CLUSTAL format seed alignment for MF_01464_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

E1R5K6_SEDSS          ------------------------------------------MTKVVR------------
E0RQA8_SPITD          -------------------------------------------MKVIR------------
SECF_BORBU            ------------------------------------------MQRVIN------------
SECF_TREPA            ------------------------------------------MRQVVR------------
Q73PW5_TREDE          ------------------------------------------MKKIIS------------
B0SPU5_LEPBP          -------------------------------------------MYNIN------------
Q72PD4_LEPIC          -----------------------------------MALKNWSPKRMFD------------
SECF_DICTD            ------------------------------------------MKKEIN------------
B0VHR6_CLOAI          ----------------------------------------MRILKNPN------------
A1BCH7_CHLPD          ----------------------------------------MRIFHKTS------------
SECF_RHOM4            ----------------------------------------MRIFENAN------------
Q9WXE9_PRERU          MDHRYRRFHSATAVYLTRVVYDAMLSKDKWTNLTFVTGYSKNLMQNAK------------
D5MHP4_9BACT          ---------------------------------------MIEILGKTQ------------
D8PI88_9BACT          ---------------------------------------MFEILGKTN------------
B6ANM4_9BACT          ---------------------------------------MIELIKNPS------------
B5ECA5_GEOBB          ----------------------------------------MQLISNTN------------
B3E2R7_GEOLS          ---------------------------------------MMELLGKTN------------
SECF_THEYD            ---------------------------------------MIQILGKTN------------
SECF_KORVE            ----------------------------------------MELFRNTN------------
E8X5J9_GRATM          ----------------------------------------MELFRQPN------------
Q029K3_SOLUE          ----------------------------------------MELFKNTN------------
SECF_ELUMP            ---------------------------------------MMNLIPKTN------------
SECF_UNCTG            ----------------------------------------MRFFRSVD------------
D0RNY4_9PROT          -----------------------------------------MFNIYNK------------
B6BPL7_9PROT          ------------------------------------------------------------
B4WED0_9CAUL          --------------------------------MAMRGWPFIKLLPQKT------------
D5VIW1_CAUST          -----------------------------------MRWPLIRYIPRAT------------
Q0BS57_GRABC          ----------------------------------MFIRPMLRMVPDGT------------
C6XJ03_HIRBI          --------------------------------------MLLKYLPTEP------------
Q0ANE7_MARMM          -----------------------------------MTLALVKYLPTSG------------
Q0C0W7_HYPNA          --------------------------------------MLIKYWPTET------------
E2CQN2_9RHOB          ------------------------------------MALL-RLVPDNT------------
A7HXL1_PARL1          ------------------------------------MRHL-KLIPDDT------------
D8JWH2_HYPDA          ----------------------------MLMRLIPVFKGF-DFFPHDL------------
E3I015_RHOVT          ------------------------------MLLKPLFR-----LPQKT------------
B0UI93_METS4          ------------------------------------MRLL-RLWPDES------------
B2II62_BEII9          ------------------------------------MKLL-RLAPENT------------
E6VHR2_RHOPX          ----------MTSTQWILIGLGAVVVVLTFVSIMNWLPSL-RIVPDET------------
A7IND7_XANP2          ------------------------------------MPLI-DYIPAQT------------
D5BQT4_PUNMI          ------------------------------------MRL--KLVPSDT------------
Q2W4A8_MAGSA          ------------------------------------MQLIDRFLPHGT------------
B6ISI3_RHOCS          ------------------------------------MKPL-RLVPDNT------------
Q2NBX9_ERYLH          ------------------------------------MKLL-KLVPDDT------------
Q1GSE6_SPHAL          ------------------------------------MRLL-KLVPDDT------------
D4YYJ1_SPHJU          ------------------------------------MKLL-KLVPDNT------------
SECF_RHOCB            ------------------------------------MAFRLKLVPEKT------------
SECF_KETVY            ------------------------------------MAFRLKLVPDKT------------
D0D195_9RHOB          -------------------------------------MRHLRLVKDET------------
SECF_RICPR            -----------------------------------MQIYPLRFVPNKI------------
A5CDU1_ORITB          -----------------------MRIDNIKYFGVKMPALSLELILSKI------------
B9KH24_ANAMF          ----------------------------MATRAFAVLAMVLRIVPDGV------------
Q2GI09_EHRCR          -----------------------------------------MVFLSDI------------
Q5GT97_WOLTR          --------------------------------------MAVRLIPDNL------------
C6V4R4_NEORI          ------------------------------------MRFIISSLLDGC------------
C1D5X5_LARHH          -------------------------------------------MQAPQNQKSNGQK----
B1XW93_LEPCP          -------------------------------------------MEFFR------------
B6BWI7_9PROT          -------------------------------------------MEIFR------------
A5EWX6_DICNV          -------------------------------------------MQIKI------------
C0N4C3_9GAMM          ---------------------------------------MQF-LKNET------------
A5CVL6_VESOH          ---------------------------------------MSFKVLNIP------------
A1WXP7_HALHL          ----------------------------------------MEIFKNDP------------
Q31FZ8_HYDCU          ---------------------------------------MSTSMENQK------------
D3S9V5_THISK          --------------------------------------MLPHLNFAES------------
D3RSH8_ALLVD          --------------------------------------MTQKRTINEL------------
C7RB48_KANKD          ----------------------------------------MSFLNEDT------------
A4GK29_9BACT          ------------------------------------------------------------
A4GHV4_9BACT          ----------------------------------------------MT------------
B8KFI4_9GAMM          -----------------------------------------------M------------
Q21KV9_SACD2          --------------------------------------------MTPE------------
Q2SDV4_HAHCH          --------------------------------------------MSDE------------
E4PKE9_MARAH          ------------------------------------------MSEDQK------------
A6VYM8_MARMS          ---------------------------------------------MKV------------
E1V6F3_HALED          ------------------------------------------MQSLIN------------
Q0VS96_ALCBS          -------------------------------------------MSKAP------------
B3PDJ9_CELJU          -------------------------------------------MIQPS------------
Q8GEL5_PSEPU          -------------------------------------------MTSRSCGF---------
D0SG96_ACIJO          ------------------------MMTDVTQ------------QDSKKYGR----P----
Q1QBR5_PSYCK          ------------------------MAIDNNNPLEKQNNPEPNGSNSEASGRGRKKPRRDG
Q83CH4_COXBU          ----------------------------------------MEFFKTNT------------
Q5ZU08_LEGPH          ----------------------------------------MEFFNPNS------------
A0A0B3WJC7_FRATU      ----------------------------------------MEFFKQKT------------
B8L1U9_9GAMM          -----------------------------------MKLFPLHILPNDT------------
D0KW98_HALNC          ---------------------------------------MFNLFPYNA------------
B7J4R6_ACIF2          -------------------MASSNSPSASGACKSFISEVAMELFKVRT------------
SECF_ECOLI            ------------------------------------MAQEYTVEQLNHG-----------
Q8D162_YERPE          --------------MPSSTCFTAASALTSCLFEEYVVAQDYTVEQLNYG-----------
Q1LSN7_BAUCH          ----------------------------------MTRKENSVVNKLESS-----------
Q7VQA8_BLOFL          ---------------------------------------MNNVS----------------
E8Q616_BLOVB          ---------------------------------------MPKIKDFTPH-----------
Q493H0_BLOPB          ---------------------------------------MSESY----------------
A0KJ23_AERHH          ---------------------------------------MFQILHFEKP-----------
Q0HWQ6_SHESR          ---------------------------------------MLEILSLKRT-----------
C4L7L0_TOLAT          ---------------------------------------MFQLLKPGHT-----------
Q5QVF2_IDILO          ---------------------------------------MQEIIKTDER-----------
Q5E3D5_ALIF1          ---------------------------------------MFQLMKAEKT-----------
SECF_HAEIN            ---------------------------------------MMKLFTKDKDGHFIREINGIK
D4ZB75_SHEVD          ---------------------------MMSLFNFKQVNSKFSEMKTLT------------
C3LVV7_VIBCM          -----------------------------------MVDYLKSRIRPI-------------
E1SV06_FERBD          ---------------------------------------MRFDIRSMT------------
A1S8J4_SHEAM          -----------------------------------------MKTLNFT------------
B7VU09_VIBTL          ----------------------------------MSISNMTISNSSMT------------
B7VQK9_VIBTL          ---------------------------------------MTKS-ISVT------------
Q15N35_PSEA6          ----------------------------------MSANTLKNETSTQEATNTISQSTG--
Q3IL51_PSEHT          ----------------------------------MLNYFLKGETGT--------------
A0KLF0_AERHH          -------------------------MSSRRAFEPAPRPRHALPCGKPEPSAVEGTTML--
Q2RTI2_RHORT          ----------------------------------MPRPFARLTADFHYD-----------
C5ZWZ3_9HELI          ----------------------------------------MDFFKHNK------------
C3XE90_9HELI          ----------------------------------------MEIFKQQK------------
E7A9U2_HELFC          ----------------------------------------MELFKRVR------------
