGSVIILIFMIAMFR-VPGLIASFCLIVHTW
C0ZAP6_BREBN          ------KQVTSVGASLGTLALEKTMYAGYIGAALIFIFMLVVYR-MPGMIANITLAGFTY
SECD_ALIAD            ------ESETSVGPTLGATSLHRTLIAGVIAVVLIFAFMIAAYR-MAGLIADIALVAYGY
SECD_ANADE            ------TEERTVGATLGPELVRKGTLAALVGLALVVVFMVVYYR-GTGLVADVALALNGL
Q08P79_STIAD          ------GEIRQVGASMGDELIRKGSLAAIVGLALVVAFMALYYK-GAGLIADAALLLNGL
A9F8D1_SORC5          ------SNEQRIGPSLGKDAIQQSMKGAIASGLLVVVFMVVIYS-RAGLIADIAVIFNLI
Q6MKZ2_BDEBA          ------LEERRVGPTLGADAIGKAKLGSYVGAAIIIIFMIAYYK-SMGVVASVALGLNIL
E1X0T6_HALMS          ------LEQRTVGPSLGHDSIDKARFASMVACILVFGFILVYYR-VSGAIAIVTLALNVI
D0LJ86_HALO1          ------DSSSVIGPLLGADAIEKAQFAFALGALLVLIIMVFIYR-VSGWLSMVALVLNIG
SECD_SYNFM            ------LEQRTVGPSLGADSINKGVLASIVGGIGTILFMLIYYR-FGGVVADLALALNVL
Q2LVH4_SYNAS          ------LEERTVGPSLGQDSIEMGIWACVIAGILVVLFMVFYYR-LSGMVADVALVLNLV
E1YHR5_9DELT          ------IEERTVGPSLGTDSINKGLLSMWIGGLLIFVFMAFYYK-WSGVVADIGLVFNVL
E1QIL8_DESB2          ------LEERTVGPSLGQDSINQGFLSMIVGFGVVVLFILIYYK-ASGIIANMALLANLV
B8F9E3_DESAL          ------LEERTVGASLGKDSIKTSTNAMLIGFVLVVVFMAVYYM-GAGLIANIALILNVV
SECD_THEYD            ------IQNVTVGPTLGKDSIEAGKMAVIIASIFVSLFMIIYYR-LSGVIADFALILNII
D8PI89_9BACT          ------IQDLTVGPSLGQDSIEKGVKATLFAGLLVIVFMALYYR-LSGVIANFALLLNLI
B6ANM3_9BACT          ------LQNVTVGPSLGKDSIRAGIRATIFAGILVLLFMAVYYR-LSGMIADGALVLNLI
B5ECA4_GEOBB          ------VQNVTVGPSIGEDSISKGLMAGGIGILLVVLFMVFYYR-MAGLVANFGMVLNVL
Q3A3C4_PELCD          ------LENRTVGPSLGLDSIHRGIWSVIIGCVAVVLAMGIYYN-LAGLVANLALVLNLV
D5MHP3_9BACT          ------ISNLTVGPSLGLDSIQKGVQAAILGGALVIAFMAIYYK-LSGVIANLALVLNLI
SECD_CALNY            ------LENRTIGPSLGQDSIKKGIWAGIIGVAAVIIFMLIYYK-FSGFIASIALLSNAI
SECD_DESIS            ------VENRTVGPTLGQDSIDKGILSVTIGMALVLLFMVAYYR-LSGLLANMALLMNLI
C4XSM5_DESMR          ------LEQRTVGPSLGQESIEKGVHSAVIGGLIVIAFMIVYYG-VAGAVADAALLFNLM
C7LN34_DESBD          ------LEERSVGPSLGQESIDKGMMAALIGGLMVVVFMSIYYR-RAGLIAAFEIILDVF
Q1MSC1_LAWIP          ------LEERSVGPSLGEESIEKGMLAAIVGGFAVLIIMPLYYG-LSGLLADVMLLFTMT
SECD_MAGMM            ------LEERTVGPTLGADSVAQGLNSVLIGGVLVVLFMVLYYK-GFGMLANLAVVLNVT
SECD_RHOM4            ------IEERTVGPSLGEASIRAGLRSVLTGLLLVALFMIFYYR-TGGMIADLALVLNII
D5HAA4_SALRM          ------ISERTVGPSLGEESTRAGFISVVAGFLLVVLFMIMYYR-TAGVVADIALLLNLI
B3EJI9_CHLPB          ------IEERTVGPTLGADYIRSGLLSAAWGLFLVAVFMVFYYR-KAGFSTDIALVLNIL
Q3ANT9_CHLCH          ------TEERSVGPSLGADYIRAGMLSLVWAFVAVSFFMLVYYR-QAGIAANIALILNIL
B3QTH7_CHLT3          ------IEERTVGPSLGADSIRAGIQAIIWGFAVVAIFMVIYYR-GAGFIADFALIFNVI
B0VHR7_CLOAI          ------VSTSIIGATLGADSIRKGTMAGLIGLIIVVLFMIIYYK-LCGFIADIALVLNVG
SECD_ELUMP            ------IEKRTIGPSLGEDSIKSGVRASLYGIVIILILMAIYYK-SGGIISNIALILNLV
SECD_UNCTG            ------IEERTVGPSLGDDSIKKGFMSSLIGIVLVFLFMFIYYR-SSGLIADVALSLNLI
SECD_ACEP3            ------VEQRSIGPSLGADSIRAGILSLGVGFLLVVVFMVLFYG-RFGWYADIALLANLV
Q0BS58_GRABC          ------VEERSVGPELGADSIRAGAYSLAAGFVLVILFMGLFYG-LFGWMANLALLMNLF
D3NUL2_AZOS1          ------IEERTVGPDLGADSIRAGLTAVVVGFVMVCIYMIASYG-LFGAFACSALFVNLV
D8JWH1_HYPDA          ------VEERTVGPSLGADSISAGKLAGVVGGIAVVILTILYYG-TFGIFACVGLLVHLI
E3I016_RHOVT          ------IEERSVGPSLGADSIDAGSIAAAVGFAAVSLFMISAYG-LFGVFSVIALAVNIA
E2CQN1_9RHOB          ------IEERSIGPGLGQDSIEAGEYASIIAGVAVIAFMLLAYG-RFGVIADLALMANIF
A7HXL0_PARL1          ------LEERTVGPGLGADSIRAGEIAAVIGSVAVVVFMIASYG-FFGLLANIALFLNVA
B0UI92_METS4          ------IERRTVGPGLGRDSIEAGKLATIAATVLVVTMMFACYG-VFGLFANIALMVHVG
A7IND6_XANP2          ------VEERTVGPSLGADSIHAGKVAAYVATALVAVFMIAVYG-LFGLFALVALAVHIM
A4U1K0_9PROT          ------LEERTVGPDLGADSIQAGAVASGVGLLLVVVFMVVIYG-TLGALANVALVLNLV
D5BQT5_PUNMI          ------MEERSIGPGLGADSIEAGKIAAIVGLCLVIVYMFLSYG-TFGILADMALLVNVI
Q9A6U2_CAUVC          ------EQQNTVGAELGADAVRAGAISTLVAFITIVVFMILSYGLLFGGISVIALIINGM
D9QLN2_BRESC          ------EERRTVTAELGADAVQNGKISTIIGFIIIVAFMILAYGFLFGGISVIGLVLNGL
Q5NL89_ZYMMO          ------VEERTVGPGLGADSIRAGTLACSIAIVAIVIFMISVYG-RFGIYASSAVILNLF
Q1GSE5_SPHAL          ------VEERTVTPELGADSIRKGAIAGIIATVAVLAFMIIVYG-RFGIYANVALIFNIG
SECD_RHOCB            ------LEERTIGPELGADSVKAGMVASVIGFVAVVAYMIASYG-LFGFFSSVALFINIA
Q0C0W6_HYPNA          ------LDQRVVSSTLGEDSIESGYRAAIVGLALVAFFMILAYG-LQGIFAVFSLVANIV
C6XJ02_HIRBI          ------VEQRVVGAGLGEDSIRAGTTASAIGLALVAIFMILAYG-LWGVFAVISLAANIM
Q0ANE6_MARMM          ------VEQRVVTGTLGQDQVESGKLAIMIGFALVIVFMVAMYG-VFGLFSTMALLVNVV
Q2RTI1_RHORT          ------VEERTVGPSLGADRVAAGALASAAGALAVTVFLIAVYG-LFGVFATIALGLNFC
SECD_ECOLI            ------VEERTIGPTLGMQNIEQGLEACLAGLLVSILFMIIFYK-KFGLIATSALIANLI
C4K8M1_HAMD5          ------VEERTIGPTLGAQNISQGLDACLAGLAASILFMVVYYR-KFGMIASTALLVNLV
SECD_HAEIN            ------VEERTIGPSLGAQNVEQGINASLWGLVAVIAFMLFYYK-MFGVIASFALVINIV
A1SWT8_PSYIN          ------VQERTIGPSLGQENIDNGIKAMVYGMLAVVLFMFVYYR-KFGVIANTALLFNIV
Q493H1_BLOPB          ------EEERMIGPTLGKQNIVRGFIACSLGLLTSICFMILWYH-YFGLIASVALIANLI
Q7VQA9_BLOFL          ------DEEKIIGPTLGKKNIAQGIIACIVGMLISICFMIVWYR-YFGLIAGIALVTNFV
B8GTQ2_THISH          ------VEERTVGPSLGRDNIERGFNSVVIGFILVLIFMALYYR-VFGLVANVALALNLV
Q31FZ7_HYDCU          ------VEERTVGPSLGQDNINQGMMSVIVGFLLVLVIMVWRYK-TLGMIANMALTLNLI
D0KW97_HALNC          ------VEERTVGPSLGAQNIQSGVNASILGFALVAVFMLIYYR-VFGVTAIVALGVNLI
Q60B03_METCA          ------VEERTVGPSMGKENIDRGVKSNGYGFIAIAVFMILYYR-MFGLFSILALAANVL
A1WXP8_HALHL          ------VEERTIGPSLGAENVERGFMAVVIGFLLVIAFMALYYR-TFGLVANLALLSNLV
D3RSH9_ALLVD          ------VEERTIGPSLGQDNIDQGLESVMLGLGLVLLFMAVYYR-VFGLVANLALVVNLV
D0U555_9BACT          ------IEERTIGPSLGADNIQKGLISVLVGFALVLVFMAWRYR-VFGLVANLALTINLV
Q5ZU07_LEGPH          ------VEERTVGPTLGKENIRRGLISLEVGMGLILVLMLVYYH-FFGLIADIALMLNLV
A9KE82_COXBN          ------VQERVVGPSLGQENIHMGVLSTEIGALLVIVFMAFYYR-LFGVIADIALALNIV
A0A0E1PNG4_ACIBA      ------VEERVVGPSLGQENIDKGVLSTQIGFLLVAIWMVVFFR-LFGLIANFALVFNLA
Q0VS97_ALCBS          ------VEERTVGPSLGAENIEAGLKSMALGLALVLAFMVLWYK-VFGLIANVALLGNLV
A4GHV3_9BACT          ------VEERTVGPSLGADNIQAGIFSMILGLLLVLVFILFYYR-VFGIAASLALTFNIV
A4GK28_9BACT          ------VEEGTIGPSLGADNIRLGINSLILGLSLVLVFMIFYYK-VFGFIANLAVLLNLI
Q1QTM7_CHRSD          ------AQERTIGPSLGAQNIAQGIMSVEVGLLLVVLFMLARYK-AFGVVANVSLGLNLV
A1TZN9_MARHV          ------VQERTIGPSLGQKNIDAGMMSVMLGFGLVLLYMLVFYR-GFGLVANVALTLNLM
C3K1N2_PSEFS          ------AEERTIGPSLGADNITKGVDAALWGMLFVSLFIIAIYR-FFGIIATVALAGNMV
B8KXG6_9GAMM          ------VEERTVGPSLGAENIRLGVKSVQMGLTLVVIFMLLYYR-VFGIAAVIGLSVNLV
Q21KW0_SACD2          ------VEERTIGASLGQENIDLGVKSVQLGLVLVLIFMMVFYK-VFGFFANLALAVNLM
B3PDJ8_CELJU          ------VEERTIGPSLGAQNIRNGVDATIWGMILVVIFMLIAYR-VFGVFANLALTMNVL
C7RB47_KANKD          ------VEERTIGASLGAENIEKGINSVIIGFSLVVLFMLLYYK-AFGVVANIALIFNVV
B2FN02_STRMK          ------VEERVVGPSLGAENVKNGMRAVVFAFLFTLVFFSVYYR-MFGVITSIAMLFNLL
A5EWX7_DICNV          ------IEERTIGPSAGQQNIDQGVHASLLGLFAIAVFMLVYYN-KLGFYSVIALTFNLI
Q145I2_PARXL          ------IEERTIGPSLGADNIRKGFHSVVWGFAAIAVFMIAYYM-LFGVISMIGLSVNLL
D8INT3_HERSS          ------IEERTIGPQLGADNIKKGFDSVLYGFLAMAIFMVIYYQ-LFGFFSALALSVNVL
E6UXK2_VARPE          ------IQERTIGPTQGAENIKKGFDSVMYGFAAIMVFMCLYYA-LFGIFSSIALAVNLM
D6CKE5_THIA3          ------IEERTVGPSLGQQNISQGFHSVTWGFVAIVIFMSIYYM-FFGVVSSIGLAVNLL
E8UEP8_TAYEM          ------IEERTIGPSLGEDNIKKGFRSTWVGFVLIALFMILYYR-LIGVFSTLGLAFNVL
E0XSS7_9PROT          ------IEERLIGPSLGADNVSQGFQSTLWGFVAITIFIIIYYM-IFGMFSALALSLNLT
D7N3K1_9NEIS          ------VEERTIGPSLGKENIQKGFDSTLWGFAVVAVFMVVYYR-MMGVFSTIALTANIL
D7DM25_METV0          ------VEERTVGPSMGQDNINRGIHSTLWGFAAIAVMMMIYYV-AFGAVSVTALAINLL
Q0AG53_NITEC          ------VEERTIGPSLGAENISKGFNSTLFGFLAVATFIMAYYS-AIGVISVVALAINLL
B6BWI8_9PROT          ------IEERTVGPSMGKENIQRGIQSTFWGFIAVIILISIYYM-LFGLFSSIALSINLV
B7J4R7_ACIF2          ------SEERTVGPTLGQDSIHDGVMAVVFGMAFVVLFMTLYYR-AFGLIADVAILVNIL
Q0HXS6_SHESR          ------VEERTIGPTLGAENIQNGFAALGLGMGITLLFMALWYR-RLGWVANVALIANMV
E1SV05_FERBD          ------VEERTIGPTLGAENIENGFQALAVGMGATLLFMALWYR-RLGWVANVALVANLV
B7VQL0_VIBTL          ------VEERTIGPTLGAENVKNGFAALALGLGFTLVFIACWYR-RLGWVANAALTINLV
Q7MD23_VIBVY          ------VEERTIGASLGAENIQNGFAALALGMGLTLTFMALWYR-RLGWVANVALVANML
A1S8J5_SHEAM          ------QKERTIGPSLGAENIHNGFAALALGMGATLLFMALWYR-RLGWVANVALLANLV
A4SLM7_AERS4          ------LEERSIGPTLGLQNIEAGFTALAFGMAGMMLFMMAWYR-KFGWVAITALIANLL
Q15N36_PSEA6          ------VQQRTIQASLGQENVGNGIMALAIGLGFTLVFMGLWYR-KLGLIANTSLILNLV
Q3IL52_PSEHT          ------VHEQTIGPSLGSENISNGLAALMLGMGITLAFMAMWYR-RLGLIANVALILNLT
A8EY98_RICCK          ------IEERSIGPNLGADSIESGKKAGLIGFIAVCIFMIWSYG-VLGLFANIALSLALL
B3CTC4_ORITI          ------IEEKTIGPTLGSDSIQAGKLAGYIGFILVCIFMLCIYG-ILGLFANIALFFSLI
B9KH60_ANAMF          ------IEEKVIGPSLGAGSIAMGKVAMLASVVGVSAFVTASYG-ILGVFAVVGLIFNIV
A0A0H3M0Z2_EHRRW      ------IEEKTIGSSLGAEYIKQGRLAMIVSVVAVSTFIIFFYG-IFGLLAVIGLVFNII
B3CPT1_WOLPP          ------IEEKNIGPSLGEESIKAGEIAAIISIIAVGLSIIITYG-KLGLLASVALVFNVI
Q2GDE0_NEOSM          ------IEQRAIGPSLGAEAILLGKRASLLAMLLVVTFMLFGYG-WYGVAATIALIVNLT
D0RNY3_9PROT          ------IEERTVGPDLGQESIDKGIMSLIIGFVLVIIYILINYR-ILGIFANISLLVNLI
Q4FM00_PELUB          ------IEERTVGPDLGQDSINAGVIALMIGFLLVIIFMFVKYR-IFGLIANITLLINLF
Q7VFM8_HELHP          ------LEKRSVGPSLGEDSIRASLIALISGFALVVIFMIIYYS-LAGVIAVVALFVNIV
C5ZWZ2_9HELI          ------LEKRSVGPSLGADSIKASMIALISGAVLVIIFMVFYYG-IAGIIANIAMVVNIL
E7A9U3_HELFC          ------LEKRIIGPSLGADSIRTSLIALAGAFVLVIAFMIFYYS-MAGVIASVALVVNLF
A0RNX0_CAMFF          ------LEKRSIGPSLGQQSIDQSMVALAGGAILVVLFMVLIYG-LAGVLANIALVVNIL
C3XE91_9HELI          ------IEKRVVGPSLGADSIQASVIALISGFILVVGFMIVYYA-MAGVFASLALVINLF
SECD_AQUAE            ------LQEKIVGPSLGKDAIEQGIKAGILAIILLAVVLIARYK-TAGITANISIFLNVL
D3DH34_HYDTT          ------LQETVVGPSLGRDAINQSIKAGIVGFILLVALLLGRYK-VAGITANLAILLNAL