A8ERU7_ARCB4          ----------------------------------------MEIFNQKK------------
D1B3G6_SULD5          ----------------------------------------MEFFSKGK------------
A6Q513_NITSB          ----------------------------------------MEFFKTDK------------
E4U019_SULKY          ----------------------------------------MELFKEDK------------
A7ZE41_CAMC1          ----------------------------------------MQIFTKAK------------
E1YHR4_9DELT          ----------------------------------------MQFIKPGT------------
A8ZW13_DESOH          ---------------------------------------MFEIIKDGT------------
B8F9E2_DESAL          ----------------------------------------MEWIKPGI------------
E1QIL9_DESB2          ----------------------------------------MELIRPDI------------
C7LN35_DESBD          --------------------------------------MSFEIIKRDT------------
C4XR64_DESMR          --------------------------------------MVLELIRPGT------------
C8X141_DESRD          --------------------------------------MGLQLIKPGT------------
B8J2Q5_DESDA          --------------------------------------MSFTFVKHDT------------
A0A0H3AA07_DESVV      --------------------------------------MGLSFIKYDT------------
Q1MSC2_LAWIP          ------------------------------------MAMTIELFQRQT------------
Q3A3C5_PELCD          ----------------------------------------MQVIKHDI------------
Q2LVH3_SYNAS          ----------------------------------------MEIIKSET------------
SECF_CALNY            ------------------------------------MAQFLELIKNDS------------
D4H482_DENA2          ---------------------------------------MFELIKTGT------------
SECF_MAGMM            ----------------------------------------MQVFLKAT------------
SECF_DESIS            ------------------------------------------MRLRFY------------
E8T6K2_THEA1          ------------------------------------------MERKFD------------
SECF_AQUAE            ----------------------------------------------MK------------
D3SMD0_THEAH          ---------------------------------------MIILFKAMR------------
B4U6P7_HYDS0          --------------------------------------------MRIK------------
C0QRM5_PERMH          ---------------------------------------MRNFLNEPP------------
SECF_PETMO            ----------------------------------------------MP------------
C5CF37_KOSOT          ---------------------------------------------MRY------------
A7HMQ5_FERNB          -----------------------------------------------M------------
A6LP85_THEM4          ------------------------------------------------------------
Q9WZW5_THEMA          ---------------------------------------------MRK------------
B8JH53_ANAD2          -----------------------------------MQFKTFDIIPHDT------------
Q1D3B7_MYXXD          ----------------------------------------MQIFKNKT------------
E1X0T7_HALMS          ---------------------------------------MFEIISNNT------------
Q6MKZ3_BDEBA          --------------------------------------MSNKNTESFG------------
A9F8C8_SORC5          ----------------------------------------MELIKPGR------------
D0LJ87_HALO1          ---------------------------------MATHKPFRELIKPGS------------
B3T9T6_9ZZZZ          ------------------------------------------------------------
D2BGI5_DEHMV          ------------------------------------------------------------
A9WGQ9_CHLAA          ------------------------------------------------------------
A9B5U8_HERA2          ------------------------------------------------------------
SECF_ANATU            ------------------------------------------------------------
SECF_THET1            ------------------------------------------------------------
D1C4J4_SPHTD          ------------------------------------------------------------
B4WJX7_SYNS7          ------------------------------------------------------------
SECF_ACAM1            ------------------------------------------------------------
A0A0H3K5W7_SYNP6      ------------------------------------------------------------
B8HQ25_CYAP4          ------------------------------------------------------------
SECF_SYNP2            ------------------------------------------------------------
SECF_SYNY3            ------------------------------------------------------------
D3EPH1_ATETH          ------------------------------------------------------------
Q2JKR7_SYNJB          ------------------------------------------------------------
Q7NDR5_GLOVI          ------------------------------------------------------------
SECF_PROMA            ------------------------------------------------------------
A2CA57_PROM3          ------------------------------------------------------------
Q46L53_PROMT          ------------------------------------------------------------
A5GTK4_SYNR3          ------------------------------------------------------------
Q7V1E6_PROMP          ------------------------------------------------------------
B5Y8Y1_COPPD          ------------------------------------------------------------
D4JXA7_9FIRM          -----------------------------------------------------------M
E6UEG8_RUMA7          ----------------------------------------------------------MT
D4LA66_RUMC1          ----------------------------------------------------------MS
A0A2N0UMZ5_9FIRM      -----------------------------------MTDKTQTKAVSNAPLTDEEFAEKYN
E1PK78_MAGIU          ----------------------------------------------------------MT
E6U7Q5_ETHHY          -------------------------------------------MSDKHRKDNVTPLFGHK
A3DDV8_HUNT2          ------------------------------------------------------------
B8I6M7_RUMCH          ------------------------------------------------------------
E0RMP8_PAEP6          ----------------------------------------------------MRFNWN--
C6D7X9_PAESJ          ----------------------------------------------------MLYNAK--
C0ZAP7_BREBN          ----------------------------------------------------MSYDKDHT
SECF_ALIAD            -----------------------------------------------------------M
Q5WHQ4_BACSK          ----------------------------------------------------MSFNPE--
D6XWY7_BACIE          ----------------------------------------------------MNFEHW--
B1YJQ6_EXIS2          ----------------------------------------------------MNFNP---
B7R9G0_9THEO          ------------------------------------------------------------
D9TNU6_THETC          ------------------------------------------------------------
C6PXQ6_9CLOT          ------------------------------------------------------------
Q892A5_CLOTE          ------------------------------------------------------------
A6LTN3_CLOB8          ------------------------------------------------------------
Q97GT8_CLOAB          ------------------------------------------------------------
D9SMV1_CLOC7          ------------------------------------------------------------
A6TQN5_ALKMQ          ------------------------------------------------------------
E3GFZ4_9FIRM          ------------------------------------------------------------
D9TIR8_CALOO          ------------------------------------------------------------
D9RXQ1_THEOJ          ------------------------------------------------------------
D9QVJ2_ACEAZ          ------------------------------------------------------------
E4RIJ9_HALHG          ------------------------------------------------------------
B2A264_NATTJ          ------------------------------------------------------------
A0A1H8CTT8_9FIRM      ------------------------------------------------------------
D1BLM5_VEIPT          ------------------------------------------------------------
SECF_ACIFV            ------------------------------------------------------------
C8W4E2_DESAS          ------------------------------------------------------------
A5D3H0_PELTS          ------------------------------------------------------------
A4J545_DESRM          ------------------------------------------------------------
B1I4K4_DESAP          ------------------------------------------------------------
C9R7V2_AMMDK          ------------------------------------------------------------
B0TF82_HELMI          ------------------------------------------------------------
D5XEJ7_THEPJ          ------------------------------------------------------------
Q2RHU7_MOOTA          ------------------------------------------------------------
D7CLE8_SYNLT          ------------------------------------------------------------
Q0AX23_SYNWW          ------------------------------------------------------------
SECF_SEBTE            ------------------------------------------------------------
E3CUY4_9BACT          ------------------------------------------------------------
D5EDU6_AMICL          ------------------------------------------------------------
D4M8L9_9BACT          ------------------------------------------------------------
E6SLR1_THEM7          ------------------------------------------------------------
B5H469_STRC2          ------------------------------------------------------------
SECF_GEMAT            ------------------------------------------------------------
Q67LL9_SYMTH          ------------------------------------------------------------
C4RGU1_MICS3          ------------------------------------------------------------
D2S9H9_GEOOG          --------------------------------MGTDADEAAAADSAAADAAAAADETALE
D3PYP6_STANL          ------------------------------------------------------------
SECF_MYCLE            --------------------------------------------MVSRAKVGAETTK--G
B1MCI7_MYCA9          ---------------------------------------------MSTSNGTVSNGN--G
Q5YTF3_NOCFA          ---------------------------------------------MTNGNSTPSLRKDGG
D0LCM9_GORB4          ---------------------------------------------MSFSTPGGGSNTTGR
D6Z7I7_SEGRD          -----------------------------------------------------------M
D5UNI8_TSUPD          -----------------------------------------------------------M
C3PGQ3_CORA7          ------------------------------------------------------------
Q79VF7_CORGL          -----------------------------------------------------------M
D9QAR8_CORP2          ------------------------------------------------------------
C4LIX4_CORK4          ------------------------------------------------------------
Q4JVE2_CORJK          ----------------------------------------MSNPETLSAKETEAVEAVES
B1VDK1_CORU7          ---------------------------------------------------------MSS
C6WCM8_ACTMD          ------------------------------------------------------------
C7MR00_SACVD          ------------------------------------------------------------
C8XE15_NAKMY          ----------------------------------------------------MSVDDGLD
A0LUK2_ACIC1          ------------------------------------------------------------
D7BWW9_STRBB          ------------------------------------------------------------
Q0RNU2_FRAAA          ------------------------------------------------------------
D1AEV5_THECD          ------------------------------------------------------------
C7QJQ2_CATAD          ------------------------------------------------------------
D7BNQ3_ARCHD          ------------------------------------------------------------
D6ZHF3_MOBCV          ------------------------------------------------------------
A0JXA8_ARTS2          ------------------------------------------------------------
C5CCH8_MICLC          ------------------------------------------------------------
D2NT09_ROTMD          ------------------------------------------------------------
B0REC3_CLAMS          ------------------------------------------------------------
Q6AFB1_LEIXX          ------------------------------------------------------------
A6WCH5_KINRD          ------------------------------------------------------------
D1BGW3_SANKS          ------------------------------------------------------------
D1BSK2_XYLCX          ------------------------------------------------------------
C7MCC3_BRAFD          ------------------------------------------------------------
E6SB76_INTC7          ------------------------------------------------------------
C7NI43_KYTSD          ------------------------------------------------------------
Q83MZ6_TROWT          ------------------------------------------------------------
D4HDX0_CUTAS          ------------------------------------------------------------
D7GDS8_PROFC          ------------------------------------------------------------
D2PVF2_KRIFD          ------------------------------------------------------------
A1SJB0_NOCSJ          ------------------------------------------------------------
C7LYS7_ACIFD          ------------------------------------------------------------
Q1AWC9_RUBXD          ------------------------------------------------------------
E1QZN4_OLSUV          ------------------------------------------------------------
D8IEE2_BRAP9          ------------MSENIKKNNDVKKTENN-------------------------------
                                                                                  

E1R5K6_SEDSS          ------------------------------------------------------------
E0RQA8_SPITD          ------------------------------------------------------------
SECF_BORBU            ------------------------------------------------------------
SECF_TREPA            ------------------------------------------------------------
Q73PW5_TREDE          ------------------------------------------------------------
B0SPU5_LEPBP          ------------------------------------------------------------
Q72PD4_LEPIC          ------------------------------------------------------------
SECF_DICTD            ------------------------------------------------------------
B0VHR6_CLOAI          ------------------------------------------------------------
A1BCH7_CHLPD          ------------------------------------------------------------
SECF_RHOM4            ------------------------------------------------------------
Q9WXE9_PRERU          ------------------------------------------------------------
D5MHP4_9BACT          ------------------------------------------------------------
D8PI88_9BACT          ------------------------------------------------------------
B6ANM4_9BACT          ------------------------------------------------------------
B5ECA5_GEOBB          ------------------------------------------------------------
B3E2R7_GEOLS          ------------------------------------------------------------
SECF_THEYD            ------------------------------------------------------------
SECF_KORVE            ------------------------------------------------------------
E8X5J9_GRATM          ------------------------------------------------------------
Q029K3_SOLUE          ------------------------------------------------------------
SECF_ELUMP            ------------------------------------------------------------
SECF_UNCTG            ------------------------------------------------------------
D0RNY4_9PROT          ------------------------------------------------------------
B6BPL7_9PROT          ------------------------------------------------------------
B4WED0_9CAUL          ------------------------------------------------------------
D5VIW1_CAUST          ------------------------------------------------------------
Q0BS57_GRABC          ------------------------------------------------------------
C6XJ03_HIRBI          ------------------------------------------------------------
Q0ANE7_MARMM          ------------------------------------------------------------
Q0C0W7_HYPNA          ------------------------------------------------------------
E2CQN2_9RHOB          ------------------------------------------------------------
A7HXL1_PARL1          ------------------------------------------------------------
D8JWH2_HYPDA          ------------------------------------------------------------
E3I015_RHOVT          ------------------------------------------------------------
B0UI93_METS4          ------------------------------------------------------------
B2II62_BEII9          ------------------------------------------------------------
E6VHR2_RHOPX          ------------------------------------------------------------
A7IND7_XANP2          ------------------------------------------------------------
D5BQT4_PUNMI          ------------------------------------------------------------
Q2W4A8_MAGSA          ------------------------------------------------------------
B6ISI3_RHOCS          ------------------------------------------------------------
Q2NBX9_ERYLH          ------------------------------------------------------------
Q1GSE6_SPHAL          ------------------------------------------------------------
D4YYJ1_SPHJU          ------------------------------------------------------------
SECF_RHOCB            ------------------------------------------------------------
SECF_KETVY            ------------------------------------------------------------
D0D195_9RHOB          ------------------------------------------------------------
SECF_RICPR            ------------------------------------------------------------
A5CDU1_ORITB          ------------------------------------------------------------
B9KH24_ANAMF          ------------------------------------------------------------
Q2GI09_EHRCR          ------------------------------------------------------------
Q5GT97_WOLTR          ------------------------------------------------------------
C6V4R4_NEORI          ------------------------------------------------------------
C1D5X5_LARHH          --------------------------------------------------------SWWM
B1XW93_LEPCP          ------------------------------------------------------------
B6BWI7_9PROT          ------------------------------------------------------------
A5EWX6_DICNV          ------------------------------------------------------------
C0N4C3_9GAMM          ------------------------------------------------------------
A5CVL6_VESOH          ------------------------------------------------------------
A1WXP7_HALHL          ------------------------------------------------------------
Q31FZ8_HYDCU          ------------------------------------------------------------
D3S9V5_THISK          ------------------------------------------------------------
D3RSH8_ALLVD          ------------------------------------------------------------
C7RB48_KANKD          ------------------------------------------------------------