B4U9J1_HYDS0          ------LQDAVVGPTLGKAAIKQSIYAGLASFLFVVFLIITRYK-TAGVTATIAIIMNGL
C1DVG5_SULAA          ------VEESVIGPTLGKESIDKTLMAGIVSFTLVGLFMIYRYA-LSGFVAVIALVFNLM
E8T6K3_THEA1          ------VEETTVGPSLGKESVEKGIKAGVAGIIVVMLFMLVYYK-TAGIAADAALLMNVI
SECD_KORVE            ------LEERTVGPSLGMDSIRQGVRAAIIGFVAVIIFMLIYYK-GAGINADLSLLLNLV
E8X5K0_GRATM          ------LETRTVGPSLGAASIRQGVIAAVVGMAAVMIFMLIYYK-GSGINADLALLLNLL
C1F9I4_ACIC5          ------LQESTIGPSLGMDSIHAGVMASIFGMSAVLIFMLIYYK-GAGINADLALILNLV
Q029K4_SOLUE          ------LQERSIGPSLGADSIHQGLMAGIAGLLAVIVVMLVYYK-RSGLNAVLALILNTV
SECD_PETMO            ------YQERTLGPTLGRDIVTTIINAGIIGLIIVMIYMIIFYR-WMGVIADIALIYNTF
C5CF36_KOSOT          ------FNKRVLSPTLGKDIITSALWAGLAGLVIIMIYMVLVYG-LMGLVADVALLYNSL
A6LP86_THEM4          ------VSSGWVAPLLGKDIIEASIKAGIVGVVIVLIYMIVFYG-VMGIVADIALLYNTF
A0A1Q6S007_9FIRM      ------SNYGTISATLGENSLVAMAYAGVIAFIIIAIIMILFYR-LPGFVAVISLLGQMG
D3R265_MAGIU          ------ISSSSISPSLGNNALSVMLRAGIVAFIILSIFLLLYYR-LPGFVAIIALLAQIV
B8I6M6_RUMCH          ------RQVNNISPTLGSNALKVSIEAFIVALILICLFMIFYYR-LPGLIASIALILHTV
B0SPU4_LEPBP          ------LEMRFIGPTLGIESIEVGVKAVAIGFFLVMVYMILYYR-LGGLIADLSLLVNII
SECD_TREPA            ------ENQQVVGASMGEESIRQGTRALVWGLCAVLLFMLVWYQ-EAGVNACVAQLLNLY
Q73PW4_TREDE          ------ETQQVVGASLGDEKINEGIKALQWGLIAVLVFMLVFYK-EAGINACIAQILNLY
E1R5K7_SEDSS          ------NNQQAVGASLGEDSVRQGLKAITLSFILVIIFMLLYYQ-VAGIVSDIALILNLV
E0RQA9_SPITD          ------EDYEAVGASLGEDSIRRGVQAIVLGFALVVLFMILYYK-GAGIVADIALLLNLF
D5UAD5_BRAM5          ------VEEEVVGQSIGADSVKAGATALLMAAILVAVFMIAVYR-LSGVLATIAMIVNVI
SECD_LEPBD            ------VENRTVGATLGVDSIKQTGIAGLIALGVISVFMIAIYK-IPGIVADIALLINGV
SECD_SEBTE            ------METRSVDASLGAESIKATKMAAMIALVLVSLFMLAVYR-VAGFVADLALCVFGI
A5TW61_FUSNP          ------AETRTVGATLGDESIAQSKNAGMVAIVLIWVFMIIFYR-LPGIIADLAIVLFGF
SECD_GEMAT            ------AEVRQIGASLGSDSISKGVMALGVALLLVLVIMVVYYR-FSGVLAVIALVLYLV
B2A263_NATTJ          ------LETRTLGPSLGEEFQEQSLQAGLLGLALLVIFMLGVYR-LPGLMANIALAVYLV
SECD_ACIFV            ------VENRTVGPTLGQDAKDASMKAFAIGLAGVFLFMLLYYR-LSGLVADIVLLLYTL
D1BLM4_VEIPT          ------LEVRTVGPSLGQDSKDKSVVAFSAGIAMIMIFLVILYR-FSGIVANIALLVYVM
B8CXF7_HALOH          ------IETRMVGPTLGKISKNRSIMAGLIGLALVAIYMIFYYR-FPGLLAAVALIIYGI
D9QVJ1_ACEAZ          ------IQNRTIGPTLGARSIDQSITAGLIGLALVALLMIILYR-LSGAVATVALGIYGV
D5XEJ6_THEPJ          ------VYTQTVGPTLGADSLAKSTKAGIVGIIAILIFMIAYYR-IPGLIANVALAAYAL
Q2RHU6_MOOTA          ------IERRTVGPTLGADSLAKSKTAIIVGLIAIALFMLLIYR-LPGVVADFSLIVYGL
Q3ABZ0_CARHZ          ------LEKKVVGPTLGADSLRRSVRASIIGVIAIFVFMILYYR-FPGFIADFALILYAT
B0TF81_HELMI          ------VEKRTVGPTLGAESLEKSKAAAMIGVGLIFAFMFLYYR-VPGFVAIVSLILYSV
C9R7V3_AMMDK          ------LEKRTVGPTLGADSLHKSLFAGAIGVAAILIFMLLYYR-VPGLIADFCLGIYAL
B1I4K5_DESAP          ------MEKRTVGPQLGADSLERSVTAGAIGFGAILLFMVLYYR-LPGLVSAVSLVVYAT
C8W4E1_DESAS          ------IEKRAVGPMLGADSLAKSKMAGIVGFAAILIFMIGYYR-LPGLIADIALVIYSL
A4J544_DESRM          ------IEKRTVGPSLGADSLSKSIKAAAVGLIAILIFMLGYYR-LPGMVANFALVVYGV
Q0AX22_SYNWW          ------LEKRTVGPTLGSDSLSKSVKAGIAGLIAILIFMLGYYR-LPGFIADISIVLYSI
Q892A4_CLOTE          ------VEVKTVGATLGSNALPLSIKAGGIGIGLVFLFMILFYR-VPGLIANIALVLYIV
D9SMV2_CLOC7          ------ISSKTVDSTLGASALPNSIQSGLIGVALVMLLMIFLYR-KSGVASSIALLLYIV
Q67LL8_SYMTH          ------VEARMVSATLGADSVAKSLRAGWIGIVGVLLFMILLYR-IPGLLADIALGVYAI
D9TNU7_THETC          ------VEYSSVGATLGPSALKASEEAGLYGLVIVLLFMIAFYR-LPGLIADIALGIYIL
A4XIR1_CALS8          ------VESRAIGPSLGNEALRTTLKAGIIGLLLVFLFMIIFYR-LPGFIADIALVAYVV
E3GFZ5_9FIRM          ------IEVTTIGPTLGQDSLNQSLIAGAIGIAAVLLFMLVMYR-GLGFIADLALIIYIM
D9RXQ2_THEOJ          ------REIRSVGPTLGADSLAKSLRAGIVGVFLVMAFMILYYR-IPGLIADIALMFYIM
E3PRC6_ACESD          ------VQSSTITATLGEEALDKSIYGASIGILLVMLFMIFYYR-LPGLVAAIALVAYVL
A6TQN4_ALKMQ          ------VQTTTITASLGENSLASSVRAAQIGITIVLLFMLAFYR-LSGLVADIALVVYIL
D4M8M0_9BACT          ------AENRSVGPSLGADSVRQGMQAGLFGAAMVLVFMLIYYR-FRGLAADVALVVTIL
E6SLR2_THEM7          ------VENRTVSATLGADSLQRSVEALIVGGAAVAAFMLVIYR-IPGFWAVTALAVYML
SECD_DICTD            ------IENRTIDPTLGKDTMESAYRAGVIGAILVVLFMILVFR-FLGLVADIALLIYVV
SECD_DEHMV            ------IYEQTVSPTLGQNFVDLAVKAGLVGIILVMIFMIAFYR-LPGLLASIALVFYGV
B3T9T5_9ZZZZ          ------LTEKVVDASLGSSSLRDSLIAGIVGLALVLFFMVSYYR-GSGIVAALALFIYTT
SECD_THET1            ------ISSNTVGATLGNDSVQRSIRAGLIGIGAVALFMILYYR-LPGFVSVVALAIYAA
B9KYU6_THERP          ------VQSRTVGPTLGQDSIRKSIVAGIVGLGLVALFMILYYR-LPGFISVIALLLYTA
A9B5U9_HERA2          ------DSNRSISATLGNDSIDASKIAGAIGLIAVMLFMLMYYR-LPGLLADIALIVYTI
A7NP80_ROSCS          ------ESSRTVSASLGQGSVDASIVAGVVGLATVALFMILFYR-LPGVLATVALLLYTL
SECD_ANATU            ------VESRVIGPTLGRDSLQKSLLAGYIGFTIVILFMGIYYR-LPGVMADLSLIVYAL
SECD_PROMA            ------VQVRTIGPTLGVDNIRRSLIAALLGLSLVAIFMVSFYR-LAGFIAIFALSFYAL
B5IKE7_9CYAN          ------VEVRTVGPSLGADNIRTSLVAALSGLALVAVFMVLVYR-LAGVVAVVALSLYAL
B4WJX6_SYNS7          ------VENRTVGATLGRDSVERSLYAALLGLALVLVFMAVYYR-LPGILADIALVVYAI
D3EPH0_ATETH          ------VENRTVGATLGQDSVRRSIYATATGLILVLIFMIVYYR-LSGVLANIALLIYAA
SECD_ACAM1            ------EEIRTVGATLGQDSIRQSVYAGIGGLILVLIFMGVWYR-LPGLIADVALCVYGL
Q2JY13_SYNJA          ------IENRTVGATLGEESVRRSLYAGIAGLVLVFVFMVAYYR-LPGLVADIALLIYAL
Q7NDR6_GLOVI          ------IENRTVSATLGADSVRQSLYTGIAGTLLVFIFMVAYYR-LPGLIADMALIIYGL
Q1AWD0_RUBXD          ------LSVETIGPTLGTESLRSGLIAALVGFGLVLLFLVAIYR-ALGVVAGLALLIYAF
A0QWJ2_MYCS2          ------SEAETVSATLGLSSLRAGLIAGAIGLAAVLLYSLLYYR-VLGLLVALSLVAAGA
A0A0H3MPV3_MYCLB      ------SEAQTVSATLGLTSLRAGLIAGAIGLSLVLLYSLLYYR-VLGLLTAFSLFCSGT
C0ZZ50_RHOE4          ------SEAETVSATLGLASLQAALIAGAVGLVLVLLYCLVYYR-MLGVLTALSLILSGV
D0LCM8_GORB4          ------SNAETVSATLGLSSLRAGLLAGAIGLLAVLIYALAYYR-MLGILTFASLVLAGL
D5UNI7_TSUPD          ------GTAQTVSATLGFDSLRAGVIAGLIGLVLVLIYALAYYR-ALGVLVALSLVLSIA
D9UX19_9ACTN          ------SDATTVSATLGYASLQAGLIAGAIGLAVVFVYCLFYYR-LLGILTIWSLVLSGL
C7MQZ9_SACVD          ------SDATTVSATLGMATLKAGLIAGAIGLALVFVYCLLYYR-ILGVLTVLSLALSAL
A4FBB0_SACEN          ------SEAETVSATLGVASLEAGLLAGGLGLLLVAVYCLAYYR-LLGLLTILSLVLSGA
C6WCM7_ACTMD          ------SEAETVSATLGLASLEAGLIAGAVGLFLVFLYCVFYYR-LLGLLTILSLVLSGV
C8XE16_NAKMY          ------AESVNVSAELGYQYLIAGIIAGGIGLLLVVVYCLIYYR-LLGLITILSLILSFG
D2S9I0_GEOOG          ------ATAQSISTELGAEQLQAGLIAGAIGIALVFVYALLYYR-LLGLVMIASLVLSAV
Q4JVE1_CORJK          ENGEPGGTTTTISPSLGAASLKAGVIAGLVGLVLVGLYALAYYR-GLGVVAIISLIAAFS
C4LIX5_CORK4          ENGEKGGTATTIPATLGFASLKAGLIAGGIGLILVALYALAYYR-GLGVITIFSLLLSAL
Q8NPZ9_CORGL          ENGERGGTTTTVPPSLGAASLKAGLIAGIVGIALVAIFVFAYYR-VFGFVSLFTLFAAGV
D7BNQ2_ARCHD          -----VQSEEQISATLGAEQLESGLIAGLFGILFIVLYMIWQYH-ALGLVAIASIAVSTG
D6ZHF4_MOBCV          -----QQSKQSISATLGGEHLKVGFYAAIVGLILVVLYLLQQYH-ALAGLATASLLLAGG
B2GIL6_KOCRD          -----IDSEQQISATLGSNQLRMGIVAGLIGLALVCVYSLFQYR-WLGLVTIASLVVAGV
A9WSE2_RENSM          -----IQSEEQISATLGTQQLEMGLLAGLIGLALVVVYSLFQYR-ALGFVTVASLVVAGV
E1VWF6_GLUAR          -----IQSERQVSATLGADQLTAGLIAGVIGLVLVFIYSLFQYR-ALGLVTIASLLVSGV
C5CCH9_MICLC          -----IESEQQISATLGRDQLFWGLIAGLIGLGLVAVYQFFQYR-ALGLLTFASIIVAGV
B0REC2_CLAMS          -----LQSSDVISATLGSSQLTSGLIAGLIGLVLVVLYSLVQYR-ALGMVTIASLVIAAV
E8NFI9_MICTS          -----VVSSDTVSATLGSQQLQVGFIAGLIGLALVALYSLIVYR-ALGTVIIASLGVMAV
D5UEN5_CELFN          -----EQSVEQISATLGSEQLEKGLIAGVFGLLLVVVYSLFQYR-TLGLVTVASLLVAAV
D1BGW2_SANKS          -----VQSEQQISATLGSEQLEKGMIAGLIGLLLVVVYSLFQYR-ALGLVTVASLLIAGL
C5C5R0_BEUC1          -----VQSQEQISATLGGEQLRNGVIAGLIGLVLVVLYTVFQYR-GLAFVTLTSLAVAGA
C7R4G5_JONDD          -----VQSEETISATLGSEQLQKGILAGLIGLILVGVYSLVQYR-VLGTLTIASLVIAAV
D1BSK1_XYLCX          -----VQSQQEISATLGSEQLQKGIIAGLIGLVLVVVYSLFQYR-TLGLLTVASLVVAGV
Q83MZ7_TROWT          -----VQSSENISATLGSSQLQSGILAGILGMILVVVYSLFQYR-LLGLLTVSSLICSAI
A6WCH6_KINRD          -----VQTEDQVSATLGSEQLRNGLIAGIVGLVLVVAYSLVQYR-ALGLVTIGSLLLAAA
E6SB77_INTC7          -----LQTNDTITPQLGEEQLRLGLLAGLIGLILVVVYSMFQYR-ALGMVTVISLVVAAT
C7NI44_KYTSD          -----LQSSEQISPTLGEEQLRWGIWAGVIGLVLVAIYSLLQYR-ALGLVTLASLALAAL
C7MCC2_BRAFD          -----VASEQQISATLGADQLEMGMIAGLIGLALVVLYAVGQYR-LLAMVTTASLAIMGL
D6Y2C4_THEBD          -----TASVVSVSSTLGQDQLRGGLLAGALGLLLVVPYLLGYYR-GLGLIGVASLGVAGV
D2AWR2_STRRD          -----KGSIEEVSSTLGADQLRGGLIAGAIGLGLVLVYSMLYYR-GLGIVSVLSLVVASV
D1AEV4_THECD          -----RGQAETVSSTLGSDQLEKGMQAGALGLALVVAYSLLYYR-GLGLVSVASLAVAAA
A0LUK3_ACIC1          -----QQSAETVSATLGNSELRAGLLAGMLGLLLVILYSIFYYR-GLSLVTVSSLALSAA
A8KZE4_FRASN          -----RSQAESVSPTLGRESLHGGLLAGAIGLGLVIIYSFLYYR-ALGIVVIASLGVSAA
Q2JD92_FRACC          -----RSQAESISPTLGRDSLHGGLLAGAIGLVLVIAYSFLYYR-ALGMVVIISLAVSGL
E2PV76_STRC2          -----EESVTTVSAALGGEQLRAGLIAGAIGLALVIIYLVAYYR-GLAAIAILSLLVSAA
E4N7T8_KITSK          -----KSDVTTVSPQLGSEQLKAGLIAGLIGMVLVVAYSLVYYR-GLGLISIAGLVVSAV
C7QJQ1_CATAD          -----EGNVSQISASLAGNQLSAGLIAGGIGMVLVIIYLIAYYR-GLSIVAIASLAISGI
D7GDS9_PROFC          -----VSSVDAVSASLGDEQLQAGLIAGLIGLILVLAYSFFYYR-GLGIVVVGSLLAAVI
Q6A8K5_CUTAK          -----ISSVDNISPTLGGEQLRAGIIAGIIGLILVGGYCLLYYR-GLGLVTLGSLVIAGI
D2PVF3_KRIFD          -----ISSVETISPQLGGDQLSAGIWAGLIGLLLVIVFSFLYYR-GLGLVVVLSLAVAAA
A1SJA9_NOCSJ          E----ATSVEQIGASLAGDQLSAGILAGIIGLALVMLYCLLYYR-GLGLVVIASLVVAGV
C4RGU0_MICS3          Q------EQQNVTATLGASHLRAGLLAAGIGMLLVIIYSFFYYR-LLGSVIFLSLVLSAL
A4X5X5_SALTO          Q------AQQNVTATLGASHLRAGLLAAGIGMLLVIIYSFFYYR-LLGSVIFLSLVLSAL
D3PYP7_STANL          E------TIDEVSPTLGLSQMYAGLLAGGVGVALVILYCLVYYR-LMGFVVIVSLLVSGA
E1QZN3_OLSUV          S------ESRVVGPTLGQDSLNQGVFAIAIGVAIVVAYLFVFYR-GLGLLTMGSLGVFAV
C7LYS6_ACIFD          ------QTVQTVSPTLGASALRAGLVAGVVGLIAVLLYTIVYYR-VLGVVVLAGLVVTAA
                                 :    .             .           :    .            