A4GK29_9BACT          ------------------------------------------------------------
A4GHV4_9BACT          ------------------------------------------------------------
B8KFI4_9GAMM          ------------------------------------------------------------
Q21KV9_SACD2          ------------------------------------------------------------
Q2SDV4_HAHCH          ------------------------------------------------------------
E4PKE9_MARAH          ------------------------------------------------------------
A6VYM8_MARMS          ------------------------------------------------------------
E1V6F3_HALED          ------------------------------------------------------------
Q0VS96_ALCBS          ------------------------------------------------------------
B3PDJ9_CELJU          ------------------------------------------------------------
Q8GEL5_PSEPU          ------------------------------------------------------------
D0SG96_ACIJO          ------------------------------------------------------------
Q1QBR5_PSYCK          KGSNTQTNNATAKKSASKTQRTGKGANKDSQVFATTALDPSLALGDAAEDAAAYAEGGIK
Q83CH4_COXBU          ------------------------------------------------------------
Q5ZU08_LEGPH          ------------------------------------------------------------
A0A0B3WJC7_FRATU      ------------------------------------------------------------
B8L1U9_9GAMM          ------------------------------------------------------------
D0KW98_HALNC          ------------------------------------------------------------
B7J4R6_ACIF2          ------------------------------------------------------------
SECF_ECOLI            ------------------------------------------------------------
Q8D162_YERPE          ------------------------------------------------------------
Q1LSN7_BAUCH          ------------------------------------------------------------
Q7VQA8_BLOFL          ------------------------------------------------------------
E8Q616_BLOVB          ------------------------------------------------------------
Q493H0_BLOPB          ------------------------------------------------------------
A0KJ23_AERHH          ------------------------------------------------------------
Q0HWQ6_SHESR          ------------------------------------------------------------
C4L7L0_TOLAT          ------------------------------------------------------------
Q5QVF2_IDILO          ------------------------------------------------------------
Q5E3D5_ALIF1          ------------------------------------------------------------
SECF_HAEIN            LP----------------------------------------------------------
D4ZB75_SHEVD          ------------------------------------------------------------
C3LVV7_VIBCM          ------------------------------------------------------------
E1SV06_FERBD          ------------------------------------------------------------
A1S8J4_SHEAM          ------------------------------------------------------------
B7VU09_VIBTL          ------------------------------------------------------------
B7VQK9_VIBTL          ------------------------------------------------------------
Q15N35_PSEA6          ------------------------------------------------------------
Q3IL51_PSEHT          ------------------------------------------------------------
A0KLF0_AERHH          ------------------------------------------------------------
Q2RTI2_RHORT          ------------------------------------------------------------
C5ZWZ3_9HELI          ------------------------------------------------------------
C3XE90_9HELI          ------------------------------------------------------------
E7A9U2_HELFC          ------------------------------------------------------------
A8ERU7_ARCB4          ------------------------------------------------------------
D1B3G6_SULD5          ------------------------------------------------------------
A6Q513_NITSB          ------------------------------------------------------------
E4U019_SULKY          ------------------------------------------------------------
A7ZE41_CAMC1          ------------------------------------------------------------
E1YHR4_9DELT          ------------------------------------------------------------
A8ZW13_DESOH          ------------------------------------------------------------
B8F9E2_DESAL          ------------------------------------------------------------
E1QIL9_DESB2          ------------------------------------------------------------
C7LN35_DESBD          ------------------------------------------------------------
C4XR64_DESMR          ------------------------------------------------------------
C8X141_DESRD          ------------------------------------------------------------
B8J2Q5_DESDA          ------------------------------------------------------------
A0A0H3AA07_DESVV      ------------------------------------------------------------
Q1MSC2_LAWIP          ------------------------------------------------------------
Q3A3C5_PELCD          ------------------------------------------------------------
Q2LVH3_SYNAS          ------------------------------------------------------------
SECF_CALNY            ------------------------------------------------------------
D4H482_DENA2          ------------------------------------------------------------
SECF_MAGMM            ------------------------------------------------------------
SECF_DESIS            ------------------------------------------------------------
E8T6K2_THEA1          ------------------------------------------------------------
SECF_AQUAE            ------------------------------------------------------------
D3SMD0_THEAH          ------------------------------------------------------------
B4U6P7_HYDS0          ------------------------------------------------------------
C0QRM5_PERMH          ------------------------------------------------------------
SECF_PETMO            ------------------------------------------------------------
C5CF37_KOSOT          ------------------------------------------------------------
A7HMQ5_FERNB          ------------------------------------------------------------
A6LP85_THEM4          ------------------------------------------------------------
Q9WZW5_THEMA          ------------------------------------------------------------
B8JH53_ANAD2          ------------------------------------------------------------
Q1D3B7_MYXXD          ------------------------------------------------------------
E1X0T7_HALMS          ------------------------------------------------------------
Q6MKZ3_BDEBA          ------------------------------------------------------------
A9F8C8_SORC5          ------------------------------------------------------------
D0LJ87_HALO1          ------------------------------------------------------------
B3T9T6_9ZZZZ          ------------------------------------------------------------
D2BGI5_DEHMV          ------------------------------------------------------------
A9WGQ9_CHLAA          ------------------------------------------------------------
A9B5U8_HERA2          ------------------------------------------------------------
SECF_ANATU            ------------------------------------------------------------
SECF_THET1            ------------------------------------------------------------
D1C4J4_SPHTD          ------------------------------------------------------------
B4WJX7_SYNS7          ------------------------------------------------------------
SECF_ACAM1            ------------------------------------------------------------
A0A0H3K5W7_SYNP6      ------------------------------------------------------------
B8HQ25_CYAP4          ------------------------------------------------------------
SECF_SYNP2            ------------------------------------------------------------
SECF_SYNY3            ------------------------------------------------------------
D3EPH1_ATETH          ------------------------------------------------------------
Q2JKR7_SYNJB          ------------------------------------------------MTAQELSPVDPA
Q7NDR5_GLOVI          ------------------------------------------------------------
SECF_PROMA            ------------------------------------------------------MSFTPK
A2CA57_PROM3          ----------------------------------------------------MAVSSSSG
Q46L53_PROMT          ------------------------------------------------------------
A5GTK4_SYNR3          ------------------------------------------------------MTSSSG
Q7V1E6_PROMP          ------------------------------------------------------------
B5Y8Y1_COPPD          ----------------------------------------------------MKNVWFGF
D4JXA7_9FIRM          NNKK--------------------------------------------------------
E6UEG8_RUMA7          NEKK--------------------------------------------------------
D4LA66_RUMC1          KQKK--------------------------------------------------------
A0A2N0UMZ5_9FIRM      RGHK--------------------------------------------------------
E1PK78_MAGIU          QNIP--------------------------------------------------------
E6U7Q5_ETHHY          KNEPKVRESQIDVPDEPAAQPKQDIGRRHHGTAPTIMDMDSGRRSVQPDQQAGSDAEEKG
A3DDV8_HUNT2          ------------------------------------------------------------