B1YJQ7_EXIS2          LVMIFFNGI------NAVLTLPGIAALVLGVGMAVDANIITAERIKDELRSGK-SVLSAF
D6XWY8_BACIE          VVLVIFDWM------NAVLTLPGIAALILGVGMAVDANIITFERIKDELRSGK-SVMSAF
E3E8W8_PAEPS          LVLAIFYLG------GFVLTLPGIAAFVLGIGMAVDANIITYERIKEEIKSGK-TIRSSV
C0ZAP6_BREBN          FCMVVLDWM------HATLTLPGIAGFILAVGIAVDANIITYERIQEEIRSGK-TVLSAF
SECD_ALIAD            LTLLTFAGL------HVVLTLSGLAALILGVGIAVDANIITYERIKDEVRNGR-SLRSAV
SECD_ANADE            LVLAVMS------MIGTTLTLPGIAGFVLTLGMAVDANVLINERIREEMRAGR-NVRQSV
Q08P79_STIAD          LILAGLA------IFNATLTLPGIAGFVLTLGVAVDANVLINERIREELSHGK-TARQAV
A9F8D1_SORC5          LQVAVLA------MFGASMTLPGIAGLVLTMGIAVDANVLINERIREELRNGK-SPRAAV
Q6MKZ2_BDEBA          GIFALLT------TFGATLTLPGIAGIALTVGFAVDANVLINERIREELRMGH-GIKVAV
E1X0T6_HALMS          IVIACLV------GLEATLTLPGIAGIALTIGMAVDANIIIYERIREEVRKGV-SNYKAV
D0LJ86_HALO1          FMMAILA------ALGATLTLPGIAALVLTVGMAVDANIIIYERIREELRLGK-SVRGAV
SECD_SYNFM            LVLAGMA------AFGFTLTLPGIAGIALTIGMAVDANVLIYERIREELRLGK-TPRAAL
Q2LVH4_SYNAS          LLMGAMA------AFKATLTLPGIAGIVLTIGMAVDANVLIFERIREELRTEK-TPRAAV
E1YHR5_9DELT          LITGALA------AFQATLTLPGLAGIVLTIGMAVDANVLIYERIREELALGK-TARAAV
E1QIL8_DESB2          LILGAMGLLGAMPEFQATLTMPGIAGIILTIGMAVDANVLIFERIREELRAGK-TPAAAV
B8F9E3_DESAL          LILASLA------LLDATLTLPGIAGIILTIGMAVDANVLIFERIREEIRTGK-APAFAV
SECD_THEYD            LLIGALA------ALNATLTLPGIAGIALAVGMAVDSNVLMFERIREELRLGK-TPKAAI
D8PI89_9BACT          CLIGALA------GLNATLTLPGIAGIILTIGMGVDSNVLIFERIREELRQGK-AVRVAI
B6ANM3_9BACT          LLVGAMA------ALHATLTLPGIAGIILTIGMGVDSNVLIFERIREELRLGK-PVRSAI
B5ECA4_GEOBB          FLLGALA------ALGATLTLPGIAAIVLLVGMSVDSNVLIFERVKEEIRLGC-TPKMSI
Q3A3C4_PELCD          FIMAMLS------LCKASLTLPGIGGIVLTLGMAVDANVLIYERIREELRLGK-SARNAL
D5MHP3_9BACT          WLVGALA------SLRATLTLPGIAGIILGIGMAVDSNVLILERIREELRSGK-PVRSAI
SECD_CALNY            IILGAMG------MFKATLTLPGIAGLILTMGMAIDANVLIFERIREELRLGR-TPMNAL
SECD_DESIS            ILMGLLA------YFGATLTLPGIAGIILTIGIAVDANVLIFERIREELRRGA-SPRLAI
C4XSM5_DESMR          LIVAGLA------GFGATLTLPGIAGIILTIGMAVDANVIIFERVREELRRGL-TARSAV
C7LN34_DESBD          LILAGLA------AFGATLTLPGIAGIILTLGMAVDANVLIYERIREELRHGE-SVAAAI
Q1MSC1_LAWIP          LLLAGLA------AFGATLTLPGIAGIVLTIGMSVDANVLIFERIREELKKGL-MPLKAV
SECD_MAGMM            ILVSLLA------LMQATLTLPGIAGAVLLLGMAVDANVLIFERIREELRLGK-SPLAAI
SECD_RHOM4            FILGILA------AFNATLTLPGIAGIVLTIGMAVDANVLIFERIREEQATGK-TLRAAI
D5HAA4_SALRM          LIMGILA------GFGATLTLPGIAGIVLTIGMAVDANVLVYDRVREEQATGK-TLRAAI
B3EJI9_CHLPB          FVLSVLA------GFSAALSLPGIAGIVLTIGMAVDANVLIFERIREEIAQGK-NMRLAV
Q3ANT9_CHLCH          IVLSVLA------GFNASLSLPGIAGIVLTIGMAVDANVLIYERVREELAEGK-SIAAAV
B3QTH7_CHLT3          FVIAVLA------GFSAALTLPGIAGLVLTIGMAVDANVLIFERVREEISNGK-RVRLAV
B0VHR7_CLOAI          FILAMLT------AFGATLTLPGIAGIILTIGMAVDANVLIFERIREELDLGK-TPRSAV
SECD_ELUMP            FLLAAMA------AFNATLTMPGIAGIILSLAMAIDANVLILERMREEKLRGR-SLYEMI
SECD_UNCTG            ILMAIMA------YLKFTLTLPGVAGIALTLAMSVDANVLILERIREEIAVGK-TAKMAV
SECD_ACEP3            LMVAILSLF------EATLTLPGMAGMLLTLGMAVDANILINERIREEVARGR-TPLAAM
Q0BS58_GRABC          MLLGALSLL------EATLTLPGMAGILLTLGMAVDANILINERIREETKAGR-PPVAAM
D3NUL2_AZOS1          LTLAALSLL------HATLTLPGIAGVLLSLGLAVDANILINERIREETKKGR-GVFASM
D8JWH1_HYPDA          LTVALMTMI------GAVLTLPGIAGLVLGVAMAVDANVLIYERIREELRLGK-MPVSAI
E3I016_RHOVT          IIMACLSLF------HATLTMPGIAGIVLTMGVAVDANVLIYERIREELRTGR-GMISAI
E2CQN1_9RHOB          LIFGALTFL------QATLTLPGIAGIVLTIGMAVDANVLIFERIREEARAGR-SAITAI
A7HXL0_PARL1          MIFAALSIL------QATLTLPGIAGIVLTIGMAVDANVLIYERIREEIAAGK-GPIPAI
B0UI92_METS4          LILGLMSVL------EATMTLPGIAGIVLTIGTAVDSNVLIYERVREEVRAGR-SIPSAL
A7IND6_XANP2          LMFSLQSIL------GATLTMPGIAGVVLTIGMAVDSNVVIFERMRDEAREGR-SAISAI
A4U1K0_9PROT          ILLALMSVL------GATLTLPGIAGIVLTMGMAVDANVLIYERMREEQRSGR-SIISTI
D5BQT5_PUNMI          LIVAALSAL------QATLTLPGIAGIVLTMGMAVDANVLIFERIREELKRGR-SVMAAI
Q9A6U2_CAUVC          LIVAAMSLT------QATLTLPGIAGLILTLAVAVDANVLIYERMRDEARAGK-SPILAA
D9QLN2_BRESC          LIIAAMSLT------QATLTLPGIAGLVLTFAVAVDANVLIYERIRDEARAGR-SVIASL
Q5NL89_ZYMMO          LILAVMAVL------GATLTLPGIAGLVLTIGAAVDANVLINERIREEIGRGR-TPVHAV
Q1GSE5_SPHAL          LIIAIMAAF------NATLTLPGIAGFVLTIGAAVDANVLINERIREELKRGR-RVFQAV
SECD_RHOCB            FIFAVMGAI------GGTMTLPGIAGIVLTIGTSVDANVLIYERMREEIRSGK-SPVRAI
Q0C0W6_HYPNA          LIFAALSLL------GATLTLPGIAGIILTIGMAVDANVLVFERIREEQQNGR-SVWTAV
C6XJ02_HIRBI          LIIGSLSGL------GATLTLPGIAGIILTIGMAVDANVLVFERIREEHKNGR-SPITSI
Q0ANE6_MARMM          LILGGLSGL------GMTLTLPGIAGIILTIGMAVDANVLIYERIREEVLNNR-TPVQAL
Q2RTI1_RHORT          LLFGMLSGL------GATLTLPGIAGIALTIGMAVDASVLIFERIGEEARAGL-AVDEAL
SECD_ECOLI            LIVGIMSLLP-----GATLSMPGIAGIVLTLAVAVDANVLINERIKEELSNGR-TVQQAI
C4K8M1_HAMD5          LIVGVMSLLP-----GVTLTMPGIAGIVLTLAVAVDANVLINERIKEELRNAR-SIQQAI
SECD_HAEIN            LLVGLMSILP-----GATLSMPGIAGIVLTLGMSVDANVLIFERIKEEIRNGR-SIQQAI
A1SWT8_PSYIN          MIIGFMSMIP-----GATLTLPGIAGIVLTVGMAVDANVLIFERIREELAAGK-SIQQAI
Q493H1_BLOPB          LMISTMSIVP-----GIVLTMPSIVGIVLTLSVAVDANVLINERIKEEIKKGK-PVQYAI
Q7VQA9_BLOFL          LIVSLLSVIP-----GITLTMSSIVGVVLTLSVAIDANVLINERVKEELKQGK-PVQYSI
B8GTQ2_THISH          LIVSVLSML------QATLTLPGIAGIVLTVGMAVDANVLIFERIREELRNGN-SPQAAI
Q31FZ7_HYDCU          LIVAVLSLL------QATLTLPGIAGIVLTVGMAVDANVLIFERIREELRT-S-SVQSAI
D0KW97_HALNC          LIVAVLSML------QATLTLPGIAGMVLTLGIAVDANVLINERIREELRNGL-TPHAAI
Q60B03_METCA          LLVAVLSLL------QATLTLPGLAGIALTVGMAIDANVLINERIREELRAGS-TPHAAI
A1WXP8_HALHL          IIVAVLSML------QATLTLPGIAGIVLTVGMAVDANVLIFQRIREELKAGA-PIQTAI
D3RSH9_ALLVD          LTIAVLSML------QATLTLPGIAGIVLTIGMAVDANVLIYERIREEIRNGN-SPQASI
D0U555_9BACT          TIVSILSLI------QATLTLPGIAGIVLTVGMAVDANVLIFERVKEELRATK-NIQKAI
Q5ZU07_LEGPH          FLCALLSII------DATLTLPGIAGIVLTVGMAVDANVLIYERIREELRNGL-SPQAAI
A9KE82_COXBN          FIVAVLSIL------GATLTLPGIAGIVLTVGMAVDANVLINERIREELRNGM-STQASI
A0A0E1PNG4_ACIBA      MILTIMSWI------GASLTLPGIAGIVITIGMAVDANVLICERIREEMLWGA-SPKQAI
Q0VS97_ALCBS          IIVGVMSLIP-----GATMTLPGIAGIVLTVGMAVDANVLIFERIREDLRRGL-SPRQAI
A4GHV3_9BACT          LLVAVMSIL------SATLTLPGIAGIVLTVGMAVDANVLIFSRIREELNKGR-EPLEAI
A4GK28_9BACT          LIASIMSIL------SATLTLPGIAGIVLTIGMAVDANVLIFSRIREELKRKL-KPLEAI
Q1QTM7_CHRSD          LLVAAMSLL------GATLTLPGIAGIVLTLGMAVDANVLIFERIREELRAKM-PVQQAI
A1TZN9_MARHV          LLVACMSIL------SATLTLPGIAGIVLTVGMAVDANVLIFERIKEELKAGV-PPQSAI
C3K1N2_PSEFS          MLLALMSLL------GATLTLPGIAGIVLTMGMAVDANVLIFSRIREEIAAGM-TVQRAI
B8KXG6_9GAMM          LLVAVMSLM------GATLTLPGIAGIVLTVGMAVDANVLIFARIREELANRA-SPQMAI
Q21KW0_SACD2          VLVAVMSMF------GATLTLPGIAGIVLTVGMAVDANVLIFSRIKEELKAGS-SSQTAI
B3PDJ8_CELJU          LMIAVMSMF------GATLTLPGIAGIVLSIGMAVDANVLIHSRIREELKGGA-SPQQAI
C7RB47_KANKD          TIVAVMSIM------GATLTLPGIAGIVLTVGMAVDANVIIFERIREELRHGT-GVAQAI
B2FN02_STRMK          IVVAVMSLF------GATMTLPGFAGLALSVGLSVDANVLINERIREELRAGV-PGKTAI
A5EWX7_DICNV          LLIASISLL------GATLTLPGIAGIVLTLGMAVDANVLIYERIREELAADR-PIKESI
Q145I2_PARXL          LLIAVLSML------QATLTLPGIAAIALALGMAIDANVLINERVREELRNGA-PPQLAI
D8INT3_HERSS          LLVALLSTL------QVTLTLPGIAAIALALGMAIDSNVLINERIREELRAGN-SPQAAI
E6UXK2_VARPE          LLVAILSIL------QATLTLPGIAAMALAIGVAIDSNVLINERVREELRNGA-SPQAAI
D6CKE5_THIA3          LLVAVLSML------QATLTLPGIAAMALALGMAIDSNVLINERIREELRNGA-SPQNAI
E8UEP8_TAYEM          LLLAVLSLI------QATLTLPGIAAIALTLGMAIDANVLINERIREELREGV-NPQQAI
E0XSS7_9PROT          LLIALLSLL------QATLTLPGIAAMALTLGMAIDSNVLINERIREEIRAGA-TPHIAI
D7N3K1_9NEIS          FLIAILSAL------QATLTLPGIAALALTLGMAIDSNVLINERIREELRAGV-PPQQAI
D7DM25_METV0          LLVAILSML------QATLTLPGLAAIALALGMAIDANVLINERIREELRNGN-TPQASI
Q0AG53_NITEC          FLIGLLSIL------QATLTLPGMAGMALTVGMAIDANVLINERIRDEIRHGA-SPQAAI
B6BWI8_9PROT          LLVALLSTI------QATLTLPGLAAMALTVGMAIDSNVLINERIRDEIRNGN-TPQASI
B7J4R7_ACIF2          AILAVLSIM------GGTLTLPGIAGIVLKIGLAVDANVLVFERIREELRHGM-STRAAI
Q0HXS6_SHESR          ILFGLLALIP-----GAVLTLPGIAGLVLTVGMAVDTNVLIFERIKDKLKEGR-SFALAI
E1SV05_FERBD          TLFGLMALLP-----GAVLTLPGIAGLVLTVGMAVDTNVLIFERIRDMIRQGH-SLARAI
B7VQL0_VIBTL          CLFGLLALIP-----GAVLTLPGIAGLVLTVGMAVDTNVLIFERIKDKMREGR-NFSQAI
Q7MD23_VIBVY          CLLGLIALLP-----GAVLTLPGIAGLVLTVGMAVDTNVIIFERIKDKMREGR-SLAQAI
A1S8J5_SHEAM          MLLGLLALIP-----GAVLTLPGIAGLVLTVGMAVDTNVLIFERIRDKMKEGR-SLALAI
A4SLM7_AERS4          MQVGMLAVLP-----GAVLTLPGIAGLVLTVGMAVDTHVLIFERIKDRLREGG-SLANAI
Q15N36_PSEA6          CLLGLMALLP-----NVVLTLPGIAGLVLTVGMAVDTNVLIFERIKEERKRGR-SNFLAI
Q3IL52_PSEHT          SLVGLMSLLP-----GVVLTLPGIAGLVLTIGMAVDTNVIIFERIKEERRKGR-APYQAI
A8EY98_RICCK          YILALLSLF------QATLTLPGIAGIILTIGMAVDANVLIYERIKEELHKGV-SNLYAI
B3CTC4_ORITI          YILAILSML------QATLTLPGIAGIILTIGMAVDANILIYERIREELQNGN-SILYSV
B9KH60_ANAMF          FVLLTMTFI------GATLTLPGIAGMTLTVGMSIDANVLIFERIREEIRTGR-KLRLAV
A0A0H3M0Z2_EHRRW      FIVAALTLL------QATLTLPGIAGITLTVGMSVDANVLIFERIKEELRSKK-KLRWAV
B3CPT1_WOLPP          SILLILTLL------EATLTLPGIAGIALTVGMSVDANVLIFERIREEIRAGK-RTARAI
Q2GDE0_NEOSM          LLVASLTLL------EATLTLPGIAGLILTIGMAVDANVLIFERMREEFKRTG-VLRNSL
D0RNY3_9PROT          LLLGTLTLI------EATLTLPGIAGIILTVGMAVDANVLIYERIKEELLIEK-NIMIAF
Q4FM00_PELUB          FLVGILTLF------EATLTLPGIAGIILTVGMAVDANVLIFERIKEECKKEK-NNIIAF
Q7VFM8_HELHP          LIIAVMACF------GASLTLPGMAGIVLTVGMAVDANIIINERIREALRAGF-GIAKSI
C5ZWZ2_9HELI          LVIAVMALF------GATLTLPGMAGIILTVGMAVDANVIINERIREGFRAGE-NFIKAM
E7A9U3_HELFC          LIIAVMALF------GATLTLPGMAGIVLTVGMAVDANIIINERVREGLRGNE-SVAQAL
A0RNX0_CAMFF          LLVAVMALF------GATLTLPGMAGILLTIGMAVDANVIINERIRELLKAGQ-SVHVSI
C3XE91_9HELI          LIIAVMALF------DATLTLPGMAGIVLTVGMAVDANIIINERIREGLKSGM-GVIKSL
SECD_AQUAE            FLLASMAFL------GATLTLPGIAGIILNMGIAVDSNVLIFERVKEELRLGN-TVSKAI
D3DH34_HYDTT          FLWAGLVLL------GATLTLPGIAGILLNMGIAVDSNVLIFERVKEELRSGS-SPKKAV
B4U9J1_HYDS0          LLWAGLVLL------GATLTLPGIAGIILNMGIAVDSNVLIFERIKEEIARGN-TLRKAV
C1DVG5_SULAA          LLWVAMLLF------DITLTLPGIAGIILNIGMGVDGNVVIFERIKEELHQGK-TLRVSL
E8T6K3_THEA1          ILWALMALI------GATLTLPGIAGFILTIGMSVDANVIIFERIKEELRKGR-NLYSAV
SECD_KORVE            ILLGFMGYF------GAVLTLPGIAGVILTVGMGVDSNVLIFERIREELRNGK-TPPSAV
E8X5K0_GRATM          ILLGFMGYS------HATLTLPGIAGVILTIGMGVDSNVLIFERIREELRAGK-TAAAAV
C1F9I4_ACIC5          ILLGFMGYT------HSVLTLPGIAGVILTVGMGVDSNVLIFERIREELRAGK-APSAAV
Q029K4_SOLUE          LLLAAVSYF------HAVLTLPGIAGIILTIGMAVDSNVLIFERIREELRSGK-SVIAAV
SECD_PETMO            LLMGILS------WTGAILTLPGIAGIILTFGTTVDGNIIIYERIKEELRIGR-PPLTAV
C5CF36_KOSOT          LLFGMLA------LTGSILTLPGIAGIILTIGMTVDGNILIFERIKEELRVGK-TPENAV
A6LP86_THEM4          LLLGVLA------TTGSILTLPGIAGIILTIGTTVDGNIIIYERIKEEIRRGS-SVKAAI
A0A1Q6S007_9FIRM      LAIAAVSGYFPV-FSSFTMTLPGIAGLILSIGMGVDCNVITAERIKEELKAGR-TLDGAL
D3R265_MAGIU          GIMLGIS------IPQQTLTLQGIAGIILSIGMGVDANIIISERIKEELRGGA-TLLTAI
B8I6M6_RUMCH          MELLALS------WTNIIVTLPGIAGLILTVGMAVDANVIIFERIKDELKNGK-TLRAAI
B0SPU4_LEPBP          ILAALLT------LMDFTLTLPGIAGIILTAGMAVDANVIIYERIREEIEEGR-ALSIAV
SECD_TREPA            IMFGVLS------AFNLTLTLSSIAGMILTIGMAVDANVVVFERIREELALGK-SRGAAV
Q73PW4_TREDE          IMFSILS------AFNLTLTLPSIAGMILTIGMAVDANVVVFERIKEELRLGK-TREASI
E1R5K7_SEDSS          IMVSILS------AFNLTLTLTSIAGLILTVGMAVDANVIIFERIKEEYRLGK-TPEASA
E0RQA9_SPITD          FMTALLS------VFNFTLTLTSIAGVILTVGMAVDANVIIYERIKEELRLGK-TPASAV
D5UAD5_BRAM5          LIIAVLS------PLRFTLTLPGIAGLILTIGMAVDANVIIFERIKDELKVKS-NVADAI
SECD_LEPBD            LVLGLLSGI------GAALTLPGIAGFILTLGMAVDSNVITYERIKEELRLGE-SLHDAV
SECD_SEBTE            LTAGLMCAI------GTTLTLPGIAGFILSLGMAVDANVIIFERIKDEIMEGK-RFQDCI
A5TW61_FUSNP          ITFACLNFI------DATLTLPGIAGFILSLGMAVDANVIIFERIKEELRFGN-SIRNSI
SECD_GEMAT            YTLAILAGF------NAVVTLPGLAGFVLSIGMAVDNNVLIFERIREELDHGK-STRLAI
B2A263_NATTJ          IIFNALIYL------DATFTLPGIAGLILSLGMAVDANVIIFERIKEELNYGK-TLRVSV
SECD_ACIFV            LLLAVM------KGLNATLTLPGMAGIILSIGMAVDANVLIFERFKEEIANGK-TLRAAV
D1BLM4_VEIPT          LLLLVLG-----KGFNATMTLPGIAGIILSMGVAVDANILIFERFKEEVFSGK-SMRVAM
B8CXF7_HALOH          IFIGVL------AGLQATLTLPGIAGFILSIGMAVDANIIIFERIKEERRSGK-GIKSSI
D9QVJ1_ACEAZ          IVMGTL------AGLNATLTLPGIAGLILSIGMAVDANIIIFERVKQELGAGK-TKRAAI
D5XEJ6_THEPJ          IVLGLL------AALQATLTLPGIAGFLLSIGMAVDANIIIFERVKEELREGN-SLRRSI
Q2RHU6_MOOTA          IVMAVL------WGLKATLTLPGIAGLLLSVGMAVDANIIIYEHIKEELRNGK-TLRAAI
Q3ABZ0_CARHZ          IVLGVM------IALKATLTLPGIAGFVLSMGMAVDANILIFERLKEELRMGK-TLRSAI
B0TF81_HELMI          IVVGIL------TLLKATWTLPGIAGFLLSLGVAVDANVIIYERLKEELRAGK-TLRTAI
C9R7V3_AMMDK          LVLLVF------VALKATMTLPGIAGYLLSFGVAVDANILISERIKEELRSGK-SLRTAV
B1I4K5_DESAP          LVLLVL------AAFNATLTLAGIFGFLLSLGIAIDANIIIFERLKEELRTGR-SLRSAV
C8W4E1_DESAS          IVLAVF------AGLHVTMTLPGIAGFLLSLGIAVDANVIIFERIKEELRNGK-TLRTAI
A4J544_DESRM          IVIAIF------AAMHVVLTLPGIAAFVLSMGMAVDANVIIFERIKEELKSGK-SLRSSI
Q0AX22_SYNWW          LVLGTM------TLFGAVLTLPGIAAFVLSIGMAVDANIIIYERIKEELRWGK-TLKAAI
Q892A4_CLOTE          MVLGTF------VSIDAIITLSGIAGLLLTIGMAVDANILIFERIKEELSTGK-SIRSSV
D9SMV2_CLOC7          LLLLAF------LLGRVTLSLPGIAALLLTIGMALDANVLMFERIKDKIREGM-SVKNAI
Q67LL8_SYMTH          LNMVVL------LAIDAVFTLPGIAGLLLGIAMAVDGNVIIFERIKEELRKGK-GLRSGI
D9TNU7_THETC          INFIVY------ALLHVTLDLPGIAGMLLSIGMAVDANIIIFERMKEEMRAGK-SIRASL
A4XIR1_CALS8          ILVAIV------GYAKITLTLPGIAGIILSAGMAVDANILIFARMKEELRAGK-TLKAAM
E3GFZ5_9FIRM          LDLILM------VFANVTLTLPGIAGIILSVGMAVDANVIIFERIKDESRSGK-SINAAI
D9RXQ2_THEOJ          LTLIVF------IMLDATLTLPGIAGFILSVGMAVDANVLIFERFKEELRSGK-TLRAAM
E3PRC6_ACESD          IVIYTY------IGIKATLTLPGIAAMILSVGMAVDANVIIFERIKEEIRSGK-SIRVSV
A6TQN4_ALKMQ          IVLGIF------VALNATLTLPGIAALILSVGMAVDANVIIFERLKEELRAGK-TLRSAI
D4M8M0_9BACT          LIFTGL------IAFHATLTLPGIAGIILTLGMAVDGNVLIYERIREEVRSGK-TPIAAL
E6SLR2_THEM7          LTAGAL------YGLNATLTLPGIAGFVMSVGMAVDANVLIYERIKDELKAGK-TIRAAL
SECD_DICTD            LDLAAL------KLLNATLTLPGVAGIILSIGMAVDANCLIFARMKEEYAQRK-TPMASL
SECD_DEHMV            IVLALFKLV------PVTLTLAGIGGFIVSAGMAVDANILIFARLKEELLTGK-TLGAAV
B3T9T5_9ZZZZ          LVLAVFKLM------PVTLTLAGVAGFVLSMGMAVDANILIFERMKEELRIGR-TLNFAL
SECD_THET1            VVFALFKLI------PVTLTLAGIAGFILSVGMAVDANVLIFARLKDELRRGR-GLIQAI
B9KYU6_THERP          YVFALFKLI------PVVLTLPGIAGFILSIGMAVDANVLIFARIREELRLGR-PIARAI
A9B5U9_HERA2          LSFAIYNLV------PVTLTLPGIAGFILSIGLAVDANVLIFARIKEELHRGR-SLERAV
A7NP80_ROSCS          ISFALYQLI------PVTLTLPGIAGFILSIGVAVDANVLIFARLKEELRRGR-SLNASI
SECD_ANATU            ITLTLFRFI------PVTLTLPGIAGFLLSTGSALDANILIFERLKEELRAGR-TFSQAL
SECD_PROMA            FNIAIYALI------PVTLTLPGVAGFVLSIGMAVDANVLIFERVKDELRRGN-TLIRSI
B5IKE7_9CYAN          FNLALYALI------PVTLTLPGIAGFILSLGMAVDANVLIFERIKDELRSGN-TLIRSI
B4WJX6_SYNS7          LTFAAYNLL------GVTLTLPGIAGFILSIGMAVDANVLIFERTREEMRAGK-TLYRSV
D3EPH0_ATETH          LTLACYSLI------GVTLTLPGIAGFILSIGMAVDANILVFERIREELQNGK-TLYTGV
SECD_ACAM1            LTFACYVLF------GVTLTLPGIAGFILSIGMAVDANILIFERTREELRSGK-TLYRSI
Q2JY13_SYNJA          CTFALFQLL------GVTMTLPGIAGFILSIGMAVDANVLIFERIKEELRAGK-SIYKSI
Q7NDR6_GLOVI          STFAIFKLI------PVTLTLPGIAGFILSIGMAVDANVLIFERTKEELRAGK-QLFTAV
Q1AWD0_RUBXD          LLWGLIVAI------PVTVTLPGIAGIVLSVGVAADANIVIFERIKEEVRRGK-TPRTAI
A0QWJ2_MYCS2          VVYAILVLLGR--YIGYTLDLAGIAGLIIGIGTTADSFVVFFERIKDEIREGR-SFRSAV
A0A0H3MPV3_MYCLB      IIFAILVLLGR--YINYTLDLAGIAGLIIGIGTTADSFVVFFERIKDEIREGR-SFRSAV
C0ZZ50_RHOE4          MVYAIMVLLGR--YIGFTLDLAGMAGLIIGIGMTADSFVVFFERIKDEMREGR-SFRSAV
D0LCM8_GORB4          MVYGIMVLLGR--WIGFTLDLAGIAGLIIGIGMTADSFVVYFERIKDEMREGR-SFRSAV
D5UNI7_TSUPD          LLYGLLVLLGR--WIGYSLDLSGIAGIIIGIGMTADSFVVYFERIKDEIRDGR-SFRSAV
D9UX19_9ACTN          LVYAVLVLLGR--WIGYTLDLAGVAGLIIAIGITADSFVIYFERLKDEIREGR-TFRSAV
C7MQZ9_SACVD          IVYAVLVLLGR--WIDYTLDIAGVVGFIVAVGVTADSFVVYFERIKDEMREGR-TFRSAV
A4FBB0_SACEN          IVYAVLVLLGR--WVGFTLDLAGVAGLIIAIGITADSFIVFFERLKDEIREGR-TFRSAV
C6WCM7_ACTMD          IVYAVMVLLGR--VVGFTLDLAGIAGLIIAIGITADSFVVFFERLKDEMREGR-SFRSAV
C8XE16_NAKMY          LVYPVLVLLGR--WIGYSLDMAGVAGLIIAIGITADSFVIYFERIKDEVREGR-TFRSAV
D2S9I0_GEOOG          VVYAVLVVLGR--QIGFTLSLAGIAGFIVSLGITADSFVVYFERLKDEIREGR-TLRSAV
Q4JVE1_CORJK          LVYGFIVLLGR--WIGYSLDLSGIAGLIIGLGTTADSFVIYFERIKDDIKNGS-TFRSAV
C4LIX5_CORK4          LIYGSLVLLGR--WVGYSLDLAGIAGLIIGIGTTADSFVVYFERIKDEIRDGR-TFRSAV
Q8NPZ9_CORGL          LVYGLLVLLGR--WIGYSLDLAGIAGLIIGIGTTADSFVVFYERIKDEIREGR-SFRSAV
D7BNQ2_ARCHD          LSFFVISLLSW--TMDYRLSMAGVLGIIISVGVTADSFIVYFERIRDEIRDGR-TIRGGI
D6ZHF4_MOBCV          IVYLAVAILSW--SMGYRLSLAGVVGLIVAVGVTMDSFIIYFERIRDEVRDGK-PLATAV
B2GIL6_KOCRD          LTYLAITLLGW--GANYRLSLAGVAGLVVAIGQTADSFIVYFERIRDEIRAGR-TIPAAV
A9WSE2_RENSM          LTYLAIAVLGW--SQNYRLSLAGVAGLIVAIGQTADSFIVYFERIRDELREGR-GLVAAV
E1VWF6_GLUAR          LTYLCLVLLGW--GMNYRLSLAGVAGLIVAIGLIADSFIVYFERVRDELREGR-PLASAV
C5CCH9_MICLC          LTWLAIAILGW--TDNYRLSLAGIAGLIVAIGLTADSFIVYFERIKDELRAGH-TVPVAV
B0REC2_CLAMS          ITYLLITLLSW--REGYRLSLAGVAGLIVAIGITADSFIVYFERIKDELRDGR-GLVSSV
E8NFI9_MICTS          LTYVMLCILAW--RMGFRLSLAGVAGLIITIGFTADSFIVYFERIRDELRDGK-SITAAV
D5UEN5_CELFN          VTYGIIALLSW--VQGYRLSLPGVAGIIVAIGITADSFIVYFERIRDELRDGR-TLGAAI
D1BGW2_SANKS          VTYGMITLLSW--TQGYRLSLPGVAGLIVAIGITADSFIVYFERIRDELRDGR-SLTSAV
C5C5R0_BEUC1          LTYGAILLLSW--LQGYRLSLPGVAGLIIAIGVTADSFIVYFERIRDEVREGR-VLTAAV
C7R4G5_JONDD          ATYLALALLSW--VQGYRLSLAGVAGIIVAIGITADSFIVYFERIRDELREGR-SLDGAI
D1BSK1_XYLCX          ITYVTIALLSW--GMGYRLSLPGVAGLIVAIGFTADSFIVYFERIRDELRNGR-TLHFAV
Q83MZ7_TROWT          VTYLVITFLSW--QNGYRLSLAGVAGLIVAIGITADSFIVYFERVKDELREGR-DIVRAV
A6WCH6_KINRD          LNYGVLLLLSW--LQGFRLSLAGIAGLIVAIGVTADSFILFFERVRDEIRDGR-ILSSAV
E6SB77_INTC7          LTYLALVVLGT--THGFRLTMAGVTGAIVAIGVTADSFIVYFERIRDEVREGR-PLVAAV
C7NI44_KYTSD          LAYGAVVLLGW--QYNLRLTMAGITGLIVAIGITADSFIVYFERIRDEVREGR-PLRNAV
C7MCC2_BRAFD          LTYGTLTVLSNIPEIGYRLSLAGVVGLIVAIAFTADSFIVYFERVRDEIREGR-GIVAAV
D6Y2C4_THEBD          ITYLAVALLSHNA--GFRLSLPHLIGLVVSIGVTADSFIVFFERIRDELRRGRRALRPAV
D2AWR2_STRRD          LTYQAVVILGTFA--GFRLSLPHIIGLIVSIGITADSFIVYFERIRDEMKEGRRSLRTAV
D1AEV4_THECD          ITYLAVVLLGYEGTLGFRLSLAHVIGLIVSIGIAADSFIVYFERLRDELREGR-PLRSAV
A0LUK3_ACIC1          IQYPLLVLLGQGI--GYTLTLAGIAGLIVAVGVTADSFVVFFERLRDEVREGN-SLRSAV
A8KZE4_FRASN          LIYASVVLLGDAI--GFTLTLAGIAGLIVSIGVTADSFVVYFERIKDEVRAGR-SVRTSV
Q2JD92_FRACC          LIYASVVLLGVAI--GFTLTLAGIAGLIVSIGVTADSFVVYFERIKDEVRAGR-TVRAAT
E2PV76_STRC2          LTYVLMSLLGPAI--GFALNLPAVCGAIVAIGITADSFIVYFERIRDEVREGR-TLRPAV
E4N7T8_KITSK          LTWSIMSLLGAGI--GFALNLPAVCGAIVAIGITADSFIVYFERIRDEVREGA-QLRAAV
C7QJQ1_CATAD          LTYSLASLLGPAM--GFRLSLAGVAGLVVAIGITADSFVIFFERLRDEVREGR-TLRTAV
D7GDS9_PROFC          ITWGTIVLLGQTV--GFAMNLPGIAGAIVAIGVTADSFIVYFERIRDEIRDGH-SLRHSI
Q6A8K5_CUTAK          TTYAAMVLLGEAV--GFTLSLAGIAGAIVAIGVTADSFIVYFERIRDEIREGR-TLRTAL
D2PVF3_KRIFD          LTYAAVVLLGKTM--GFTLTLAGIAGLIVAIGITADSFVIYFERLRDEVREGR-SLRSSV
A1SJA9_NOCSJ          VTYSTVLLLSRTA--GFTLTLPGIAGLIVAVGITADSFIVYFERIRDEMRDGK-SMRVAV
C4RGU0_MICS3          LVFGALIVLGR--QIGFTLTLAGIAGMIVSLGVAADSFVIYFERLKDEIREGR-SPRSAV
A4X5X5_SALTO          LVFGALVVLGR--QIGFTLTLAGIAGMIVSLGVAADSFVIYFERLKDEIREGR-SPRSAV
D3PYP7_STANL          VLYPAISMLGA--QIGFTLTLAGVAGFIVAIGITADSFVVFFERLKDEVKEGR-SSRSAV
E1QZN3_OLSUV          LYLGLLALLSH--FDAFALTLPGLAGIVLTTGSAADSSILVLERFREEIRMGR-SVRTAS
C7LYS6_ACIFD          AVWAVVAYLGR--AAQLTLDLSGVTGLIVSIGLITDSYIVFFERLKDEIREGS-SIGYAV
                                          :  . .  :  .   *   :   :  :             

B1YJQ7_EXIS2          KAGNRRSFGTILDANLTTLISAGVLYYFG--------------TSTVKGFAIMLMVSIAV
D6XWY8_BACIE          KAGSRRSLSTIIDANVTTILAAVVLFYFG--------------TSAVQGFALMLIVSILT
E3E8W8_PAEPS          IAGSKASFRTVMDANITTIIAAAVMFGLG--------------TGSVRGFALVLIVDIVV
C0ZAP6_BREBN          RAGERRSLITIIDAHVTTLIATGVLFFFG--------------TSSVQGFAVVLAMTIIV
SECD_ALIAD            RIGNKNAFRTIVDSNATTFIAGLIMYIFGG-------------EGDVRGFAVALMVGIIV
SECD_ANADE            QLGYDRVFWTIVDSHVTTLVAGVVLFQY-G-------------SGPIRGFAVTLIIGLVA
Q08P79_STIAD          DQGYDRAFWTIFDSHVTALIAGFILFAT-G-------------TGPIRGFATTLIVGLIA
A9F8D1_SORC5          DIGYDKAFSAILDGHVTTLISGLILAQY-G-------------TGPIKGFAITLIVGIAI
Q6MKZ2_BDEBA          AEGYNRAMSAIIDANVTTAATAVVLLYF-G-------------TGPVRGFAVTLLIGIVT
E1X0T6_HALMS          ESGFESAFWTIIDANITTALAGFCLLNF-G-------------TGPIRGFAVTLLIGIFA
D0LJ86_HALO1          DAGFSRGFSAIFDGQITTAVAAYVLLQY-G-------------SGPIRGFAVMLIIGIGC
SECD_SYNFM            ETGYDRATLTILDANVTTIIAALVLLQF-G-------------TGPVRGFAVTLTVGLAA
Q2LVH4_SYNAS          EAGYSKAFLTILDSNVTTLVAALFLFGF-G-------------TGPIKGFAVTLTIGIVV
E1YHR5_9DELT          DAGFERATWTILDSNVTTLIAGLVLFQF-G-------------TGPVKGFAVTLSIGIVT
E1QIL8_DESB2          EAGYGRATMTILDANITTLIVALVLLQF-G-------------TGPVRGFAVTLSLGIAS
B8F9E3_DESAL          DSGFSKATITILDANVTTFVAAFVLLQF-G-------------TGPVKGFAVTLCFGIAA
SECD_THEYD            ETGYKKAFWTIFDSHVTTLITAAVLFHF-G-------------SGPIKGFAVTLSLGVAI
D8PI89_9BACT          DAGYDKALLTIVDSHVTTLITGFALFLF-G-------------TGPIKGFAVTLCLGIAI
B6ANM3_9BACT          DSGYDKAFLTIVDSHVTTLITALILFIF-G-------------TGPIKGFAVTLSVGIAI
B5ECA4_GEOBB          DAGYDKAFLTVMDSHVTTLITAAVLFQF-G-------------TGPVKGFAVSLSLGVII
Q3A3C4_PELCD          EAGYSKAFLTIMDANITTLIAALVLFQF-G-------------TGPVKGFAVTLSIGIAA
D5MHP3_9BACT          EGGYDKAFLTIIDSHVTTLITACALFLF-G-------------TGPVKGFAVTLSLGVIF
SECD_CALNY            EAGFEKAMSTIIDSNITTLIAGLVLFQF-G-------------TGPVKGFAVTLTIGILS
SECD_DESIS            EEGYAKAFSTILDANITTLIVAVILFQF-G-------------TGPIKGFAVTLSIGILA
C4XSM5_DESMR          DVGYSRATLTILDANVTTVIAAVVLYQF-G-------------TGPIRGFAVTLILGIVA
C7LN34_DESBD          NNGFSRATQTIIDSNVTTIIAAVILYQF-G-------------TGPVRGFAVTLTLGILA
Q1MSC1_LAWIP          IAGFDRASISIMDSNVTTIIAAAILYQF-G-------------TGPVRGFAVTLSLGIIA
SECD_MAGMM            DHGYSKAFSTILDANITTLITAVILYQF-G-------------TGPVRGFAVTLSVGLLA
SECD_RHOM4            DLGYSKAFSAIFDANITTFFTAAILYSF-G-------------VGPIQGFAVTLMAGIAA
D5HAA4_SALRM          NAGYEQSLSAILDANITTFFVGVILYSF-G-------------VGPIKGFAVTLMAGILA
B3EJI9_CHLPB          DTGYSKAFSAIVDSQITTLGAGFLLYIY-G-------------IGPIQGFALTLMIGIAA
Q3ANT9_CHLCH          AQGYDRAFSSILDSHVTTLAAGFLLYTY-G-------------IGPIQGFAVTLMIGTAA
B3QTH7_CHLT3          EIGYEKAFSAILDSHITTLGGAFLLYSF-G-------------IGPIQGFAVTLMIGTIA
B0VHR7_CLOAI          EAGFKRALVTVWDSNLTTVIAGIILYYL-G-------------TGPIRGFAVTLVIGIMG
SECD_ELUMP            DLGYTKAWSAIFDSNFTSWIVALFLFQF-G-------------SGPVKGFAVTLTLGLLI
SECD_UNCTG            DAGYQKVFWTIFDANFTTLIAALFLFQF-G-------------AGPIKGFAVTLSIGLIV
SECD_ACEP3            QTGFERATSTIVDSNATAFLAHVMLFVFG--------------TGPVRGFALTITIGIAT
Q0BS58_GRABC          EAGFKRAWATVLDSNMTALLAHVMLFVFG--------------TGPVRGFAVTITVGIAT
D3NUL2_AZOS1          EAGFSRAYSTIVDSNLTTAIKMALLFIFG--------------TGTIKGFAVTITFGILI
D8JWH1_HYPDA          DAGFQRAYVTILDSQLTTLACAIIMFWLG--------------SGPIRGFAVTLTIGILT
E3I016_RHOVT          EAGFDRAYATIIDSHLTALLAALILYAFG--------------SGTVKGFAVTLSFGIVS
E2CQN1_9RHOB          DAGYKRALGTILDANVTTLIAAVILFQLG--------------SGPVRGFAVTLAIGIFT
A7HXL0_PARL1          EAGYNRALSSILDANITTLISAAILFQMG--------------SGPVRGFAVTLGIGIIT
B0UI92_METS4          QAGFDRAFATIVDSNSTMAIAAIILFFMG--------------SGPVRGFAVVFILGILT
A7IND6_XANP2          DKGFVNALGTILDANVTSLATAVILFLMGG-------------SGPVRGFAVTYILGLLT
A4U1K0_9PROT          QVSFERAFGTILDANLTTLAAAALLFQFG--------------SGPVRGFAVTLSLGLLT
D5BQT5_PUNMI          DGGYQRAISTIVDSNLTTLFAASFLYIFG--------------SGPIKGFAVTLGIGIAT
Q9A6U2_CAUVC          DAGFSRAMTTIIDANVTTLVAAGIMFAFG--------------AGPVRGFAWTLSIGVFT
D9QLN2_BRESC          DAGFNKAMGTIIDANLTTLVAAAIMFIFG--------------AGPVRGFAWTLSIGVFT
Q5NL89_ZYMMO          DMGYKEASRTIFDANVTHAISALIMICFG--------------SGPVKGFAVVLLIGIIT
Q1GSE5_SPHAL          ELGYSEASRAIFDANITNVIAAGLMFWFG--------------SGPIKGFAVVLTIGIIT
SECD_RHOCB            ELGFDKAMSAIIDANVTSFLSSAILFVLG--------------AGPVRGFAVTTMIGIAA
Q0C0W6_HYPNA          QAGYERALITILDANITTLFAAVILYSLG--------------SGPVKGFAVTLALGIIT
C6XJ02_HIRBI          EIGYKQASSTILDANLTTLIAAAVLFWLG--------------SGPVKGFAVTLGIGVFT
Q0ANE6_MARMM          QAGYERALAAILDANITTFIAAAVLYMLG--------------AGPVRGFAVTLGIGIIT
Q2RTI1_RHORT          RAGFGKAFSAVLDANILTLGVGALLFWLG--------------GGPVRGFAVTLTLGAVS
SECD_ECOLI            DEGYRGAFSSIFDANITTLIKVIILYAV-G-------------TGAIKGFAITTGIGVAT
C4K8M1_HAMD5          HEGYKGAFSSIIDANITTLITAIILYAV-G-------------TGSIKGFAITTIIGVLT
SECD_HAEIN            NEGYNGAFTSIFDANLTTILTAIILYAV-G-------------TGPIQGFAITLSLGVAI
A1SWT8_PSYIN          HEGYSNAFSTIADANITTFITALILFAV-G-------------TGPIKGFAVTLAIGIAT
Q493H1_BLOPB          YTGYRKAFTSIVDANITTIITSIILYLI-G-------------TGPIKGFAITTIIGVGT
Q7VQA9_BLOFL          YIGYRKACTSIIDANITTIITAIILYIF-N-------------TGPIQGFAITTIIGVGT
B8GTQ2_THISH          ASGYDRAFSTIVDANITTLIAALVLFMF-G-------------TGPIKGFAITLSIGIVI
Q31FZ7_HYDCU          NAGYEKAFVTIADANITTLLAALVLFSF-G-------------TGPIKGFAITLSIGIIT
D0KW97_HALNC          KAGYERAFATIIDSHVTTLLAAIVLFAL-G-------------AGAVKGFAVTLTIGILA
Q60B03_METCA          HAGYERAFATILDSNVTTFVAGVALFLL-G-------------AGPVRGFALVLCIGILT
A1WXP8_HALHL          DAGYGKALSTIADANVTTLIAALVLFLF-G-------------TGPVQGFAVTLAIGLAT
D3RSH9_ALLVD          HAGYDKAFSTIVDANVTTLIAAVVLFSF-G-------------TGPVKGFAVTLFIGIVT
D0U555_9BACT          SAGYEKALLTIADANITTLIASIVLFSF-G-------------TGAIKGFAVTLSIGIIT
Q5ZU07_LEGPH          HAGYERAFSTILDANVTTLIVAIILFAV-G-------------TGPVRGFAVVLSLGLLT
A9KE82_COXBN          KAGYDRAFATIVDANVTTLIVMIILFAL-G-------------SGPVQGFAVTTTIGLLS
A0A0E1PNG4_ACIBA      VAGYDRAYNTIFDSNLTTFLVAFILFAI-G-------------TGPIKGFAVTLMIGIIC
Q0VS97_ALCBS          EEGYARAFTTILDANITTLIVAVILFAA-G-------------TGSVQGFAVTLFIGILT
A4GHV3_9BACT          DAGYNRAFLTIWDANVTTLIVAVILLSY-G-------------TGPVKGFAITLSIGIIT
A4GK28_9BACT          TSGYNRAFITIVDANLTTLIVALILYIV-G-------------TGPIQGFAITLSVGILT
Q1QTM7_CHRSD          HTGFERAFTSIVDANITTLLVAVILFSI-G-------------TGPVKGFAVTLSLGILT
A1TZN9_MARHV          NAGYGRAFVSIFDANITTLLVAVILFAM-G-------------SGPVKGFAVTLCIGILT
C3K1N2_PSEFS          NEGFGRAFTAILDSNLTTLLVGGILFAM-G-------------TGPVKGFAVTMSLGIFT