B8I6M7_RUMCH          ------------------------------------------------------------
E0RMP8_PAEP6          ------------------------------------------------------------
C6D7X9_PAESJ          ------------------------------------------------------------
C0ZAP7_BREBN          ------------------------------------------------------------
SECF_ALIAD            ------------------------------------------------------------
Q5WHQ4_BACSK          ------------------------------------------------------------
D6XWY7_BACIE          ------------------------------------------------------------
B1YJQ6_EXIS2          ------------------------------------------------------------
B7R9G0_9THEO          ------------------------------------------------------------
D9TNU6_THETC          ----------------------------------------------------------MR
C6PXQ6_9CLOT          ------------------------------------------------------------
Q892A5_CLOTE          ------------------------------------------------------------
A6LTN3_CLOB8          ------------------------------------------------------------
Q97GT8_CLOAB          ------------------------------------------------------------
D9SMV1_CLOC7          ------------------------------------------------------------
A6TQN5_ALKMQ          ------------------------------------------------------------
E3GFZ4_9FIRM          ------------------------------------------------------------
D9TIR8_CALOO          ------------------------------------------------------------
D9RXQ1_THEOJ          ------------------------------------------------------------
D9QVJ2_ACEAZ          ------------------------------------------------------------
E4RIJ9_HALHG          ------------------------------------------------------------
B2A264_NATTJ          -----------------------------------------------------------M
A0A1H8CTT8_9FIRM      ------------------------------------------------------------
D1BLM5_VEIPT          ------------------------------------------------------------
SECF_ACIFV            ------------------------------------------------------------
C8W4E2_DESAS          ------------------------------------------------------------
A5D3H0_PELTS          ------------------------------------------------------------
A4J545_DESRM          ------------------------------------------------------------
B1I4K4_DESAP          ------------------------------------------------------------
C9R7V2_AMMDK          ------------------------------------------------------------
B0TF82_HELMI          ------------------------------------------------------------
D5XEJ7_THEPJ          ------------------------------------------------------------
Q2RHU7_MOOTA          ------------------------------------------------------------
D7CLE8_SYNLT          ------------------------------------------------------------
Q0AX23_SYNWW          ------------------------------------------------------------
SECF_SEBTE            ------------------------------------------------------------
E3CUY4_9BACT          -----------------------------------------------------------M
D5EDU6_AMICL          -----------------------------------------------------------M
D4M8L9_9BACT          ------------------------------------------------------------
E6SLR1_THEM7          ------------------------------------------------------------
B5H469_STRC2          -----------------------------------------------MNHVARGGLLFVF
SECF_GEMAT            ------------------------------------------------------------
Q67LL9_SYMTH          ------------------------------------------------------------
C4RGU1_MICS3          ---------------MA----------------------KTGLA--------------SR
D2S9H9_GEOOG          DAGLPREGGTGSRRPRH----------------------RGSLS--------------HR
D3PYP6_STANL          ---MTTDKDRGADKPVK----------------------KPGVL--------------SR
SECF_MYCLE            IDEPDRNDNTDDNGAGAVEVTEAAEDAVELTNDISTQLPQHGFLARFYTGL-------SR
B1MCI7_MYCA9          TDKDVAEDATDATASTAQEPKSTAVETV-------SAAPEHGFL--------------YR
Q5YTF3_NOCFA          RDEDRAQSAVDDFAYGS-------------------GAPRHGFF--------------NR
D0LCM9_GORB4          TDLTKASGGTDPVTEVIDTATTEQPSPSMGSDADFVSDSKRSFL--------------SR
D6Z7I7_SEGRD          SEKPVHTREAKKETDAVDQTELED-------DGQERAAGRPSLF--------------TR
D5UNI8_TSUPD          SDTTTQVSEQEK---------------------------KAGFF--------------TK
C3PGQ3_CORA7          ---------MAVETTNR----------------------KISRF--------------DR
Q79VF7_CORGL          TDSQTESLSTQSVKPAK----------------------KRSWF--------------NS
D9QAR8_CORP2          ---------------MS----------------------SKGVL--------------NK
C4LIX4_CORK4          ---------------MS----------------------KRPFF--------------ER
Q4JVE2_CORJK          TELSAAEANPVDAPDSE----------------------AQGFF--------------EK
B1VDK1_CORU7          TDTAMSSVNTAQPKEQD----------------------KGSRL--------------SQ
C6WCM8_ACTMD          -------------MSST--------------------PRKASVF--------------QR
C7MR00_SACVD          --MGESTVNTTNAAGQE--------------------PAKQSVF--------------QR
C8XE15_NAKMY          TPAAVSAAATGDKLYGR----------------------QAGFL--------------SR
A0LUK2_ACIC1          ---------------------------------------MSKLGS-----------IGHG
D7BWW9_STRBB          ---------------------------------------MSRLGT-----------LGAR
Q0RNU2_FRAAA          ---------------------------------------MALLG---------------R
D1AEV5_THECD          ---------------------------------------MPAIRA-----------VLSR
C7QJQ2_CATAD          ---------------------------------------MSASNS-----------WGNR
D7BNQ3_ARCHD          ---------------------------------------MLSMYK-----------IGND
D6ZHF3_MOBCV          ---------------------------------------MMSYAQ-----------WGNA
A0JXA8_ARTS2          --------------------------------------MTTNFAT-----------FGNE
C5CCH8_MICLC          ---------------------------------------MNRFAD-----------WGNA
D2NT09_ROTMD          ---------------------------------MATDVKPNAFAR-----------FGND
B0REC3_CLAMS          ---------------------------------------MAGFSE-----------FGND
Q6AFB1_LEIXX          --------------------------------------MASRLTQ-----------FGND
A6WCH5_KINRD          ----------------------------------------MGMAQ-----------LGNR
D1BGW3_SANKS          --------------------------------------MAVGFAQ-----------WGND
D1BSK2_XYLCX          -------------------------------------MAGFSFAA-----------WGND
C7MCC3_BRAFD          --------------------------------------MTASFAR-----------FGND
E6SB76_INTC7          ---------------------------------------MINFAQ-----------FGND
C7NI43_KYTSD          ----------------------------------------MGFAQ-----------FGND
Q83MZ6_TROWT          ---------------------------------------MAWFAR-----------FSDD
D4HDX0_CUTAS          -----------------------MTDDMNAQTSSVATKRPSDGATGKKRKR----SFTHA
D7GDS8_PROFC          -----------------------------MSESTSTLDRPADHGTDKARKGKYTGNFAHR
D2PVF2_KRIFD          ---------------------------------------MSKLGT-----------IGAK
A1SJB0_NOCSJ          ---------------------------------------MGKFSR-----------LGND
C7LYS7_ACIFD          -------------------------------MSQVRIVEDASQLS-----------WWRR
Q1AWC9_RUBXD          ------------------------------------------------------------
E1QZN4_OLSUV          -----------------------------------------------------------M
D8IEE2_BRAP9          ------------------------------------------------------------
                                                                                  

E1R5K6_SEDSS          -------FTKIRYLMFVVSL----------------------------------------
E0RQA8_SPITD          -------FTRYRALAITLSL----------------------------------------
SECF_BORBU            -------FSKYGSNVLIVSA----------------------------------------
SECF_TREPA            -------FSLLFLPCAILSV----------------------------------------
Q73PW5_TREDE          -------FSKFFVPCIILSI----------------------------------------
B0SPU5_LEPBP          -------FTKYKYFTLSISF----------------------------------------
Q72PD4_LEPIC          -------FIKYKYVSICISL----------------------------------------
SECF_DICTD            -------FLGKRVRRVFMIL----------------------------------------
B0VHR6_CLOAI          -------IQFVKSRYWFYGI----------------------------------------
A1BCH7_CHLPD          -------FDFIKYRKISYAI----------------------------------------
SECF_RHOM4            -------YPFVQHRKKAYVF----------------------------------------
Q9WXE9_PRERU          -------FNFMSSYKKSYTI----------------------------------------
D5MHP4_9BACT          -------IDFVAWRRIAFAV----------------------------------------
D8PI88_9BACT          -------IDFMGKRSITFVI----------------------------------------
B6ANM4_9BACT          -------IDFMGKRKISLTI----------------------------------------
B5ECA5_GEOBB          -------IDFIGKRKVSFVI----------------------------------------
B3E2R7_GEOLS          -------FDFIGKRNISFVI----------------------------------------
SECF_THEYD            -------IDFLGKKYIALAL----------------------------------------
SECF_KORVE            -------IDFLGKKWYFLAF----------------------------------------
E8X5J9_GRATM          -------VDWLGKKWYFLAF----------------------------------------
Q029K3_SOLUE          -------FDFLGKKWPFIIA----------------------------------------