B8KXG6_9GAMM          HAGFERAVATILDANITTLIVAVILYAV-G-------------TGPIKGFAVTLSVGILT
Q21KW0_SACD2          NSGYDSAFSTILDANLTTFIVAIILYAI-G-------------SGPVKGFAVTLAIGIIT
B3PDJ8_CELJU          YAGYERAWITILDANLTTLIVGIILFAI-G-------------TGPVKGFAVTLMIGIAT
C7RB47_KANKD          DKGYSQALSTIADANITTAIAAIILYAV-G-------------TGPIKGFAITLFIGILT
B2FN02_STRMK          VTGYERASGTILDANLTGLIVGVALFAF-G-------------TGPLKGFALTMIIGIFA
A5EWX7_DICNV          RMGFNGALSSIVDANITTLIVGVLLFIF-G-------------AGPIKGFAVTLSVGIMT
Q145I2_PARXL          QNGYAHAWATILDSNVTTLIAGIALLAF-G-------------SGPVRGFAIVHCIGILT
D8INT3_HERSS          AAGFDRAWATILDSNVTTLIAGLALLIF-G-------------SGAIRGFAVVHCLGILT
E6UXK2_VARPE          HAGYERAWGTILDSNITTLIAGIALLAF-G-------------SGPVRGFAVVHCIGIVT
D6CKE5_THIA3          FHGYERAWATIFDSNVTTLIAGVALLIF-G-------------SGAIRGFAVVHVLGILT
E8UEP8_TAYEM          NIGFEKAWATIFDSNITSLIVGIALLAFSG-------------PGPIRGFAVVHVLGILT
E0XSS7_9PROT          SAGYDRAWATILDSNITTLIAGIALLVF-G-------------SGPIRGFAVVHVLGILT
D7N3K1_9NEIS          NLGYQHAWSTIVDSNLTSLIAGIALLIF-G-------------SGPVRGFAVVHCLGIVT
D7DM25_METV0          HAGYERAWDTILDSNVTTLIAGLALFMF-G-------------TGPIKGFAVVHVLGILT
Q0AG53_NITEC          HAGYERAWDAIIDTNLTTLLAGLGLMIF-G-------------SGPIKGFAVVLCLGILT
B6BWI8_9PROT          HLGYEKAWGTILDSNITTLIAGIALFMF-G-------------TGPIKGFAVVHVLGILT
B7J4R7_ACIF2          DAGFKKAFATIVDSNITVLIAALVLFQF-G-------------TGAIKGFALVLTIGVIT
Q0HXS6_SHESR          DTGFDSAFSTIFDANFTTMITAVVLYSI-G-------------NGPIQGFALTLGLGLLT
E1SV05_FERBD          HLGFDRALTTIWDANLTTMITALVLYSI-G-------------NGPIQGFALTLGLGLMT
B7VQL0_VIBTL          DRGFDSAFSSIFDANLTTMIVAIALYAI-G-------------NGPIQGFAITLGLGLLT
Q7MD23_VIBVY          DSGFDSAFATILDANITTMITAVVLYAI-G-------------NGPIQGFALTLGLGLLT
A1S8J5_SHEAM          DKGFASAFGTIVDANLTTMITALVLYAI-G-------------NGPIQGFALTLGLGLVT
A4SLM7_AERS4          DFGYRSAFRTIFDANITTLICAVVLYSI-G-------------SGPLQGFSITLILGLIS
Q15N36_PSEA6          ETGYKEAFATILDANVTTMITALILLSI-G-------------YGPVKGFAMTLSLGILT
Q3IL52_PSEHT          EQGYKQAFSTIFDANITTMITALILYGI-G-------------YGPVKGFAITLALGLVT
A8EY98_RICCK          RTGFASAFATILDSNLTTLIVASLLYIF-G-------------VGAIKGFAITLTIGIIS
B3CTC4_ORITI          REGFKLSFATIIDSNITTLLAAILLYIF-G-------------TGAVKGFAITLAIGILS
B9KH60_ANAMF          DKGFRNAMSTIFDSNITTLIVAAIMFIM-G-------------SVSVSGFAVTLGVGILC
A0A0H3M0Z2_EHRRW      ESGFKNAMSTIFDSNITTLIVAAIMFVM-G-------------SGPVSGFAITLSIGILC
B3CPT1_WOLPP          EEGFKNAIKTILDSNLTTLIASGIMFII-G-------------SGAIRGFSITLSIGVLC
Q2GDE0_NEOSM          MNGFEHAKATIFDANITTILAALMMIFI-G-------------SGPIRSFAVTLSLGIIT
D0RNY3_9PROT          DNGYKRVLTTLLDANITTLIAAIVLYFI-G-------------SGPVKGFAVTLAVGIIT
Q4FM00_PELUB          DTGYVKSKTAIIDANITTLIAAVILFFM-G-------------SGPVKGFSVTLAIGIFT
Q7VFM8_HELHP          EMGYANASRAIFDSNLTTLIAAVLLYAF-G-------------TGAIKGFAITMGIGITA
C5ZWZ2_9HELI          ENGYANASRAIFDSNLTSLIAAVLLYMF-G-------------TGAIKGFAITMSIGIIA
E7A9U3_HELFC          RSGYANASRAIFDSNLTSLIASFLLYAY-G-------------TGSIKGFALTTGIGILA
A0RNX0_CAMFF          EKGYKNAMSAIIDSNLTTLITSAALYAY-G-------------TGPVKGFAVTMSIGILA
C3XE91_9HELI          RIGYENASRAIFDANITSLIASVLLYVY-G-------------TGVIKGFAITTGIGILA
SECD_AQUAE            ELGFKRTLSAVWDTHVTLLVASVILFQF-G-------------SGPVKGFATTLALGTIA
D3DH34_HYDTT          ELGYRRSLSVVWDTHITLLIAALILFQF-G-------------SGPVKGFATTLTIGSIA
B4U9J1_HYDS0          EYGYKRVLSAVYDTHATLLVAALILFQF-S-------------SGPVKGFATTLTIGTIA
C1DVG5_SULAA          EEGFKKGFQAIFDSHVTVIIAALALLEF-G-------------NAPLKGFAATLSIGTFI
E8T6K3_THEA1          EAGFARAWGTILDSNVTTLIAAAVLFQF-G-------------TGPIKGFAVTLSLGIMT
SECD_KORVE            EQGFGHAWLTIIDTHVTTIVSAIILFLF-G-------------TGPVKGFAVTLSFGLFA
E8X5K0_GRATM          KEGFAHAWITIVDTHVTTIVSAAILFLF-G-------------TGPVKGFAVTLTFGLLA
C1F9I4_ACIC5          DQGFAHAWTTILDTHVTTVVSAAILFIF-G-------------TGAVRGFAVTLTFGLLA
Q029K4_SOLUE          DAGFGKAWWTIVDTHVTTVVSCAFLFLF-G-------------EGPVRGFAVTLTIGLIA
SECD_PETMO            KFGFNKVFSTIFDANITTILAGLVLFFVTS--------------GSIRGFAVTLIIGVLG
C5CF36_KOSOT          DSAFNKVFWTIFDANLTTILAGLVLLYFGT--------------GTVKGFAVTLIIGVLG
A6LP86_THEM4          STAFSKSFITLFDANLTTIIAGLFLYYFGT--------------GTVKGFAITLIIGVLG
A0A1Q6S007_9FIRM      ERGTKNSLSAIVDGNMTVIIVSIILMLVFGPANILSIIFGESTTGTIYSFGYTLLVGVIA
D3R265_MAGIU          ASGFDRAFSSILDGNVTVAISAVCLM-VFG-------------TGSMLSFGYSLLLGVIL
B8I6M6_RUMCH          DVGFKRAFSAVLDSNITTLISAVVLW-KFG-------------SGPIQSFAYTLGIGVVL
B0SPU4_LEPBP          TRGFENAFWTIMDANVTTLIAGILMIRLGN--------------GPIKGFAITLCWGIVT
SECD_TREPA            CSGFERAFWAIMDSNVTTFIAALFLSVLGT--------------GPIKGFAYSLAIGVVS
Q73PW4_TREDE          NAGFEHAFSAIMDSNITTFIAAFFLSILGT--------------GPIKGFAYSLAIGVVS
E1R5K7_SEDSS          KAGFRKAFWTIMDANITTFIAALVLSQLGS--------------GPVQGFANTLAVGIVS
E0RQA9_SPITD          KAGFSKAFWTIVDANVTTFIAAIFLSQVGR--------------GPIQGFAVTLAIGIVS
D5UAD5_BRAM5          ISGYDRAFATIFDSNITTIIVALILWIFGS--------------GPVQGFAITLFFGILI
SECD_LEPBD            ERGYENAFPAIIDGNITTLLVAAVLFFLGT--------------GPIKGFAVTLSLGVVA
SECD_SEBTE            DDGFNRAFPAILDGNITTLLITMVLFFFGT--------------GPVRGFAVILTIGVLV
A5TW61_FUSNP          ESGFGKGFVAIFDSNLTTLIITTILFVFGT--------------GPIKGFAVTLALGTLA
SECD_GEMAT            DEGFRHALGAIIDTSAATILSGMVLYQYGT--------------GPVRGFAVTLIAGLVA
B2A263_NATTJ          ESGFKKGIRTILDANITTLIAAAVLFYFGS--------------GPIRGFAVTLSTGIIA
SECD_ACIFV            NSGFSRAFTTILDSNVTTLMAAAVLFYLGT--------------GPIKGFAVTLALGVLI
D1BLM4_VEIPT          EAGFSRALATITDANVSVIITAGILTILGS--------------GPVKGFAISLGVGVVV
B8CXF7_HALOH          DAGFKRAFTTVIDANITTLITALILAYYTS--------------GTVRGFAVTLVIGVLT
D9QVJ1_ACEAZ          KSGFERAYKTIFDANVTTLITAGILAYFGT--------------GTIRGFAVTLSIGILA
D5XEJ6_THEPJ          ESGFSRAFWTVFDSNVTTLIAAAILYYFGT--------------GAIRGFAVTLSIGILA
Q2RHU6_MOOTA          DAGFKRAFTTIFDSNATTVLAAIVLYFLGS--------------GTVRGFAITLSLGIAA
Q3ABZ0_CARHZ          DAGFKRAFLTVFDSNATTLIAAVILYFLGT--------------GPIRGFAVTLSIGIIA
B0TF81_HELMI          EDGFQRAFTTILDSNVTTLISIVILYYLGT--------------GPIRGFAVTLGIGILT
C9R7V3_AMMDK          DHGFKYAFRAIFDANVTTVLGALVLYYFGT--------------GPIRGFALTLAVGVIA
B1I4K5_DESAP          DAGFKRAFVAILDANVTTLIAAVILYVFAP--------------VMIKGFALTLGIGILI
C8W4E1_DESAS          DAGFKRAVVTVVDANVTTLIAAAVLYYFGT--------------GPIKGFAVTLSVGILA
A4J544_DESRM          ESGFKRAFVAVLDSNVTTLIAAAVLFYFGS--------------GPIKSFAVALSVGILT
Q0AX22_SYNWW          EAGFNRAFWTIFDANLTTLIAAFVLLYFGS--------------GPIKGFAVTLSIGIIA
Q892A4_CLOTE          DAGFNRALTSIMDSNITTIIAAIVLYNLGT--------------GAVKGFALTLMIGIVL
D9SMV2_CLOC7          EIGYKSSLSSILDSQITTIIAAVILYFLGS--------------GAVKGFAYTLILGIVI
Q67LL8_SYMTH          DAGFHRAYVTVLDSQITTAIAAAILWYLGT--------------GPVRGFAVTLFVGTVL
D9TNU7_THETC          DAGFRKAFVAVFDSNITTLIAAFVLFFMGA--------------GTVKGFALTLIIGVIS
A4XIR1_CALS8          DAGFRRALNAVIDSNITTIIAGLVLLFLGT--------------GPIKGFAWTLTIGIVV
E3GFZ5_9FIRM          DAGFKRAMGTIIDSNVTTLIAGFVLFFMGS--------------GSVQGFAVTLILGIIV
D9RXQ2_THEOJ          DSGFYRALTTIIDSNLTTIIAALVLFYFGT--------------GPIKGFAVTLIIGNIA
E3PRC6_ACESD          DSGFQKAMSTIIDSQITTFIAGVVLYNFGT--------------GSIKGFAITLMIGIMA
A6TQN4_ALKMQ          DSGFNRAFKAIIDSNITTLIAGVVLYQFGT--------------GPIRGFAVMLIIGIVA
D4M8M0_9BACT          DAGFRKALVTILDSNITTLIAALVLFHFGS--------------GSVRGFGVTLSIGLVA
E6SLR2_THEM7          DAGFRNAFSAILDSNLTTLIAAAVLYGLGT--------------GPVRGFAVTLAVGVVA
SECD_DICTD            DAGFRNALRAIIDSNVTTILAALILFYFGT--------------GPIRGFAVTLSLGVAL
SECD_DEHMV            EAGFSRAWSAIWDSNVTTFIACGILFWVGGTIAAG---------APVKGFAVTLFLGVAV
B3T9T5_9ZZZZ          RIGFQRAWSSIRDGNISTLIIAFIIYWFGNQFAA----------STVTSFAVTLIVGVFL
SECD_THET1            DVGFKNAWPSIRDSNISTLITCAILIWFGSRFGA----------SVIKGFAITLAIGVIV
B9KYU6_THERP          EEGFNHAWPSIRDSNISTMISCMILFWFGRYVGA----------TIIQGFALTLFIGVAV
A9B5U9_HERA2          EDGFNHAWPSIRDSNASTLITSFILYVLGNGLGV----------SIIQGFALTLALGIIV
A7NP80_ROSCS          DAAFVEAWPAIRDSSVATLITCTILFMFGNTFGV----------SLIKGFALTLGLGIVL
SECD_ANATU            DLAWKRALPSIRDSNIATLITVVILFIFGSQFGA----------TIVKGFAFTLGVGIFV
SECD_PROMA            ETGFSQAFSSIIDGHITTLISCISLFYLGTGFVK--------------GFAATLGIGVFI
B5IKE7_9CYAN          DTGFNLAFSSILDGQLTTLISCVALFALGTGFVK--------------GFAVTLGIGVLL
B4WJX6_SYNS7          ESGFYRAFSSILDSNVTTLIACGALFFLGTGLVR--------------GFALTLAIGVLV
D3EPH0_ATETH          ESGFYRAFSSILDSNITTLIACGALFSLGSGLVK--------------GFALTLAIGVLI
SECD_ACAM1            ESGFYRAFTSILDSNVTTLIACGVLYWLGSGLVR--------------GFAVTLGIGVAV
Q2JY13_SYNJA          SEGFNRAFSSILDSNVTTLLVCGVLFWLGMGLVK--------------GFAVTLAIGILV
Q7NDR6_GLOVI          EAGFSRAFTSIFDSHATSLISCAVLFWLGTGLVK--------------GFALTLAIGLIV
Q1AWD0_RUBXD          QVGYQKGFRAILDGNITTLITAFILFAMAS--------------AQVRGFAVLLAIGVVL
A0QWJ2_MYCS2          PRGWVRARKTIVSGNAVTFLAAAVLYVLAI--------------GQVKGFAFTLGLTTIL
A0A0H3MPV3_MYCLB      PRGWVRARKTIVSGNAVTFLAAAVLHFLAI--------------GQVKGFAFTLGLTTIL
C0ZZ50_RHOE4          PRGWARARRTILSGNAVSFIAAAVLYVLAV--------------GQVRGFAFTLGLTTIL
D0LCM8_GORB4          PRGWASARRTIWSGNAVSFIAAAVIYILAV--------------GEVRGFAFTLGLTTIL
D5UNI7_TSUPD          PRGWASARRTIWTGNAVSLLSAVVLYILAV--------------GDVRGFAFTLGLSTVL
D9UX19_9ACTN          PRGWARARRTILASDAVSFLAAAILYIIAV--------------GDVQGFAFTLGMSTVL
C7MQZ9_SACVD          PRGWVKARRTILASDAIMFLAAGVLYVLAV--------------GEVKGFAFTLGMSTVL
A4FBB0_SACEN          PRAWERAKRTILSADAVSFLAAAVLYVLAV--------------GQVKGFAFTLGMSTVL
C6WCM7_ACTMD          PRAWVRSRRTILSADAVSFLCAMILYVIAV--------------GQVKGFAFTLGVSTVL
C8XE16_NAKMY          PRGWSRAKRTILSADAVSFLSAFILYILAV--------------GEVKGFAFTLGLSTVL
D2S9I0_GEOOG          PRAWVRARRTILSADAVSFLAAAILYVLAI--------------GDVKGFAFTLGMSTVL
Q4JVE1_CORJK          PRAWQRARSTIVTGNIVSLIAAVILYFLAV--------------GDVKGFAFTLGLTTVF
C4LIX5_CORK4          PKAWERARRTILSGNLVSLIAAVVLYILAV--------------GDVKGFAFTLGLTTVF
Q8NPZ9_CORGL          PRAWESAKRTIVTGNMVTLLGAIVIYLLAV--------------GEVKGFAFTLGLTTVF
D7BNQ2_ARCHD          EHGWERARRTIIISDVVNLVAASVLFILTV--------------GSVRGFAFTLGVTTVL
D6ZHF4_MOBCV          ETGWNRAKRTIVVSDIVNIVAAVVLYVLAV--------------GGVQGFAFTLGLTTLV
B2GIL6_KOCRD          DHGWQRARQTVLASKAVNLLAAVVLYFVAV--------------GNVRGFAFTLGLTAIA
A9WSE2_RENSM          ENGWKRAKRTVLASKAVNLLAAVVLYFVAV--------------GNVRGFAFTLGLTAIA
E1VWF6_GLUAR          DVGWKRAKRTILASKAVNVLAAVVLYIVAV--------------GNVRGFAFTLGLTAII
C5CCH9_MICLC          HEGWKRARRTITASKAVNLLAAVVLYFVAV--------------GNVRGFAFTLGLTAIA
B0REC2_CLAMS          EQGWKRALRTIIASDTVNFLAAAVLFILAV--------------GNVKGFALTLGLTTII
E8NFI9_MICTS          EDGWSRAKRTIYISKSINILAAVVLYILAD--------------ATVKGFAFTLGLTTAI
D5UEN5_CELFN          EKGWERARRTILASDAVNFTAAIVLYLLAV--------------GGVRGFAFTLGLTTLV
D1BGW2_SANKS          DTGWDRARRTIVASDTVNFLAAVVLYFLAV--------------GGVRGFAFTLGLTTLV
C5C5R0_BEUC1          EQGWLRARRTILASDAVNFLAAVVLYFLAV--------------GGVRGFAFTLGLTTLV
C7R4G5_JONDD          EVGWDRAKRTIIASDAVNFIAAVVLYFLAV--------------GGVRGFAFTLGLTTLI
D1BSK1_XYLCX          QHGWQRARRTIYAAKAVNLISAVILYFLAV--------------GGVQGFAFTLGLTTVI
Q83MZ7_TROWT          DRGWSRALRTICASDAVNFLAAIVLFLVAV--------------GSVKGFAFTLGLTTLV
A6WCH6_KINRD          EAGWHRARRTILVSDAVSLLSAVVLYVLAV--------------GNVRGFAYTLGITTII
E6SB77_INTC7          ETGWKRARRTIIAADAVNLLAAVVLYVLAS--------------ANVRGFAFTLGLTTLI
C7NI44_KYTSD          DTAWVRARRTILISDAVNLLAAVILYLLSE--------------ANVKAFAFMLGLTTII
C7MCC2_BRAFD          DHGWDRAKRTILASDAVNLIAAVVLYLLST--------------GGVRGFAFVLGLTTVL
D6Y2C4_THEBD          EVAWRRARRTILIADTVMFIAAVVLYVLAV--------------GGVAGFAFAMGLTTLI
D2AWR2_STRRD          EVAWVRARRTILIADAVMFIAAVVLYFLAV--------------GGVAGFAFAMGLTTLI
D1AEV4_THECD          ESAWVRARRTILVADAVMFIGAAVLYVLAV--------------GGVKGFAFAIGLTTLI
A0LUK3_ACIC1          EKGWLQARRTIVSADLVSLIAAIILYWLAV--------------GDVRGFAFTLGLSTIV
A8KZE4_FRASN          ERAWPAARRTMLSADTVSFLAAAVLYVLSV--------------GSVRGFAFTLGLSTLI
Q2JD92_FRACC          DRAWPAARRTMLSADTVSFLAAAVLYILSI--------------GSVRGFAFTLGLSTLS
E2PV76_STRC2          ERAWPRARRTILVSDFVSFLAAAVLFIVTV--------------GKVQGFAFTLGLTTLL
E4N7T8_KITSK          QRAWPRARRTILVSDFVSFLCAAVLYLVSV--------------GKVQGFAFTLGLTTLL
C7QJQ1_CATAD          DHGWVRARRTIISSDFVSFLAAFVLYEVSI--------------GTVKGFAFTLGLTTLL
D7GDS9_PROFC          QSGWNKARGTIVMADSVQLLSAVVLFILAI--------------GAVKGFAFTLGVTTAI
Q6A8K5_CUTAK          QTGWAKARGTILMADGVSLLSAIVLFVLSV--------------DQVKGFAFTLGLTTVI
D2PVF3_KRIFD          ETGWARAKHTIIAADSISLLAAIVLYVLAV--------------GGVKGFAFTLGLTTLI
A1SJA9_NOCSJ          QAGWKRARGTCVAADTVSLLAAIVLYIFAT--------------GVVKGFAFTLGISTVI
C4RGU0_MICS3          PRAWIRARRTIISANAITILSAVVLYIVSV--------------GAVKGFAFALGLATVL
A4X5X5_SALTO          SRAWIRARRTIISANAITLMSAVVLYIVSV--------------GVVKGFAFALGLATVL
D3PYP7_STANL          PRAWTRARRTILSANTVQIIGALVLYFVAI--------------GAIKGFAFTLGLSTLF
E1QZN3_OLSUV          VSGAKHGITTSLDADAVTLVTALALFFVAV--------------GSVKGFGLTLALGIVC
C7LYS6_ACIFD          KAGFQKAFRTIIAADLVSFIGAALLWYFSI--------------GQVRGFAFFLGLATVA
                        .                     :                       .*.         

B1YJQ7_EXIS2          TFVTNVFISRYLMQLLVSSRWFDKKKTWFGVKESEIREL---------------------
D6XWY8_BACIE          SFLTAVLGARLFLGLWVNSRILNGKQKLFGVKEDQISEL---------------------
E3E8W8_PAEPS          SILTNIFFSRFLLNLLVKADAV-KKAKYFGVKESDISAL---------------------
C0ZAP6_BREBN          SIITNVFGSRFLLWLVVRSNMF-KKPFWFGVKESEIREL---------------------
SECD_ALIAD            SLLTAVLFARAMLLTFTAAQAV-KNPWWYGAPRGVVKSREAKV-----------------
SECD_ANADE            SMFTSIVVTRVIMEYFTRHDT-ARLSV---------------------------------
Q08P79_STIAD          SLYTSIVVTRTITTYFVHGRN-AQTVSV--------------------------------
A9F8D1_SORC5          SLFTGVVCTRLMFDWAVRGRK-IKTLSLG-------------------------------
Q6MKZ2_BDEBA          SMFANVFVSKVIVDTLVNKFN-LKKLSV--------------------------------
E1X0T6_HALMS          TVYTAYFAGKLLFEFYMDKVQ-GEDLSI--------------------------------
D0LJ86_HALO1          TLFTATWCTRLFFEYYVGKGRKVEQLSI--------------------------------
SECD_SYNFM            NMFTAIFVTRVIFDYLLVQRR-IKTLSI--------------------------------
Q2LVH4_SYNAS          SMFTAIFVTRIIFDYFVWNRR-IKSISI--------------------------------
E1YHR5_9DELT          TVFTALIMTRVIFEYFIYDRK-IKKLSI--------------------------------
E1QIL8_DESB2          SLFTAITLTRVVFDWILRKYQ-PKKLSI--------------------------------
B8F9E3_DESAL          SMFTAIVVSRLIFDYFLYYRN-VRKLSI--------------------------------
SECD_THEYD            NLFTALIGTKTVFDFIYIGKE-RKSLSI--------------------------------
D8PI89_9BACT          NLFTALVGTKVVFDLFNQRRK-IEQLSI--------------------------------
B6ANM3_9BACT          NLFTALVGTRVVFDAMTARKK-LDRLSI--------------------------------
B5ECA4_GEOBB          NLFTTLVTTKVVFDSAFSRFQ-IRRLSI--------------------------------
Q3A3C4_PELCD          SLFTAIFVSRVIFDFFLERYQ-VKRLSI--------------------------------
D5MHP3_9BACT          NLVTALTGTRVVYDWMTQRWN-LKTLSI--------------------------------
SECD_CALNY            SIFTAVTLSKTIFLTLYGNKE-IKKLSV--------------------------------
SECD_DESIS            SMFTAILCTRAIYELILVYKP-IRKLSI--------------------------------
C4XSM5_DESMR          SMFTAIFFTRFLFDLWLSKRPAEASLRI--------------------------------
C7LN34_DESBD          SMFTAIFVSRIFFDSWLARRQPGTQPSI--------------------------------
Q1MSC1_LAWIP          SMFTAIFVSYTCFLLWLRKSK-KKTLSV--------------------------------
SECD_MAGMM            SMFTAIFVTRVVLAEVVKNRR-LKTLSI--------------------------------
SECD_RHOM4            SLFSAIVITRIIFDYLVL-ERKLMVSVG--------------------------------
D5HAA4_SALRM          SLFTAIIVTRIIFDYMVE-DRRMQVSYG--------------------------------
B3EJI9_CHLPB          SLFTALVVTKVIFDLLIDRNLMTAKSFG--------------------------------
Q3ANT9_CHLCH          SLFTAIVVTREIFNFMLFKEKLSTKSFG--------------------------------
B3QTH7_CHLT3          SLFTAVVITKVIIDWMIEQDKVQDTTFG--------------------------------
B0VHR7_CLOAI          SMFTAIVVVRSILDNIVLTGKRTKLSV---------------------------------
SECD_ELUMP            GVFTSVFVTRAIYDLLLTANPK-DISL---------------------------------
SECD_UNCTG            SMFTAVTVTKLIYEFLFKKNLLLKIKI---------------------------------
SECD_ACEP3            TLFTTLLLSRMLMARWYA--RTRPASLPV-------------------------------
Q0BS58_GRABC          TLFTNFMLARLLMVKWFA--RNRPAELPV-------------------------------
D3NUL2_AZOS1          SMFTATVLVRLMMVTWLR--RTRPAALPV-------------------------------
D8JWH1_HYPDA          SIFASVTVVRLLISYWLRA-QPKGRAIYVPV-----------------------------
E3I016_RHOVT          SLFTAITLTRLMVSTWLR--QTRPTALHI-------------------------------
E2CQN1_9RHOB          TVFSAFTFSRLLVALWVR--TARPTKLPI-------------------------------
A7HXL0_PARL1          SVFTAFTVNRLMVSVWLR--RRRPKTLYL-------------------------------
B0UI92_METS4          TVITAVTLTRMMIAVWYH--RFRPKVLPI-------------------------------
A7IND6_XANP2          TMFTAYTLTRLMIAYWVK--WRRPAKLPI-------------------------------
A4U1K0_9PROT          SMFTAIMVTRLMVATWVR--LRRPKTLPL-------------------------------
D5BQT5_PUNMI          SMFTAVMVTRLFIVLWLE--RKKPNELVL-------------------------------
Q9A6U2_CAUVC          SVFTAVLVSQLLIGWWFR--AARPKKLPI-------------------------------
D9QLN2_BRESC          SVFSSVLVAQVLLAYWLK--TTKSKTLPIAESVR--------------------------
Q5NL89_ZYMMO          SVFTAVTFTRMLVALYLRR---RPAKLTI-------------------------------
Q1GSE5_SPHAL          SVFTAVTVTRLFAARWLHK-T-RPASLNI-------------------------------
SECD_RHOCB            SIFTAIWVVRLMIVIWYG--WRRPKTIVI-------------------------------
Q0C0W6_HYPNA          SVFTAFVFTRMLTIFWMK--TFKTKRFAI-------------------------------
C6XJ02_HIRBI          SVFTAFVLTRMFMADWVR--TVRPKKLPV-------------------------------
Q0ANE6_MARMM          SVFTAFVVSRLLAVLWLR--AFKPKKLPL-------------------------------
Q2RTI1_RHORT          ALFTAMLLNRLIVALWLR--LARPKTIPL-------------------------------
SECD_ECOLI            SMFTAIVGTRAIVNLLYGGKR--VKKLSI-------------------------------
C4K8M1_HAMD5          SMFTAILGTRAIVNMLYGAKR--IEKLSI-------------------------------
SECD_HAEIN            SMFTAITGTRALVNALYGGKQ--LKKLLI-------------------------------
A1SWT8_PSYIN          SMFTSIFGTRAIVNAVWGGRND-IKKLSI-------------------------------
Q493H1_BLOPB          SMFTSIVGTRAVVNLVYGKRR--INKLSI-------------------------------
Q7VQA9_BLOFL          SMFTSIIGTRALVNLVYGKKR--TKYLSI-------------------------------
B8GTQ2_THISH          SMFTAILVTRAIINLIYGR-RRRIKALAI-------------------------------
Q31FZ7_HYDCU          SMFTAILGTRAIVNALYGN-KP-VEKLSV-------------------------------
D0KW97_HALNC          SLFTAIMVTRALVNLIYGR-RVRLNKISI-------------------------------
Q60B03_METCA          SMFSAVLVSRALVNFTYGR-QRKLVKIAV-------------------------------
A1WXP8_HALHL          SMFTAIVGTRAVINLIYGG-RK-VSELKI-------------------------------
D3RSH9_ALLVD          SMFTAILGSRALINLIYGG-RR-LNKLAI-------------------------------
D0U555_9BACT          SMFTAIIVSRAVINIIYGG-KK-IEELAI-------------------------------
Q5ZU07_LEGPH          SMLTGITYTRAIVNWYYGG-RN-VKKLSIGI-----------------------------
A9KE82_COXBN          SMVTAIFFTRAVVNLVYGR-RR-ASRLSIGINAKSAEAKK--------------------
A0A0E1PNG4_ACIBA      SMFTAITVTRAIVQIIYGK-RRNLKKLSI-------------------------------
Q0VS97_ALCBS          SMFTAIIGTRAMAEMIYGRGARAPSKLSI-------------------------------
A4GHV3_9BACT          SMFTAIMGTRAFVNLIYGS-RKNLERISI-------------------------------
A4GK28_9BACT          SMFTAILFTRMLVFFIYAR-RRNIEKIWI-------------------------------
Q1QTM7_CHRSD          SMFTAIMVSRAMINLTIGG-R-PLKKIWI-------------------------------
A1TZN9_MARHV          SMFSGLMVSRGIVNLVYGG-R-RVEKLSIGGKLENA------------------------
C3K1N2_PSEFS          SMFTAIMVTRAMVNLIFGG-R-DFKKLWI-------------------------------
B8KXG6_9GAMM          SMFTAILGTRAIINLIYGG-R-RVDKLSIGPLPKSRQTSDDARGEPA-------------
Q21KW0_SACD2          SMFTAIVGTRALVNLAFGG-R-NVKKLWI-------------------------------
B3PDJ8_CELJU          SMYTSVTCSRALANLVYGS-RKNLKKISI-------------------------------
C7RB47_KANKD          SMFTAILVSRGIINLIYGR-GKKPSKLWI-------------------------------
B2FN02_STRMK          SMFTAITVSRALATLIYGR-RKKLQNVAI-------------------------------
A5EWX7_DICNV          SMFTAVYVTRALTEFFLLRQAQPTIKL---------------------------------
Q145I2_PARXL          SMFSAVFFSRGIVNLWYGG-KKKLKSLAIGQVWRPDTAPAGSAAYLGSEDASTDTAQAVA
D8INT3_HERSS          SMFSAVFFSRGVVNLWYGR-KKRLSSLAIGQIWKPE-----------------------G
E6UXK2_VARPE          SMFSAVFFSRGLVNFWYGQ-KKKLKSVSIGTVWRPKT----------------------D
D6CKE5_THIA3          SMFSAVFFSRGIINLWYGR-KRRLHSISIGQIWKPQA----------------------A
E8UEP8_TAYEM          SMFSAVVGVRALVNLWYGR-KKKLKNISIGTVWKPKT----------------------S
E0XSS7_9PROT          SMFSSVFFSRGLVNIWYGS-RKKIPHLKIG------------------------------
D7N3K1_9NEIS          SMYSSVVVSRALVNLWYGR-RRKLQTISIGTVWKPET----------------------A
D7DM25_METV0          SMFSAVLVSRAIVNLIYGY-RRKLTKLSIGQIYKG-------------------------
Q0AG53_NITEC          TLFSAVTVSRAMVNLLYG--NRKLARVPIGTIKISKKSSNKH------------------
B6BWI8_9PROT          SMFSAILVSRALVNFFYGS-KRKIDKLNIGEIYKVNN-----------------------
B7J4R7_ACIF2          SMFTATMMSRGIIELALGK--RRVQKLYI-------------------------------
Q0HXS6_SHESR          SMFTGIFASRALINLVYGRDARRHVRV---------------------------------
E1SV05_FERBD          SLFTGVFLSRALINLVWGQDTRRKVTI---------------------------------
B7VQL0_VIBTL          SLFTGVFASRILINYLWGRDTSHEVKL---------------------------------
Q7MD23_VIBVY          SMFTGVFASRAMINLVWGKDSRRNVRV---------------------------------
A1S8J5_SHEAM          SMITGIFMSRLIINWVYGRDERKAVRI---------------------------------
A4SLM7_AERS4          SMVTGIWGTRAIINPLWGKSSAKLLRV---------------------------------
Q15N36_PSEA6          SMFTGVFVAHVLTSLVKPQIAIKQKELRS-------------------------------
Q3IL52_PSEHT          SMFTGVYVSKVLSQSLYLKLGKKSGVSTDA------------------------------
A8EY98_RICCK          SMFSAIIITKLLIDIWVKYFKSKKLGLV--------------------------------
B3CTC4_ORITI          SMYSATIITRLLIDSWVKYKLPIKLNTTTICKR---------------------------
B9KH60_ANAMF          SMLSAVVLTKVLIDVWVHTTKGLQMV----------------------------------
A0A0H3M0Z2_EHRRW      SMFSAITLTKMLIDLYIRFFNLKVLNI---------------------------------
B3CPT1_WOLPP          SMFSAIIVTKLLIELCINPQKLVL------------------------------------
Q2GDE0_NEOSM          SVFSSIFVTRVLLEVFVLPKKPSR------------------------------------
D0RNY3_9PROT          SLFTTFILGRLFVASYVKSKKGGVIKI---------------------------------
Q4FM00_PELUB          TLFSVYFIARMLTGLYVVRNKEKTELI---------------------------------
Q7VFM8_HELHP          SILTAIVGTHGIYQAIMQRIIKSGNVNLWFGIKLPLDTTESAKQQDTKLNKG--------
C5ZWZ2_9HELI          SVITAIVGTHGIFRLLQDRIIKSGNYSLWFGYKKRGA-----------------------
E7A9U3_HELFC          SILTAIIGTQGFYQAIAPKLSKKKGLYFWFGISLNTHPKSPKKVTHGAL-----------
A0RNX0_CAMFF          SMLTAILGTHGMFEFLGKKIENNKNSVLWFGYKIRKVA----------------------
C3XE91_9HELI          SIVTAIIGTHGIYLWLGNRIERSKNLAFWFGIKLDSKTEVAAKQKR--------------
SECD_AQUAE            SFISNVYYAKVFLDL--LNSLKILKI----------------------------------
D3DH34_HYDTT          SFVSNVYFTKFFLDV--LTKIGALKI----------------------------------
B4U9J1_HYDS0          SFLSNVYYSKVMIDI--LAKLRMLKI----------------------------------
C1DVG5_SULAA          NLFTAVFLTKMMLDFT-IGGKKYLKYAI--------------------------------
E8T6K3_THEA1          SMFTAVFVTKVLLDLIVKYKPKLFKI----------------------------------
SECD_KORVE            NLFTAVFVSRVIFDSILNRHQRGEALSI--------------------------------
E8X5K0_GRATM          NLFTAVYVSRLIFDAHLKGKERGTALSI--------------------------------
C1F9I4_ACIC5          NLFTAVFVSRVIFEANLNRKQRGEAISI--------------------------------
Q029K4_SOLUE          NIFTAVFVSKTIFDYELSGRRQLTELSI--------------------------------
SECD_PETMO            AMFTNLVVSRLLLESTSHFLKPEKYVKGIVVEKGGTK-----------------------
C5CF36_KOSOT          AMFTNLVASRTMLVGMAGSINAARYVKATGGEGSDKR-----------------------
A6LP86_THEM4          SLFVNLVVSRFFLDLFSSGIKVRRTSKGGARA----------------------------
A0A1Q6S007_9FIRM      NFIMGVFCTRIMLRSVAGFKFLRKKWLFGGAKND--------------------------
D3R265_MAGIU          NLICGATASHLMVSSLAAFKQLRNTWLYGDYSAKQKARKEGGAL----------------
B8I6M6_RUMCH          SFLTAVTASRIMLQSIQDLEVAKHHWLYGVSMRGGKANG---------------------
B0SPU4_LEPBP          TLFTSLFLSRLFMELTVNRFGVHHLNLRPFFFGKKEGKHV--------------------
SECD_TREPA            SVFTALFVSRLMFDYGTEVLHKKTVRIGWRIARV--------------------------
Q73PW4_TREDE          SVFTALFVSRLIFDFGTQTLKLEKIHISWRKL----------------------------
E1R5K7_SEDSS          SMFTALFVSRLIFDFGIEQLKVKKLSIGWRIR----------------------------
E0RQA9_SPITD          SMFTALVVSRLIFDYLVDQRKVKKLSISWRL-----------------------------
D5UAD5_BRAM5          NLFTAVFITRYIYEELIRTKMVKKAGFFFI------------------------------
SECD_LEPBD            TIITGVFVSKVILKLFIKTFNIKREQLFWKGALNED------------------------
SECD_SEBTE            SMFTAIFITKIIVKIFVNIFHLNGEKLFGLKGVE--------------------------
A5TW61_FUSNP          SMFTAITATKVLLLTFVNIFGFRSPKLFGVTEGEVIK-----------------------
SECD_GEMAT            ALFTTIFVTKTFFLVWLNRSRGTQTLSI--------------------------------
B2A263_NATTJ          SMITAVLFTRVILKLLVSSRLIRDTKYFGIQRG---------------------------
SECD_ACIFV            SMFTAVTVTKFILGALIGSNFTKNPAWFGAKAFQPKAKDG------KGEAAR--------
D1BLM4_VEIPT          SMFTAITVSHFLLRLLIDCNFTNHPFWFGANISPSTSADAFAPKSLKGGKRK--------
B8CXF7_HALOH          SMFTAFYVTRNIINLFTNTKLLKSSAAFSVKRGL--------------------------
D9QVJ1_ACEAZ          SMFTAIVVTRTLVDLLLDANLLKGQNAFGRVRR---------------------------
D5XEJ6_THEPJ          SMFTAITLTRFMLRNLADSKLITNKKLYGA------------------------------
Q2RHU6_MOOTA          SMFTAITLTRFLLHLVVGVPAFHNLWLFGVKEEQIPAAARGEI-----------------
Q3ABZ0_CARHZ          SMFTAITFTRWLLFLAADSKVVKNPKLYGA------------------------------
B0TF81_HELMI          SMFTALSFTRMMLRSAGGSGLFNNKKLYGA------------------------------
C9R7V3_AMMDK          SFLTAVTMTRWLLRLVLDTGLIKNPKLYGA------------------------------
B1I4K5_DESAP          SMFTGLVLTKWMLHLLAGSGMVNSPRLYLK------------------------------
C8W4E1_DESAS          SMFTAISLTRYMLQLTASSNLVKNTKMYGA------------------------------
A4J544_DESRM          SMFTAITFTRWVLHLTASTG-IKNTKLYGAQGR---------------------------
Q0AX22_SYNWW          SMLVVLTFTRYLLVLS--ADLTKNHKLYGV------------------------------
Q892A4_CLOTE          SMLTAVIVTRQLLKLAVNAGLLNSLAAFGAKRRVE-------------------------
D9SMV2_CLOC7          SLFTALTVTLRLLRWLNDMGWITKPSHVGVKGEQ--------------------------
Q67LL8_SYMTH          SIFTAITFTRWLVKLAVDTGWFNKRTLFGVKEVAN-------------------------
D9TNU7_THETC          SMFTAITVSRFLLKSVVDTEFTKNIRVYGA------------------------------
A4XIR1_CALS8          SFFTAITVTRFLLVSIINTGFFKDMRWYGGKKTREVRA----------------------
E3GFZ5_9FIRM          SLLTAVIITKHLTKLVIGTHLFGSGKFYGI------------------------------
D9RXQ2_THEOJ          SLFTAIVVTRILLVNLINTRLITNKKLFSA------------------------------
E3PRC6_ACESD          SMFSAIIITRFLLKSVIGISNIKNTKFFGV------------------------------
A6TQN4_ALKMQ          SMFTAVVVTKFLLKLLVAMNITKNKKLFGA------------------------------
D4M8M0_9BACT          SVFANVVVTRALLQLFVSR---RQNALKRS------------------------------
E6SLR2_THEM7          SMFTAITLTRFFLRNLVDAELFRQPARLFGVRGEAR------------------------
SECD_DICTD            SMFTQITITRTLLENLLSLPVFKKATKLLGL-----------------------------
SECD_DEHMV            SMFTAIFVTRTLLRLFVGTKTGKKLALFTTQTRGKNE-----------------------
B3T9T5_9ZZZZ          SMFTAIFITRNLLQLLAVTAMRRMPGLFTPEPLPKREEGSPRPRPASEQGA---------
SECD_THET1            SMFTAIFVTRTLLQVVLSMVHTRNLWIWGIGKNQLPEPEGRTLQPAKSSRTTQA------
B9KYU6_THERP          SMFTAIVVTRTLLRLLLTRHLFRDVRWFGIS------PSQVAMAPARGD-----------
A9B5U9_HERA2          SLFTAITVSRMLLRLTIDLGVSNPRWFGVNP-------EEDAAEVAALSSEQA-------
A7NP80_ROSCS          SLFTSMVVTRTFLHTINPLPFAQNPWLYELK-------DAPGMRHAREVA----------
SECD_ANATU            SLFCAMVVTRTFMYILVDRMKPQAKHLKWFG----------ILD----------------
SECD_PROMA            SLFTALSCTRVLLRFFM-SYKSLRKTTNFLS---------ENQLPKQLT-----------
B5IKE7_9CYAN          SLFSALTCTRTLLRLLM-SYPALRQPTYFLP---------RVQLPAASS-----------
B4WJX6_SYNS7          SMFTAVSCSRTLLFFAI-GFPQFRK-PGLFC---------PGIETLPKVTSSATQ-----
D3EPH0_ATETH          SMFTALTCTRTLLLTTVLKFSIVRKNPAIFC---------PNLFTTSKF-----------
SECD_ACAM1            SMFTAITCSRTLMFTAI-SLPNLRK-IELFD---------SKRAVS--------------
Q2JY13_SYNJA          SFFTAITCTRTLLLAAM-GIPALRK-PEFYG---------VRMEAAQS------------
Q7NDR6_GLOVI          NLFTSVTCSRTFLLTIL-NFPALRK-PALFG---------VSDVPAKAVRP---------
Q1AWD0_RUBXD          SMFTAVVVTRALLGLLSSRGIHLSPAMMGVSKKSLAGAR---------------------
A0QWJ2_MYCS2          DLVVVFLVTWPLVYLAS--KSPTMAKPKLNGLGAVQ---------QIARERREVSHATAG
A0A0H3MPV3_MYCLB      DLVVVFLVTWPLVYLAS--KSPLLARPAYNGLGAVQ---------QVARERR--ASAKTG
C0ZZ50_RHOE4          DVIVVFLVTWPLVSMAS--RSAFWSKPSVNGLGAVQ---------EVARERKVAAAASAK
D0LCM8_GORB4          DVVVVFLVTHPLVVYAS--RSTFLSRPSVNGLGAVA---------EVARQRRVATRATTT
D5UNI7_TSUPD          DVVIVFLVTHPLVVLAS--RTDFFAKPSMNGLGAVA---------AIGRERRRAVANTGA
D9UX19_9ACTN          DLVVVYLVTHPLVAMVSTSKSKFLSNPRNLGLGAVQ---------KLGSQRKSTRPAPGR
C7MQZ9_SACVD          DLIVVFLVTHPLVVVVSRSKK--LSSPRLSGLGAVQ---------RIGDSRR-----AAV
A4FBB0_SACEN          DLVVVFLVTHPLVALAS--KNKFLSKPAFSGLGAVQ---------RMGAQHRADR-KRAA
C6WCM7_ACTMD          DLIVVFLVTHPLVAIISKSKTKFLNNPKVIGLGDVA---------HAAHLKAP----KST
C8XE16_NAKMY          DLVVVFLVTHPLVHLAA--GSRLFQSPTWSGLGGVA--------KAGARQR---AAAARL
D2S9I0_GEOOG          DLVVVFLFTHPLMAVLA--RYRVFGSSRFSGLGASLDRPPATAGRRPARDRELVAAGTGR
Q4JVE1_CORJK          DLVVAFLLTAPLMILMS--RRPSFASPKLNGLGAAYRVAERK--YGRKPHEHAVRAKSAK
C4LIX5_CORK4          DLFVVFLVSAPLIILAS--RKPFFSKPSVNGLGAVMRVAERRRAAGIKLPYDVERAENAK
Q8NPZ9_CORGL          DLVVTFLITAPLVILAS--RNPFFAKSSVNGMGRVMKLVEERRANGELDEPEYLKKIHAK
D7BNQ2_ARCHD          DLIVVMMFTYPIMHYLG-KTAYFGEGKRGSGLDA-DKLERTP--IYRGRAYSAPKPTKKT
D6ZHF4_MOBCV          DLGIIFLFTHPMMSLLI-KTRYFGEGRKFSGLDP-LHLGASSDRIYMRSTATATSSRKKK
B2GIL6_KOCRD          DLLVVFLFTHPVMVLLA-RTWYFGSGAKNSGLDP---EALDAVPMYRGAGRLRSPEDSDG
A9WSE2_RENSM          DLIVVFMFTHPTLQLLA-TRKFFSEGHRFSGLSP---DRLGAVPLYRGAGRFRSPED---
E1VWF6_GLUAR          DLVVVYGLTHPTLVLLA-RTKFFANGHPLSGMDP---SLLGVKPLYQGAGKVRRFDEN--
C5CCH9_MICLC          DLIVVFMFTHPLMVLLA-QTRFVGEGHPMSGLDP---SLLGGPSLYQGAGRFREPAPAPR
B0REC2_CLAMS          DLIVVSLFTHPILQLLA-NRRFFAEGHRMSGLDP---RALGAV--YRGRATFRTPTAT--
E8NFI9_MICTS          DILIFILFTHPVMQLLA-RTRFFGSGHPLSGMDP---EALGAV--YRGRAQFRAPVAD--
D5UEN5_CELFN          DLLVVFMFTHPLMVLLG-RTRFFANGHPASGLDP--RRLGVDVPHYAGRGRVRQPETQG-
D1BGW2_SANKS          DLIVVFFFTHPLMKLLA-RTRFFADGHPASGLDP--HRLGATGVRYAGRGRVVTPATAAA
C5C5R0_BEUC1          DIVVVFLFTHPMMKILA-RTKFFGDGHPMSGLDP--VHLGATVAAYAGRGRTRTRAERT-
C7R4G5_JONDD          DLIVVFFFTHPVLQLLA-RTRFFRNGHKLSGFNP--ESLGVDRPRYVGRGKVATAQSTP-
D1BSK1_XYLCX          DVMVVVWFTHPVMELLA-KVRFFRDGHIASGLNRGRLALTAAKPRYAGAGRVAMPASVS-
Q83MZ7_TROWT          DLLVVVFFTHPVLQYLS-HSSFFTRKY--SGLNV-------KSAVYRGRLMTR-------
A6WCH6_KINRD          DVLIVVLFTHPVVALLA-RTKFFGGGHKWSGFDP----------EHLGSVVARHALHRG-
E6SB77_INTC7          DLAVVMLFTHPMVQLLA-RTEFFGNGHKWSGLDP-ERLGAKESPRYRGRGQFRPASAPT-
C7NI44_KYTSD          DLIVVMLFTHPVVTLLA-QTRFFGNGHPLSGMNP-ESLGARKST-YVGRGRVRSLPEPT-
C7MCC2_BRAFD          DLVVVFLFTHPVLQALV-RTRFFGKGHPLSGLDP--ARLDRDVPAYAGRGRVRPVGQRGG
D6Y2C4_THEBD          DLIVVVLFTKPVTSLAA-RLGFFARGHRLSGLDPGRLGPVPGAAGRAVGEA---------
D2AWR2_STRRD          DIAVVFMFTKPFVALLA-KRKFFARGHKLSGLDAERMSVQTSVGSKPTPQEA--------