SECF_ELUMP            -------FDFLKIRKYFYAV----------------------------------------
SECF_UNCTG            -------IDFIGNRYKFFTI----------------------------------------
D0RNY4_9PROT          ------NISFLKFYKQFYLL----------------------------------------
B6BPL7_9PROT          ------MIAFNKYYNHFNIF----------------------------------------
B4WED0_9CAUL          ------NFHFVKYARFAAVL----------------------------------------
D5VIW1_CAUST          ------KFRFVRWAPVAAVF----------------------------------------
Q0BS57_GRABC          ------RIRFMKGRFAGLAT----------------------------------------
C6XJ03_HIRBI          ------KIGFMKLRFGAFAL----------------------------------------
Q0ANE7_MARMM          ------KIPFIRARWIALAV----------------------------------------
Q0C0W7_HYPNA          ------KIPFMRYRYVGVVL----------------------------------------
E2CQN2_9RHOB          ------KFRFMWLRSVSFPL----------------------------------------
A7HXL1_PARL1          ------NFQFVKWRYIAVGL----------------------------------------
D8JWH2_HYPDA          ------NLPFMKVKGPALVL----------------------------------------
E3I015_RHOVT          ------NFHFVKYFKVCFAL----------------------------------------
B0UI93_METS4          ------HFDFMRLRRFSFPL----------------------------------------
B2II62_BEII9          ------RFPFMRLRRLSYPF----------------------------------------
E6VHR2_RHOPX          ------HFDFTQFRRISFPI----------------------------------------
A7IND7_XANP2          ------NIHFMRLRHWTFPF----------------------------------------
D5BQT4_PUNMI          ------NFDFLKLQKITMVL----------------------------------------
Q2W4A8_MAGSA          ------KYDFIRYRWFAFCI----------------------------------------
B6ISI3_RHOCS          ------AIDFVKWRFFGFGI----------------------------------------
Q2NBX9_ERYLH          ------NIKFLKWRVPFYVV----------------------------------------
Q1GSE6_SPHAL          ------NIQFLKWRNVAMAI----------------------------------------
D4YYJ1_SPHJU          ------NIGFVKLRHWAFAL----------------------------------------
SECF_RHOCB            ------NFDFFRWQWATFGA----------------------------------------
SECF_KETVY            ------SVNFFKWGGIPTHA----------------------------------------
D0D195_9RHOB          ------SFDFFKHWKLWLGI----------------------------------------
SECF_RICPR            ------DFDFMNFKKVSYSF----------------------------------------
A5CDU1_ORITB          ------NIDFIRLRKLNYVV----------------------------------------
B9KH24_ANAMF          ------NFNFIKHRKLALLI----------------------------------------
Q2GI09_EHRCR          ------NIDFSKYRICALSC----------------------------------------
Q5GT97_WOLTR          ------NIKFSKYRKLTALI----------------------------------------
C6V4R4_NEORI          ------SFDFAKYKKAAFLI----------------------------------------
C1D5X5_LARHH          KHILKHDIPFMSYGKLTTSI----------------------------------------
B1XW93_LEPCP          ---FRRDIPFMRHALVFNVI----------------------------------------
B6BWI7_9PROT          ---VKNDIPFLKYRKIAAFI----------------------------------------
A5EWX6_DICNV          -----PYIHYMNYARHALIL----------------------------------------
C0N4C3_9GAMM          ------NIQFMSKRRLAAIF----------------------------------------
A5CVL6_VESOH          ------TINFIGKRTYAIIF----------------------------------------
A1WXP7_HALHL          ------NIDFLGRRRIGFGL----------------------------------------
Q31FZ8_HYDCU          ------EYNFMGHRKLAMSV----------------------------------------
D3S9V5_THISK          ------NLDFLGKRKITITV----------------------------------------
D3RSH8_ALLVD          ------NIDFMRQRKAAAWL----------------------------------------
C7RB48_KANKD          ------NYDFLKVRKFAFAL----------------------------------------
A4GK29_9BACT          -----MNIQFMKFRKLALTF----------------------------------------
A4GHV4_9BACT          -----FNIDFLAWRRIALIF----------------------------------------
B8KFI4_9GAMM          -----KTINFMGKRRVAAVF----------------------------------------
Q21KV9_SACD2          -----KILNFMGQRKLAAVF----------------------------------------
Q2SDV4_HAHCH          -----KVYNFMGIAKPALAL----------------------------------------
E4PKE9_MARAH          -----QPFDFMGLRKIASII----------------------------------------
A6VYM8_MARMS          -----TNIPFMAMRKIVAVF----------------------------------------
E1V6F3_HALED          -----RQFDFMGKRRYAFIF----------------------------------------
Q0VS96_ALCBS          -----MNINFMAARKPLGVL----------------------------------------
B3PDJ9_CELJU          -----RVINFMGVRHYTSAI----------------------------------------
Q8GEL5_PSEPU          EGAAMKTINFMGVRNVAFAI----------------------------------------
D0SG96_ACIJO          --DDERVIDFMKIALPAAIL----------------------------------------
Q1QBR5_PSYCK          AVGDQRIIPFMKLEKPMGIL----------------------------------------
Q83CH4_COXBU          ------KIPFMRQRKWAGIF----------------------------------------
Q5ZU08_LEGPH          ------KIDFMGARRWTALF----------------------------------------
A0A0B3WJC7_FRATU      ------SIDFLGIKKYTTVF----------------------------------------
B8L1U9_9GAMM          ------KIDFMRWRHVAMAV----------------------------------------
D0KW98_HALNC          ------KFDFFGKRKYAYII----------------------------------------
B7J4R6_ACIF2          ------HVDFMSRRWIFLGV----------------------------------------
SECF_ECOLI            ----RKVYDFMRWDYWAFGI----------------------------------------
Q8D162_YERPE          ----RKVYDFMRWDYVAFGV----------------------------------------
Q1LSN7_BAUCH          ----IKVYDFMRWSFIAFSS----------------------------------------
Q7VQA8_BLOFL          ----FKIYNFVSHGRIILFC----------------------------------------
E8Q616_BLOVB          ----NKVYDFIFYGRDVFFV----------------------------------------
Q493H0_BLOPB          ----YKIYDFLAWKRLIFFL----------------------------------------
A0KJ23_AERHH          -------IPFMRYARPGVVF----------------------------------------
Q0HWQ6_SHESR          -------VNFLRHALPISIM----------------------------------------
C4L7L0_TOLAT          -------IPFMRLALPSTIF----------------------------------------
Q5QVF2_IDILO          -------LPFMRFRGIMGII----------------------------------------
Q5E3D5_ALIF1          -------IDFMRWSKAAFLF----------------------------------------
SECF_HAEIN            ----FPLTEFMKVRKLGYIL----------------------------------------
D4ZB75_SHEVD          -----------KLRYLTSLI----------------------------------------
C3LVV7_VIBCM          -------------RYITGII----------------------------------------
E1SV06_FERBD          -----------HWRYLTAAF----------------------------------------
A1S8J4_SHEAM          -----------RFRHLMTLI----------------------------------------
B7VU09_VIBTL          -----------RLRKVMSVI----------------------------------------
B7VQK9_VIBTL          -----------KIRQLMTMI----------------------------------------
Q15N35_PSEA6          --VHSPMAMFSKVRLAGFYL----------------------------------------
Q3IL51_PSEHT          -----------RMRFIGLVL----------------------------------------
A0KLF0_AERHH          --RMIIAMGLTRWRYIGLWA----------------------------------------
Q2RTI2_RHORT          ---------FLVSRARVMAA----------------------------------------
C5ZWZ3_9HELI          ------IYDFVKMSNYGIVL----------------------------------------
C3XE90_9HELI          ------IFDFVRWSKYGLIA----------------------------------------
E7A9U2_HELFC          ------VLDFMSYARFTLPF----------------------------------------
A8ERU7_ARCB4          ------IYDFMGKKWPFLIF----------------------------------------
D1B3G6_SULD5          ------IYNFMKYGRSFVLS----------------------------------------
A6Q513_NITSB          ------IYNFMGKAKLFMAI----------------------------------------
E4U019_SULKY          ------VYNFLGKGKIFFVA----------------------------------------
A7ZE41_CAMC1          ------VYDFMRFRFVSLAF----------------------------------------
E1YHR4_9DELT          ------KIDFIGKRYIAFSL----------------------------------------
A8ZW13_DESOH          ------TIDFVGKQKYAFVF----------------------------------------
B8F9E2_DESAL          ------NIDIIGKRFFAYAF----------------------------------------
E1QIL9_DESB2          ------NIDFIGKRYLAFAA----------------------------------------
C7LN35_DESBD          ------NIDFVGMRKYAYVL----------------------------------------
C4XR64_DESMR          ------NINFLKYRKLAYLV----------------------------------------
C8X141_DESRD          ------AVNFIGRRKIALVV----------------------------------------
B8J2Q5_DESDA          ------NIDFIGKRYWVYGI----------------------------------------
A0A0H3AA07_DESVV      ------KIDFVGMRRIAYVL----------------------------------------
Q1MSC2_LAWIP          ------HINFVAKRHLAYII----------------------------------------
Q3A3C5_PELCD          ------NINFVGWRKLALIF----------------------------------------
Q2LVH3_SYNAS          ------HFNFVAMMKMAVTI----------------------------------------
SECF_CALNY            ------NIDFLGKAKLFFII----------------------------------------
D4H482_DENA2          ------QFDFMSKTKIFFVI----------------------------------------
SECF_MAGMM            ------HFDFIGRRKPAIYA----------------------------------------
SECF_DESIS            ------YIPFMRLRTYAVAV----------------------------------------
E8T6K2_THEA1          ------FIG-KRYWAYLFSL----------------------------------------