D1AEV4_THECD          DVVVVFFFTKPMVTLLA-RRRFFARGHRWSGLDPDRLRKSRPAPSLAEES----------
A0LUK3_ACIC1          DLFIVFAFTKPLVTLLS-RTDFFGNGHRFSGLDPAHLGITRLPGTAGGAQRPVPARRV--
A8KZE4_FRASN          DVLIMFIFTRPLVTALV-RRPLFSTS-RFSGLMVLSTGGAAAADRPRLTRRADASAPGAE
Q2JD92_FRACC          DVVIMFIFTRPLVTLLV-RRRLFSVS-RYSGLSPKTLGGRGGGVAPAASTRARLAKRPA-
E2PV76_STRC2          DVVVVFFFTKPLMTLAA-RSKFFGGGHPWSGLDPKRLGVE--PPLRRS--RRT----TVV
E4N7T8_KITSK          DVVVIFLFTKPLITLLA-RTKFFASGHPWSGLDPKRLGAR--PPIRGS--RRR----STT
C7QJQ1_CATAD          DIVVVFMFTKPIVTLLA-RRRFFNDGHPWSGLDPNRLGVKKSPGIRQTIVDRR----AAA
D7GDS9_PROFC          DLFIVFFFTHPLVTLLG-RTKFFGEGHRFSGFEPEHLGVSRASLIGRRRARSRSGRRTSG
Q6A8K5_CUTAK          DLIICFFFTHPIVTVLG-RTRFWGQGRRGSGLEAEHMGVTESQLLGRRSRRS-----ASR
D2PVF3_KRIFD          DLLVVFVFTKPLVTLLA-RTDFFGHGHRLSGLDPEQLGVERLPGQTKPSQRP-----VKA
A1SJA9_NOCSJ          DLAIFFWFTHPMVSVLG-KYKFFNRGHKLSGLDAEALGVDRINIAGGRA-----------
C4RGU0_MICS3          DLVVVFLFRHPIMTMFA--RTRAFLSPRVSGLGRILPPARSEQATRTSRVKEA-------
A4X5X5_SALTO          DLVVVFLFRHPIMTMFA--RTRAFLSPRVSGLGRALPAREKPAQPRNPRAKEA-------
D3PYP7_STANL          DILVVFLFTHPLVSWVS--RSRILDNPFLSGLHTGRRRTPASVSVRGAVSPKES------
E1QZN3_OLSUV          DIVTMFCFKAPALRLLA--LGTIQRHPRFWGIDQDVEEAERERDAAGVKGGVRNA-----
C7LYS6_ACIFD          DVASAWFFTRPLVLIVGDALGKTHPRWLGVGPVQLREQAPETAILRPRARVSGSES----
                       .                                                          

B1YJQ7_EXIS2          ------------------------------------------------------------
D6XWY8_BACIE          ------------------------------------------------------------
E3E8W8_PAEPS          ------------------------------------------------------------
C0ZAP6_BREBN          ------------------------------------------------------------
SECD_ALIAD            ------------------------------------------------------------
SECD_ANADE            ------------------------------------------------------------
Q08P79_STIAD          ------------------------------------------------------------
A9F8D1_SORC5          ------------------------------------------------------------
Q6MKZ2_BDEBA          ------------------------------------------------------------
E1X0T6_HALMS          ------------------------------------------------------------
D0LJ86_HALO1          ------------------------------------------------------------
SECD_SYNFM            ------------------------------------------------------------
Q2LVH4_SYNAS          ------------------------------------------------------------
E1YHR5_9DELT          ------------------------------------------------------------
E1QIL8_DESB2          ------------------------------------------------------------
B8F9E3_DESAL          ------------------------------------------------------------
SECD_THEYD            ------------------------------------------------------------
D8PI89_9BACT          ------------------------------------------------------------
B6ANM3_9BACT          ------------------------------------------------------------
B5ECA4_GEOBB          ------------------------------------------------------------
Q3A3C4_PELCD          ------------------------------------------------------------
D5MHP3_9BACT          ------------------------------------------------------------
SECD_CALNY            ------------------------------------------------------------
SECD_DESIS            ------------------------------------------------------------
C4XSM5_DESMR          ------------------------------------------------------------
C7LN34_DESBD          ------------------------------------------------------------
Q1MSC1_LAWIP          ------------------------------------------------------------
SECD_MAGMM            ------------------------------------------------------------
SECD_RHOM4            ------------------------------------------------------------
D5HAA4_SALRM          ------------------------------------------------------------
B3EJI9_CHLPB          ------------------------------------------------------------
Q3ANT9_CHLCH          ------------------------------------------------------------
B3QTH7_CHLT3          ------------------------------------------------------------
B0VHR7_CLOAI          ------------------------------------------------------------
SECD_ELUMP            ------------------------------------------------------------
SECD_UNCTG            ------------------------------------------------------------
SECD_ACEP3            ------------------------------------------------------------
Q0BS58_GRABC          ------------------------------------------------------------
D3NUL2_AZOS1          ------------------------------------------------------------
D8JWH1_HYPDA          ------------------------------------------------------------
E3I016_RHOVT          ------------------------------------------------------------
E2CQN1_9RHOB          ------------------------------------------------------------
A7HXL0_PARL1          ------------------------------------------------------------
B0UI92_METS4          ------------------------------------------------------------
A7IND6_XANP2          ------------------------------------------------------------
A4U1K0_9PROT          ------------------------------------------------------------
D5BQT5_PUNMI          ------------------------------------------------------------
Q9A6U2_CAUVC          ------------------------------------------------------------
D9QLN2_BRESC          ------------------------------------------------------------
Q5NL89_ZYMMO          ------------------------------------------------------------
Q1GSE5_SPHAL          ------------------------------------------------------------
SECD_RHOCB            ------------------------------------------------------------
Q0C0W6_HYPNA          ------------------------------------------------------------
C6XJ02_HIRBI          ------------------------------------------------------------
Q0ANE6_MARMM          ------------------------------------------------------------
Q2RTI1_RHORT          ------------------------------------------------------------
SECD_ECOLI            ------------------------------------------------------------
C4K8M1_HAMD5          ------------------------------------------------------------
SECD_HAEIN            ------------------------------------------------------------
A1SWT8_PSYIN          ------------------------------------------------------------
Q493H1_BLOPB          ------------------------------------------------------------
Q7VQA9_BLOFL          ------------------------------------------------------------
B8GTQ2_THISH          ------------------------------------------------------------
Q31FZ7_HYDCU          ------------------------------------------------------------
D0KW97_HALNC          ------------------------------------------------------------
Q60B03_METCA          ------------------------------------------------------------
A1WXP8_HALHL          ------------------------------------------------------------
D3RSH9_ALLVD          ------------------------------------------------------------
D0U555_9BACT          ------------------------------------------------------------
Q5ZU07_LEGPH          ------------------------------------------------------------
A9KE82_COXBN          ------------------------------------------------------------
A0A0E1PNG4_ACIBA      ------------------------------------------------------------
Q0VS97_ALCBS          ------------------------------------------------------------
A4GHV3_9BACT          ------------------------------------------------------------
A4GK28_9BACT          ------------------------------------------------------------
Q1QTM7_CHRSD          ------------------------------------------------------------
A1TZN9_MARHV          ------------------------------------------------------------
C3K1N2_PSEFS          ------------------------------------------------------------
B8KXG6_9GAMM          ------------------------------------------------------------
Q21KW0_SACD2          ------------------------------------------------------------
B3PDJ8_CELJU          ------------------------------------------------------------
C7RB47_KANKD          ------------------------------------------------------------
B2FN02_STRMK          ------------------------------------------------------------
A5EWX7_DICNV          ------------------------------------------------------------
Q145I2_PARXL          AVAAKPSKARAAVAQARAGKPTVRRRNAPGSSTGTPGSSPGSTNTPQKPGSSR-------
D8INT3_HERSS          EVLTTSGKASAK----RDGK----------------------------------------
E6UXK2_VARPE          GTDAAVVAETK-------------------------------------------------
D6CKE5_THIA3          EGAAGALSSGAASDAVKAGKPLDAPTPRTTKPRRKVH-----------------------
E8UEP8_TAYEM          KELKA-------------------------------------------------------
E0XSS7_9PROT          ------------------------------------------------------------
D7N3K1_9NEIS          ASGQKAGKE---------------------------------------------------
D7DM25_METV0          ------------------------------------------------------------
Q0AG53_NITEC          ------------------------------------------------------------
B6BWI8_9PROT          ------------------------------------------------------------
B7J4R7_ACIF2          ------------------------------------------------------------
Q0HXS6_SHESR          ------------------------------------------------------------
E1SV05_FERBD          ------------------------------------------------------------
B7VQL0_VIBTL          ------------------------------------------------------------
Q7MD23_VIBVY          ------------------------------------------------------------
A1S8J5_SHEAM          ------------------------------------------------------------
A4SLM7_AERS4          ------------------------------------------------------------
Q15N36_PSEA6          ------------------------------------------------------------
Q3IL52_PSEHT          ------------------------------------------------------------
A8EY98_RICCK          ------------------------------------------------------------
B3CTC4_ORITI          ------------------------------------------------------------
B9KH60_ANAMF          ------------------------------------------------------------
A0A0H3M0Z2_EHRRW      ------------------------------------------------------------
B3CPT1_WOLPP          ------------------------------------------------------------
Q2GDE0_NEOSM          ------------------------------------------------------------
D0RNY3_9PROT          ------------------------------------------------------------
Q4FM00_PELUB          ------------------------------------------------------------
Q7VFM8_HELHP          ------------------------------------------------------------
C5ZWZ2_9HELI          ------------------------------------------------------------
E7A9U3_HELFC          ------------------------------------------------------------
A0RNX0_CAMFF          ------------------------------------------------------------
C3XE91_9HELI          ------------------------------------------------------------
SECD_AQUAE            ------------------------------------------------------------
D3DH34_HYDTT          ------------------------------------------------------------
B4U9J1_HYDS0          ------------------------------------------------------------
C1DVG5_SULAA          ------------------------------------------------------------
E8T6K3_THEA1          ------------------------------------------------------------
SECD_KORVE            ------------------------------------------------------------
E8X5K0_GRATM          ------------------------------------------------------------
C1F9I4_ACIC5          ------------------------------------------------------------
Q029K4_SOLUE          ------------------------------------------------------------
SECD_PETMO            ------------------------------------------------------------
C5CF36_KOSOT          ------------------------------------------------------------
A6LP86_THEM4          ------------------------------------------------------------
A0A1Q6S007_9FIRM      ------------------------------------------------------------
D3R265_MAGIU          ------------------------------------------------------------
B8I6M6_RUMCH          ------------------------------------------------------------
B0SPU4_LEPBP          ------------------------------------------------------------
SECD_TREPA            ------------------------------------------------------------
Q73PW4_TREDE          ------------------------------------------------------------
E1R5K7_SEDSS          ------------------------------------------------------------
E0RQA9_SPITD          ------------------------------------------------------------
D5UAD5_BRAM5          ------------------------------------------------------------
SECD_LEPBD            ------------------------------------------------------------
SECD_SEBTE            ------------------------------------------------------------
A5TW61_FUSNP          ------------------------------------------------------------
SECD_GEMAT            ------------------------------------------------------------
B2A263_NATTJ          ------------------------------------------------------------
SECD_ACIFV            ------------------------------------------------------------
D1BLM4_VEIPT          ------------------------------------------------------------
B8CXF7_HALOH          ------------------------------------------------------------
D9QVJ1_ACEAZ          ------------------------------------------------------------
D5XEJ6_THEPJ          ------------------------------------------------------------
Q2RHU6_MOOTA          ------------------------------------------------------------
Q3ABZ0_CARHZ          ------------------------------------------------------------
B0TF81_HELMI          ------------------------------------------------------------
C9R7V3_AMMDK          ------------------------------------------------------------
B1I4K5_DESAP          ------------------------------------------------------------
C8W4E1_DESAS          ------------------------------------------------------------
A4J544_DESRM          ------------------------------------------------------------
Q0AX22_SYNWW          ------------------------------------------------------------
Q892A4_CLOTE          ------------------------------------------------------------
D9SMV2_CLOC7          ------------------------------------------------------------
Q67LL8_SYMTH          ------------------------------------------------------------
D9TNU7_THETC          ------------------------------------------------------------
A4XIR1_CALS8          ------------------------------------------------------------
E3GFZ5_9FIRM          ------------------------------------------------------------
D9RXQ2_THEOJ          ------------------------------------------------------------
E3PRC6_ACESD          ------------------------------------------------------------
A6TQN4_ALKMQ          ------------------------------------------------------------
D4M8M0_9BACT          ------------------------------------------------------------
E6SLR2_THEM7          ------------------------------------------------------------
SECD_DICTD            ------------------------------------------------------------
SECD_DEHMV            ------------------------------------------------------------
B3T9T5_9ZZZZ          ------------------------------------------------------------
SECD_THET1            ------------------------------------------------------------
B9KYU6_THERP          ------------------------------------------------------------
A9B5U9_HERA2          ------------------------------------------------------------
A7NP80_ROSCS          ------------------------------------------------------------
SECD_ANATU            ------------------------------------------------------------
SECD_PROMA            ------------------------------------------------------------
B5IKE7_9CYAN          ------------------------------------------------------------
B4WJX6_SYNS7          ------------------------------------------------------------
D3EPH0_ATETH          ------------------------------------------------------------
SECD_ACAM1            ------------------------------------------------------------
Q2JY13_SYNJA          ------------------------------------------------------------
Q7NDR6_GLOVI          ------------------------------------------------------------
Q1AWD0_RUBXD          ------------------------------------------------------------
A0QWJ2_MYCS2          RG----------------------------------------------------------
A0A0H3MPV3_MYCLB      RG----------------------------------------------------------
C0ZZ50_RHOE4          ETRA--------------------------------------------------------
D0LCM8_GORB4          TGPAKGSAQ---------------------------------------------------
D5UNI7_TSUPD          TAKDASTGSNAGETKA--------------------------------------------
D9UX19_9ACTN          RANVKEA-----------------------------------------------------
C7MQZ9_SACVD          RAAVKEA-----------------------------------------------------
A4FBB0_SACEN          QTTAKEA-----------------------------------------------------
C6WCM7_ACTMD          GTAVKEA-----------------------------------------------------
C8XE16_NAKMY          DAKEVSV-----------------------------------------------------
D2S9I0_GEOOG          TAQDRSDA----------------------------------------------------
Q4JVE1_CORJK          KAGKAEK----PDNTEEADEAEKADTSATEN-KEGK------------------------
C4LIX5_CORK4          EDQPVRRHIKLADSLSETDESSSGGSSRVDTSKEEK------------------------
Q8NPZ9_CORGL          NAAADKA----STDNSSTDNSEAPGTDTNQE--EEK------------------------
D7BNQ2_ARCHD          ------------------------RTVRATGASGNVDLHDYEYPDERFLDKQETLAQRRA
D6ZHF4_MOBCV          SAQKVASPTISLARQKAGLLQTDEEDTADTAATPNANLESDTPATESAAETSSTESQSET
B2GIL6_KOCRD          LT------IAERRRRAARAAQDADGAGVTTAPTVDGEDRA--------APAPAASSAQTG