SECF_AQUAE            ------QIKFLRLRKAAYGV----------------------------------------
D3SMD0_THEAH          ------QLDFMGVRYYAYAV----------------------------------------
B4U6P7_HYDS0          ------YIHFIKYRYYSYVI----------------------------------------
C0QRM5_PERMH          ------NIDFLKIKKQGYIF----------------------------------------
SECF_PETMO            ------NIDFVGKRSFFIYL----------------------------------------
C5CF37_KOSOT          ------NFDFVGKRKGFLTL----------------------------------------
A7HMQ5_FERNB          ------KIDFVGKRYFFMAL----------------------------------------
A6LP85_THEM4          ------MIDFIGKKNIFIVI----------------------------------------
Q9WZW5_THEMA          ------EIDFMGKSKIFITI----------------------------------------
B8JH53_ANAD2          ------KFDFVGKRHIAVAL----------------------------------------
Q1D3B7_MYXXD          ------NIDFISKRKPALFI----------------------------------------
E1X0T7_HALMS          ------KINFVNKFSITTVI----------------------------------------
Q6MKZ3_BDEBA          ------RFDFVGKAWFFGGV----------------------------------------
A9F8C8_SORC5          ------QFDFMSKRWLFIGL----------------------------------------
D0LJ87_HALO1          ------NFEFVGRTRVWVML----------------------------------------
B3T9T6_9ZZZZ          ------MIDIVRYRRWFFLI----------------------------------------
D2BGI5_DEHMV          ------MNKIIQHRPLFIFI----------------------------------------
A9WGQ9_CHLAA          ------MEHLVRRRYWWFAF----------------------------------------
A9B5U8_HERA2          ------MLDLVRRRYLWFAI----------------------------------------
SECF_ANATU            ------MLNILGKRYLFFAI----------------------------------------
SECF_THET1            ------MIDIVRWRYAFYLL----------------------------------------
D1C4J4_SPHTD          ------MIDIVGKRYWWFLL----------------------------------------
B4WJX7_SYNS7          -----MKLNVIKQKTLWWSI----------------------------------------
SECF_ACAM1            -----MKLNLNQQRGLWWTI----------------------------------------
A0A0H3K5W7_SYNP6      -----MTLQLTAQRRRWWWI----------------------------------------
B8HQ25_CYAP4          -----MKFSVMRQRSLWWSL----------------------------------------
SECF_SYNP2            ---MTFKFSVIKQRLLWWSI----------------------------------------
SECF_SYNY3            -----MKLDLFKWEKPAWIV----------------------------------------
D3EPH1_ATETH          -----MKLNIIKWRKAWWFI----------------------------------------
Q2JKR7_SYNJB          SRLLDYRFDIVGRSKLWFSL----------------------------------------
Q7NDR5_GLOVI          -----MKIEVAKSKSKWFTA----------------------------------------
SECF_PROMA            NLNVKYTFNVSRNRSKVWLI----------------------------------------
A2CA57_PROM3          TPQRPLRFELCRQRRRVWGV----------------------------------------
Q46L53_PROMT          -MKAKFNVQIYKNRKYVWLI----------------------------------------
A5GTK4_SYNR3          AILREPRLRINRHRRLCLSI----------------------------------------
Q7V1E6_PROMP          --MTSFSFNLIKNKNKIFGF----------------------------------------
B5Y8Y1_COPPD          PLFSKLPVEVVKNRKKFYTA----------------------------------------
D4JXA7_9FIRM          ------VFDFIGYRKVLFLI----------------------------------------
E6UEG8_RUMA7          ------NLDVVGHRKVFYCI----------------------------------------
D4LA66_RUMC1          ------VRDYVGHMHIYIII----------------------------------------
A0A2N0UMZ5_9FIRM      ------IIDFVGHKKIFFGI----------------------------------------
E1PK78_MAGIU          -----FKMSFYKQRYKFIAF----------------------------------------
E6U7Q5_ETHHY          EVYNGLHIDFIGKRRVFYTI----------------------------------------
A3DDV8_HUNT2          ----MFNFDYVGKRKYFFIL----------------------------------------
B8I6M7_RUMCH          ------MVNLYAKRYYFFIL----------------------------------------
E0RMP8_PAEP6          -----LKY--IKMSKWFYTF----------------------------------------
C6D7X9_PAESJ          -----VRFDFIKHRNKFFMF----------------------------------------
C0ZAP7_BREBN          ----VIRFDIVKNRRKFFIA----------------------------------------
SECF_ALIAD            ----KPRFDIIRASRWFFLL----------------------------------------
Q5WHQ4_BACSK          ----KWNVDLTKHRKRFFIG----------------------------------------
D6XWY7_BACIE          ----NTRLDFVKHRKKFFIA----------------------------------------
B1YJQ6_EXIS2          -----TKFDYVKHRNIYFII----------------------------------------
B7R9G0_9THEO          MNGHRFHIDVIGKTKIWFTI----------------------------------------
D9TNU6_THETC          WNNIKWNIDVIGKTKVWFTI----------------------------------------
C6PXQ6_9CLOT          ------MLKIIEKTKIWFAI----------------------------------------
Q892A5_CLOTE          ----MKTLKIIEKTKIWFGI----------------------------------------
A6LTN3_CLOB8          ------MLKIMEKTKLWFSI----------------------------------------
Q97GT8_CLOAB          ------MLKVIKHTKVWFGI----------------------------------------
D9SMV1_CLOC7          ------MFSVIKKTKLWFSI----------------------------------------
A6TQN5_ALKMQ          -------MRIIENKKIWFSI----------------------------------------
E3GFZ4_9FIRM          ----MKTLKLVEKSKIWFSI----------------------------------------
D9TIR8_CALOO          ----MTKIDFMGKRKYFYIV----------------------------------------
D9RXQ1_THEOJ          ----------MERKWLWFGI----------------------------------------
D9QVJ2_ACEAZ          -------MEIIGKRKIWFII----------------------------------------
E4RIJ9_HALHG          -------MDILGKRKIWYII----------------------------------------
B2A264_NATTJ          EYKGVRAMEIITNRKIWFIV----------------------------------------
A0A1H8CTT8_9FIRM      ----MARFDIIGKRKIWYAI----------------------------------------
D1BLM5_VEIPT          -----MTLDVIKHHRWWFAI----------------------------------------
SECF_ACIFV            ----MKKFSIVKHARIFFSI----------------------------------------
C8W4E2_DESAS          -----MLFEIVRRRKIWYVI----------------------------------------
A5D3H0_PELTS          MLRERMPFHFIKLRKIWYAI----------------------------------------
A4J545_DESRM          ------MFHIIKKRKIYYII----------------------------------------
B1I4K4_DESAP          ------MFHFVRQRKYWYLI----------------------------------------
C9R7V2_AMMDK          -----MRLHFVRWRFLWYAL----------------------------------------
B0TF82_HELMI          -------MEIIGRRKIWYAL----------------------------------------
D5XEJ7_THEPJ          -----MTLDIIGKRKIWFAI----------------------------------------
Q2RHU7_MOOTA          ---MNFNFDFVNRRKWWYAL----------------------------------------
D7CLE8_SYNLT          -------MKIIEHRKWFYLL----------------------------------------
Q0AX23_SYNWW          -------MQFIQNRKYFFIL----------------------------------------
SECF_SEBTE            -----MDLKLMKTRNVYFIF----------------------------------------
E3CUY4_9BACT          FDTSKWHIPFMKYRRLALGI----------------------------------------
D5EDU6_AMICL          F-RRDFSFKFMKHRRQAILL----------------------------------------
D4M8L9_9BACT          ---MNRNYNFMALRRPALSL----------------------------------------
E6SLR1_THEM7          ----MTGFSFVRSRGVAFAL----------------------------------------
B5H469_STRC2          ATGPVKGFGVTLAIGVLASLVSAMVITRLFADWAVRRGPVRRRPAWTGLTVRGRVRTLLE
SECF_GEMAT            MLRIFHNTKYEFVRWWRVAA----------------------------------------
Q67LL9_SYMTH          --MGLTRIRYMRYARHYLIF----------------------------------------
C4RGU1_MICS3          LYAGEAGLDVIGRRKLWFGV----------------------------------------
D2S9H9_GEOOG          LYNGEAGLDVVGRSRLIYRI----------------------------------------
D3PYP6_STANL          LYSGETTVDFIKRRLLWYGI----------------------------------------
SECF_MYCLE            LYTGTGVFEVVGRRRLWYSV----------------------------------------
B1MCI7_MYCA9          LYTGTGAVDVVGKRTLWFGI----------------------------------------
Q5YTF3_NOCFA          LYTGTGAIDVIGKRRMWYAI----------------------------------------
D0LCM9_GORB4          LYTGTGAFEIVGRRRMWYLV----------------------------------------
D6Z7I7_SEGRD          LYTGTGAFEIVGRRKLLFRV----------------------------------------
D5UNI8_TSUPD          LYTGTGAFDIIGRRNRYYIA----------------------------------------
C3PGQ3_CORA7          LYVDGSGFDFVGRAKTWYTI----------------------------------------
Q79VF7_CORGL          LYTGDGGIDFIAKTKLWYWI----------------------------------------
D9QAR8_CORP2          LYTGGGGLDFVGRRRTWYWT----------------------------------------
C4LIX4_CORK4          IYTGEGGIEFVSQRRRWYGI----------------------------------------
Q4JVE2_CORJK          LYNGNGGFRIVQNRGRLYGI----------------------------------------
B1VDK1_CORU7          MYNGTGNFPFVAKRRLWYQI----------------------------------------
C6WCM8_ACTMD          LYVGNGAFDIVGKRTRWYGI----------------------------------------
C7MR00_SACVD          LYTGTGAFDIVGHRRKWFLA----------------------------------------
C8XE15_NAKMY          LSTGTGAFNILGRRKVYYIV----------------------------------------
A0LUK2_ACIC1          LYTGQISFDFVGRWRRWFTL----------------------------------------
D7BWW9_STRBB          LYRGEVGYDFVGKRKIWYGI----------------------------------------
Q0RNU2_FRAAA          IYRSDFHVDFVGRRRVWYAV----------------------------------------
D1AEV5_THECD          IYKGEVSADIVGRPKLWYSL----------------------------------------
C7QJQ2_CATAD          LYRGEVSYDFIGKQKRWYTI----------------------------------------