A9WSE2_RENSM          --------------RPSVAKKNIGSVGEAERRQTIAERKL--------AERAGSTEASQD
E1VWF6_GLUAR          -------------VVANRGKKNAKASVEAAKRMTIAERRR--------AQAGHSAVADK-
C5CCH9_MICLC          TG------LPAEDSDEPADADDAAAADDAAATDDAAATDAPRPLVATGAPRAGSSARGGR
B0REC2_CLAMS          ------------------TGRRAAAAKEAARRQTIAERKA--------AQQATGSTK---
E8NFI9_MICTS          ------------------TGRTKRSRGEAQRRQTIAERKQ--------AELAAARGD---
D5UEN5_CELFN          -------------GSSTTRQPVTVGAP-GASGQTIAERRA--------AARAA-QAA---
D1BGW2_SANKS          TPGLTEDRPAEPTGKKKKKQLVPAGAATAAPTMTIAERRA--------LAAAE-AAAQKS
C5C5R0_BEUC1          ------------------------AVAANANRMTIAERRA--------AEARE-RAE---
C7R4G5_JONDD          ------------------------MFNDDGTRMTIAQRKA--------AQRSK-EQT---
D1BSK1_XYLCX          -------------EEAAAEVASQVDAGVDAGTGPVAGEPA--------LVGAVGRSSLPA
Q83MZ7_TROWT          ----------------------------DKSQKTIAERKA-----------GH-------
A6WCH6_KINRD          ------------------------ERRPTVAELRAAEREK--------ARSAAGAGGGQD
E6SB77_INTC7          --------------------------VTRATQLAEGKAHS--------------------
C7NI44_KYTSD          --------------------------PTSGTTTEVAL-----------------------
C7MCC2_BRAFD          ----------LAAEDPALGGREPIAVRRARLEREAAARAAADGPGSADGPEPEDGPEPED
D6Y2C4_THEBD          ------------------------------------------------------------
D2AWR2_STRRD          ------------------------------------------------------------
D1AEV4_THECD          ------------------------------------------------------------
A0LUK3_ACIC1          ------------------------------------------------------------
A8KZE4_FRASN          DGGPRAAGDLDPPDPGPRLEKPGTGPRVAGRRTAGQRREH--------------------
Q2JD92_FRACC          --------------------------------PAGQRRES--------------------
E2PV76_STRC2          TTDLKEA-----------------------------------------------------
E4N7T8_KITSK          TQEV--------------------------------------------------------
C7QJQ1_CATAD          RQGSAEGMEA--------------------------------------------------
D7GDS9_PROFC          SSRTGSDTDAPGDDEGDKPASGSKES----------------------------------
Q6A8K5_CUTAK          AKRTIESEEA--------------------------------------------------
D2PVF3_KRIFD          STRKPVGGEV--------------------------------------------------
A1SJA9_NOCSJ          ------------------------------------------------------------
C4RGU0_MICS3          ------------------------------------------------------------
A4X5X5_SALTO          ------------------------------------------------------------
D3PYP7_STANL          ------------------------------------------------------------
E1QZN3_OLSUV          ------------------------------------------------------------
C7LYS6_ACIFD          ------------------------------------------------------------
                                                                                  

B1YJQ7_EXIS2          ------------------------------------------
D6XWY8_BACIE          ------------------------------------------
E3E8W8_PAEPS          ------------------------------------------
C0ZAP6_BREBN          ------------------------------------------
SECD_ALIAD            ------------------------------------------
SECD_ANADE            ------------------------------------------
Q08P79_STIAD          ------------------------------------------
A9F8D1_SORC5          ------------------------------------------
Q6MKZ2_BDEBA          ------------------------------------------
E1X0T6_HALMS          ------------------------------------------
D0LJ86_HALO1          ------------------------------------------
SECD_SYNFM            ------------------------------------------
Q2LVH4_SYNAS          ------------------------------------------
E1YHR5_9DELT          ------------------------------------------
E1QIL8_DESB2          ------------------------------------------
B8F9E3_DESAL          ------------------------------------------
SECD_THEYD            ------------------------------------------
D8PI89_9BACT          ------------------------------------------
B6ANM3_9BACT          ------------------------------------------
B5ECA4_GEOBB          ------------------------------------------
Q3A3C4_PELCD          ------------------------------------------
D5MHP3_9BACT          ------------------------------------------
SECD_CALNY            ------------------------------------------
SECD_DESIS            ------------------------------------------
C4XSM5_DESMR          ------------------------------------------
C7LN34_DESBD          ------------------------------------------
Q1MSC1_LAWIP          ------------------------------------------
SECD_MAGMM            ------------------------------------------
SECD_RHOM4            ------------------------------------------
D5HAA4_SALRM          ------------------------------------------
B3EJI9_CHLPB          ------------------------------------------
Q3ANT9_CHLCH          ------------------------------------------
B3QTH7_CHLT3          ------------------------------------------
B0VHR7_CLOAI          ------------------------------------------
SECD_ELUMP            ------------------------------------------
SECD_UNCTG            ------------------------------------------
SECD_ACEP3            ------------------------------------------
Q0BS58_GRABC          ------------------------------------------
D3NUL2_AZOS1          ------------------------------------------
D8JWH1_HYPDA          ------------------------------------------
E3I016_RHOVT          ------------------------------------------
E2CQN1_9RHOB          ------------------------------------------
A7HXL0_PARL1          ------------------------------------------
B0UI92_METS4          ------------------------------------------
A7IND6_XANP2          ------------------------------------------
A4U1K0_9PROT          ------------------------------------------
D5BQT5_PUNMI          ------------------------------------------
Q9A6U2_CAUVC          ------------------------------------------
D9QLN2_BRESC          ------------------------------------------
Q5NL89_ZYMMO          ------------------------------------------
Q1GSE5_SPHAL          ------------------------------------------
SECD_RHOCB            ------------------------------------------
Q0C0W6_HYPNA          ------------------------------------------
C6XJ02_HIRBI          ------------------------------------------
Q0ANE6_MARMM          ------------------------------------------
Q2RTI1_RHORT          ------------------------------------------
SECD_ECOLI            ------------------------------------------
C4K8M1_HAMD5          ------------------------------------------
SECD_HAEIN            ------------------------------------------
A1SWT8_PSYIN          ------------------------------------------
Q493H1_BLOPB          ------------------------------------------
Q7VQA9_BLOFL          ------------------------------------------
B8GTQ2_THISH          ------------------------------------------
Q31FZ7_HYDCU          ------------------------------------------
D0KW97_HALNC          ------------------------------------------
Q60B03_METCA          ------------------------------------------
A1WXP8_HALHL          ------------------------------------------
D3RSH9_ALLVD          ------------------------------------------
D0U555_9BACT          ------------------------------------------
Q5ZU07_LEGPH          ------------------------------------------
A9KE82_COXBN          ------------------------------------------
A0A0E1PNG4_ACIBA      ------------------------------------------
Q0VS97_ALCBS          ------------------------------------------
A4GHV3_9BACT          ------------------------------------------
A4GK28_9BACT          ------------------------------------------
Q1QTM7_CHRSD          ------------------------------------------
A1TZN9_MARHV          ------------------------------------------
C3K1N2_PSEFS          ------------------------------------------
B8KXG6_9GAMM          ------------------------------------------
Q21KW0_SACD2          ------------------------------------------
B3PDJ8_CELJU          ------------------------------------------
C7RB47_KANKD          ------------------------------------------
B2FN02_STRMK          ------------------------------------------
A5EWX7_DICNV          ------------------------------------------
Q145I2_PARXL          ------------------------------------------
D8INT3_HERSS          ------------------------------------------
E6UXK2_VARPE          ------------------------------------------
D6CKE5_THIA3          ------------------------------------------
E8UEP8_TAYEM          ------------------------------------------
E0XSS7_9PROT          ------------------------------------------
D7N3K1_9NEIS          ------------------------------------------
D7DM25_METV0          ------------------------------------------
Q0AG53_NITEC          ------------------------------------------
B6BWI8_9PROT          ------------------------------------------
B7J4R7_ACIF2          ------------------------------------------
Q0HXS6_SHESR          ------------------------------------------
E1SV05_FERBD          ------------------------------------------
B7VQL0_VIBTL          ------------------------------------------
Q7MD23_VIBVY          ------------------------------------------
A1S8J5_SHEAM          ------------------------------------------
A4SLM7_AERS4          ------------------------------------------
Q15N36_PSEA6          ------------------------------------------
Q3IL52_PSEHT          ------------------------------------------
A8EY98_RICCK          ------------------------------------------
B3CTC4_ORITI          ------------------------------------------
B9KH60_ANAMF          ------------------------------------------
A0A0H3M0Z2_EHRRW      ------------------------------------------
B3CPT1_WOLPP          ------------------------------------------
Q2GDE0_NEOSM          ------------------------------------------
D0RNY3_9PROT          ------------------------------------------
Q4FM00_PELUB          ------------------------------------------
Q7VFM8_HELHP          ------------------------------------------
C5ZWZ2_9HELI          ------------------------------------------
E7A9U3_HELFC          ------------------------------------------
A0RNX0_CAMFF          ------------------------------------------
C3XE91_9HELI          ------------------------------------------
SECD_AQUAE            ------------------------------------------
D3DH34_HYDTT          ------------------------------------------
B4U9J1_HYDS0          ------------------------------------------
C1DVG5_SULAA          ------------------------------------------
E8T6K3_THEA1          ------------------------------------------
SECD_KORVE            ------------------------------------------
E8X5K0_GRATM          ------------------------------------------
C1F9I4_ACIC5          ------------------------------------------
Q029K4_SOLUE          ------------------------------------------
SECD_PETMO            ------------------------------------------
C5CF36_KOSOT          ------------------------------------------
A6LP86_THEM4          ------------------------------------------
A0A1Q6S007_9FIRM      ------------------------------------------
D3R265_MAGIU          ------------------------------------------
B8I6M6_RUMCH          ------------------------------------------
B0SPU4_LEPBP          ------------------------------------------
SECD_TREPA            ------------------------------------------
Q73PW4_TREDE          ------------------------------------------
E1R5K7_SEDSS          ------------------------------------------
E0RQA9_SPITD          ------------------------------------------
D5UAD5_BRAM5          ------------------------------------------
SECD_LEPBD            ------------------------------------------
SECD_SEBTE            ------------------------------------------
A5TW61_FUSNP          ------------------------------------------
SECD_GEMAT            ------------------------------------------
B2A263_NATTJ          ------------------------------------------
SECD_ACIFV            ------------------------------------------
D1BLM4_VEIPT          ------------------------------------------
B8CXF7_HALOH          ------------------------------------------
D9QVJ1_ACEAZ          ------------------------------------------
D5XEJ6_THEPJ          ------------------------------------------
Q2RHU6_MOOTA          ------------------------------------------
Q3ABZ0_CARHZ          ------------------------------------------
B0TF81_HELMI          ------------------------------------------
C9R7V3_AMMDK          ------------------------------------------
B1I4K5_DESAP          ------------------------------------------
C8W4E1_DESAS          ------------------------------------------
A4J544_DESRM          ------------------------------------------
Q0AX22_SYNWW          ------------------------------------------
Q892A4_CLOTE          ------------------------------------------
D9SMV2_CLOC7          ------------------------------------------
Q67LL8_SYMTH          ------------------------------------------
D9TNU7_THETC          ------------------------------------------
A4XIR1_CALS8          ------------------------------------------
E3GFZ5_9FIRM          ------------------------------------------
D9RXQ2_THEOJ          ------------------------------------------
E3PRC6_ACESD          ------------------------------------------
A6TQN4_ALKMQ          ------------------------------------------
D4M8M0_9BACT          ------------------------------------------
E6SLR2_THEM7          ------------------------------------------
SECD_DICTD            ------------------------------------------
SECD_DEHMV            ------------------------------------------
B3T9T5_9ZZZZ          ------------------------------------------
SECD_THET1            ------------------------------------------
B9KYU6_THERP          ------------------------------------------
A9B5U9_HERA2          ------------------------------------------
A7NP80_ROSCS          ------------------------------------------
SECD_ANATU            ------------------------------------------
SECD_PROMA            ------------------------------------------
B5IKE7_9CYAN          ------------------------------------------
B4WJX6_SYNS7          ------------------------------------------
D3EPH0_ATETH          ------------------------------------------
SECD_ACAM1            ------------------------------------------
Q2JY13_SYNJA          ------------------------------------------
Q7NDR6_GLOVI          ------------------------------------------
Q1AWD0_RUBXD          ------------------------------------------
A0QWJ2_MYCS2          ------------------------------------------
A0A0H3MPV3_MYCLB      ------------------------------------------
C0ZZ50_RHOE4          ------------------------------------------
D0LCM8_GORB4          ------------------------------------------
D5UNI7_TSUPD          ------------------------------------------
D9UX19_9ACTN          ------------------------------------------
C7MQZ9_SACVD          ------------------------------------------
A4FBB0_SACEN          ------------------------------------------
C6WCM7_ACTMD          ------------------------------------------
C8XE16_NAKMY          ------------------------------------------
D2S9I0_GEOOG          ------------------------------------------
Q4JVE1_CORJK          ------------------------------------------
C4LIX5_CORK4          ------------------------------------------
Q8NPZ9_CORGL          ------------------------------------------
D7BNQ2_ARCHD          R-----------ERRE------RKAAAQEGEN----------
D6ZHF4_MOBCV          A-----------KSDESGDTTSKDEPTQTEEDAK--------
B2GIL6_KOCRD          ----------TAHTPGAGSSAARTDSEEAQR-----------
A9WSE2_RENSM          ----------QATEGTAADAKVSVKAAKDQD-----------
E1VWF6_GLUAR          ----------------PGSTQAKAQEENNE------------
C5CCH9_MICLC          ----------RSRTAPPMTIAERRRAERRRQEEDQ-------
B0REC2_CLAMS          ----------------TATIDAPRADDTSRDD----------
E8NFI9_MICTS          ----------------SRS--TKEGDD---------------
D5UEN5_CELFN          ----------AAPPHDPPTT--VDDAPTDGRPEGSDR-----
D1BGW2_SANKS          DAAEASDSSEAETEHDPAGTPPADDTRTDGTPASDERKDGNL
C5C5R0_BEUC1          ----------AESPDDGAVVGAKASDEQEGKR----------
C7R4G5_JONDD          -----------------EQVSSQSTTRKDGE-----------
D1BSK1_XYLCX          PATDETGRRLTIAERRAAERRAAAGTTGSGTAENEEGR----
Q83MZ7_TROWT          ------------------------------------------
A6WCH6_KINRD          ----------------EADRTTGRDEDGAGS-----------
E6SB77_INTC7          ------------------------------------------
C7NI44_KYTSD          ------------------------------------------
C7MCC2_BRAFD          GPEPTDGPDPAGGPGSAEGADGPDGADDTEEQSR--------
D6Y2C4_THEBD          ------------------------------------------
D2AWR2_STRRD          ------------------------------------------
D1AEV4_THECD          ------------------------------------------
A0LUK3_ACIC1          ------------------------------------------
A8KZE4_FRASN          ------------------------------------------
Q2JD92_FRACC          ------------------------------------------
E2PV76_STRC2          ------------------------------------------
E4N7T8_KITSK          ------------------------------------------
C7QJQ1_CATAD          ------------------------------------------
D7GDS9_PROFC          ------------------------------------------
Q6A8K5_CUTAK          ------------------------------------------
D2PVF3_KRIFD          ------------------------------------------
A1SJA9_NOCSJ          ------------------------------------------
C4RGU0_MICS3          ------------------------------------------
A4X5X5_SALTO          ------------------------------------------
D3PYP7_STANL          ------------------------------------------
E1QZN3_OLSUV          ------------------------------------------
C7LYS6_ACIFD          ------------------------------------------