D7BNQ3_ARCHD          LYTGRSSVNIIGRRKLWFSL----------------------------------------
D6ZHF3_MOBCV          LYSGKKSYGIIKNRRIPLTV----------------------------------------
A0JXA8_ARTS2          LYTGKRSYNFVSAKKIWFLI----------------------------------------
C5CCH8_MICLC          LYSGRISYPFIQRWRRWFAL----------------------------------------
D2NT09_ROTMD          LHSGARSYPFVGKRRLWLLL----------------------------------------
B0REC3_CLAMS          LYTGKRSFDIVGRRRLWYSI----------------------------------------
Q6AFB1_LEIXX          LYTGARSFAFVSKRTIWYTI----------------------------------------
A6WCH5_KINRD          LYTGESSFDFVGRRKLWFLI----------------------------------------
D1BGW3_SANKS          LYTGRKSYDIVGKRRKFYIA----------------------------------------
D1BSK2_XYLCX          LYTGRRSYPIVAQRKRWFTV----------------------------------------
C7MCC3_BRAFD          LHAGRRIVPIVTRRRVWYLF----------------------------------------
E6SB76_INTC7          LYTGRRSIDFVQRRKTWYGF----------------------------------------
C7NI43_KYTSD          LYTGRRQVDFIGRRKIWYLV----------------------------------------
Q83MZ6_TROWT          LYSGRRSIDFVGRYKIWYSA----------------------------------------
D4HDX0_CUTAS          LYTGEISYGFIQRRKVWYTV----------------------------------------
D7GDS8_PROFC          LYTGEFEFNFVARRKLWYSI----------------------------------------
D2PVF2_KRIFD          LHRGEISYDFVGKRKLWFTV----------------------------------------
A1SJB0_NOCSJ          LYSGDKSIDFVGRKWLWYAI----------------------------------------
C7LYS7_ACIFD          VGAGATRIRFVERARWFWAV----------------------------------------
Q1AWC9_RUBXD          -------MDFVRRWRLWFAI----------------------------------------
E1QZN4_OLSUV          RSHFSREIPIIYHRRQFLAI----------------------------------------
D8IEE2_BRAP9          -DVTKNKIPFVKFMPVAAVI----------------------------------------
                                                                                  

E1R5K6_SEDSS          ----------------SLILAGIVGTIS-LGGFNL-----------GIDFQAGLSQRVQI
E0RQA8_SPITD          ----------------LVIVAGGVATFF-QGGFNL-----------GIDFRAGLTERVAV
SECF_BORBU            ----------------VLILVGLIYTFFYHGGYNW-----------GIDFSSRVNINLSI
SECF_TREPA            ----------------VLIGAGVLRWAL--WGMSF-----------GIDFQSGLIERLRI
Q73PW5_TREDE          ----------------GLIAFGIIGYFT--KGINF-----------GIDFQAGFIEKVKI
B0SPU5_LEPBP          ----------------LVIVFGFVVTFSKYGGFAH-----------SLDFNGGLRTVVEL
Q72PD4_LEPIC          ----------------ALIVFGFSYTYAVHGGFAN-----------SLDFNGGLRTVVEF
SECF_DICTD            ----------------SLLFVIIGMYFFFTKGLNY-----------SIDFQSG---SVIY
B0VHR6_CLOAI          ----------------SIALLLISLCGIIFKGLNW-----------SIDFTSGIAATVNL
A1BCH7_CHLPD          ----------------SVFLLLIGIGSLFVKGLNY-----------GIDFRGGSEVLIRF
SECF_RHOM4            ----------------SGVLILLSLVSLVTRGLEL-----------GIDFKGGMEFIISG
Q9WXE9_PRERU          ----------------WIVFAIICCISFYVRGLSR-----------SIDFTGGRNYVVTL
D5MHP4_9BACT          ----------------SSVLCLLGVISIIQIGRG--------AANLGIDFAGGTSVQLKF
D8PI88_9BACT          ----------------SGILAFLGLIAVLQIARG--------AANLGIDFAGGTAVQLKF
B6ANM4_9BACT          ----------------SAVFLLLGLVALLQISRG--------KANLGIDFVGGTAVQVHF
B5ECA5_GEOBB          ----------------STIIAIIGLIGILQIARN--------SANMGIDFSGGTSVQLSF
B3E2R7_GEOLS          ----------------SAIISIIGIIAIIQMFRG--------AANMGIDFTGGTSVQLKF
SECF_THEYD            ----------------SCIMIILGIFAIFQIHAG--------KANLGVDFAGGLSLQIRF
SECF_KORVE            ----------------SLVFSVAGLISMGARYAKTG-----TAVPLGVDFKGGTLVYVKF
E8X5J9_GRATM          ----------------SLVFSVAGVFSLLFWHH----------LPLGVDFKGGTQVVTRF
Q029K3_SOLUE          ----------------SLVLTAAGAASVLMQGG----------LKFGIDFKGGALMTVKF
SECF_ELUMP            ----------------SAIILIAGLICILTRG-----------LNMGIDFKGGTMVQVQF
SECF_UNCTG            ----------------SGLLLLLTVGAFIYRGG----------LNYGIDFTGGILMRISF
D0RNY4_9PROT          ----------------SFLLIVISFISFFSN-----------GLNLGIDFKGGTVIEMQ-
B6BPL7_9PROT          ----------------SSLLIIFSLVLLIFK-----------GLNFGIDFKGGTLIELRS
B4WED0_9CAUL          ----------------SVVLCVASIVACFVP-----------GLNMGIDFRGGASMEVSK
D5VIW1_CAUST          ----------------SAILIVGSVASLFVQ-----------GLNLGIDFKGGNALEIA-
Q0BS57_GRABC          ----------------SAVLSLISIVLFFHP-----------GLNEGIDFRGGIVIEAR-
C6XJ03_HIRBI          ----------------SLVLIIASIAMVATR-----------GLNFGIDFVGGVVIEIE-
Q0ANE7_MARMM          ----------------SGLFILFSMFEFATV-----------GINFGIDFRGGIQTEVT-
Q0C0W7_HYPNA          ----------------SVIMMVASVYLVMTR-----------GLNLGVDFAGGSVVELR-
E2CQN2_9RHOB          ----------------SIVLVIASIALFVTV-----------GLNYGIDFKGGTIVEIKT
A7HXL1_PARL1          ----------------SLLVMVVSSALLITR-----------GLNFGIDFEGGIVIEIST
D8JWH2_HYPDA          ----------------SIIAMVVSIGLIGIK-----------GLNYGVDFKGGSLIELKT
E3I015_RHOVT          ----------------SIIGIVGTVVLLFIQ-----------GLNFGIDFKGGTLMQVQT
B0UI93_METS4          ----------------SALMSVGTLVLFLII-----------GLNFGIDFKGGTLIELRP
B2II62_BEII9          ----------------SALMSILAVTIFLTW-----------GMNFGIDFSGGTLLELRA
E6VHR2_RHOPX          ----------------SAVLSILAITLFFTH-----------GVNFGIDFKGGTLLEVRD
A7IND7_XANP2          ----------------SAVISIVAVVLFAIH-----------GFNLGIDFKGGTLIEAQT
D5BQT4_PUNMI          ----------------STFLVLASIGMFATV-----------GLNLGIDFKGGILLEARN
Q2W4A8_MAGSA          ----------------TAVLIIGSFASIAIK-----------GFNFGIDFAGGILLEAQS
B6ISI3_RHOCS          ----------------SLILVLITIGGLFST-----------GLNLGIDFRGGILIEARA
Q2NBX9_ERYLH          ----------------SLLLMAASWALVFTN-----------GLNYGVDFAGGQEIRATF
Q1GSE6_SPHAL          ----------------SLLMIVASIALVAVR-----------GLNLGVDFVGGQSVRVEF
D4YYJ1_SPHJU          ----------------TALLTVLAVGATFYK-----------GLNLGVDFVGGLMIEAKF
SECF_RHOCB            ----------------AIVMMIASVILPLVI-----------GLNFGIDFKGGTTIRTES
SECF_KETVY            ----------------TFALALASLIAVMTI-----------GLNYGIDFLGGTTIRAES
D0D195_9RHOB          ----------------SGVMLMLAMVSFGVR-----------GLNYGIDFMGGTTIRTES
SECF_RICPR            ----------------SIILSLISLIWISIY-----------KFNFGIDFVGGIVIEVRL
A5CDU1_ORITB          ----------------SILLIIFSIASLLIF-----------KLNLSTSFIGGINLEVKI
B9KH24_ANAMF          ----------------SLVLLLGSALLIALK-----------GVTLGADFTGGMVANFSL
Q2GI09_EHRCR          ----------------SGVLMLISILLVLLK-----------GICFGTDFAGGIIIELRA
Q5GT97_WOLTR          ----------------SIILVIFSLFIVVLR-----------GVNLGIDFTGGILMEIKS
C6V4R4_NEORI          ----------------SSTLLVVAFVFLETK-----------GLSFGIDFTGGMVLEVYS
C1D5X5_LARHH          ----------------SLLTFIAAVFFLFSK-----------GLNLSVEFTGGTVMEVQY
B1XW93_LEPCP          ----------------SFLTFAAAVFFLITR-----------GLHLSIEFTGGTVIETEY
B6BWI7_9PROT          ----------------SIITFILAFFFLFQK-----------GLNYGVDFTGGTIIEISY
A5EWX6_DICNV          ----------------SGILTVLCLLLMIFR-----------GFNFGLDFTGGATIELQY
C0N4C3_9GAMM          ----------------SAILIIASITSLAVQ-----------GLNFGIDFTGGTMIELGY
A5CVL6_VESOH          ----------------SVLLISVSIFSLTTK-----------GLKLGIDFKGGTLIEVGY
A1WXP7_HALHL          ----------------SAVLLVLSIGSLLWQ-----------GLNLGIDFTGGTLVEVGY
Q31FZ8_HYDCU          ----------------SLFFIVASIIGLFVK-----------GLNFGIDFTGGTIVELSY
D3S9V5_THISK          ----------------SLILILISVALLATR-----------GLNFGIDFTGGTLVEVGY
D3RSH8_ALLVD          ----------------SGAVLIVCLLSIVFR-----------GFDFGLDFTGGTVIELGY
C7RB48_KANKD          ----------------SAILIIASIVSFFTK-----------GLNYGLDFTGGTLVEVSY
A4GK29_9BACT          ----------------SFALLLISIVSLVFK-----------NLELGLDFTGGVLVEIQL
A4GHV4_9BACT          ----------------SSVFLILSIGSWLFK-----------DLNYGLDFTGGTLVELSY
B8KFI4_9GAMM          ----------------SALLIVTALGSLVFK-----------QLNWGLDFTGGTLVEVHY
Q21KV9_SACD2          ----------------SILLLVGSIVSLTVQ-----------GLNFGLDFTGGTQLEYKY
Q2SDV4_HAHCH          ----------------SVIMIIISIVSIATR-----------GLSFGLDFTGGTLVEVEY
E4PKE9_MARAH          ----------------SISLIVVSIALLATR-----------GLNFGMDFTGGTSVEFEY
A6VYM8_MARMS          ----------------SLTLILISLVSLATK-----------GLQFGLDFTGGTLIEVAY
E1V6F3_HALED          ----------------SVATLLISLVAILVQ-----------GLNLGLDFTGGTLVEVRY
Q0VS96_ALCBS          ----------------SLALVIISVVLLLTR-----------GLNLGLDFTGGTTVVVKS
B3PDJ9_CELJU          ----------------SIVFVLISFAALAVN-----------GLKLGLDFTGGTQLEVLF
Q8GEL5_PSEPU          ----------------TVLLTVLALFSWWQK-----------GLNFGLDFTGGTLIELTY
D0SG96_ACIJO          ----------------SIVLTIGSLFFIFTK-----------GLNLGLDFTGGISAELNY
Q1QBR5_PSYCK          ----------------SIILVIGSIIAIAVN-----------GLNLGLDFTGGVSADVRY
Q83CH4_COXBU          ----------------SAIIFLASIITLAVN-----------GLNLGLDFTGGTQVEV-N
Q5ZU08_LEGPH          ----------------SILIFVVSIGALMIN-----------GLKWGLDFTGGTQIEI-S
A0A0B3WJC7_FRATU      ----------------SVLMIVVSLFFIFTK-----------GLNLGLDFTGGYQVQIQT
B8L1U9_9GAMM          ----------------TIVVFLASIAIIGFK-----------GFNYALDFTGGTLIEARF
D0KW98_HALNC          ----------------SALLLIAAIVSLSTR-----------GINLGLDFTGGVVLEVGY
B7J4R6_ACIF2          ----------------SALLIIASVAVFLVR-----------GLNYSIDFTGGTLVELAF
SECF_ECOLI            ----------------SGLLLIAAIVIMGVR-----------GFNWGLDFTGGTVIEITL
Q8D162_YERPE          ----------------SLLLLVASIVVMSTK-----------GFNWGLDFTGGTVIEINL
Q1LSN7_BAUCH          ----------------SVILFLASIIVIFMQ-----------GFNWGLDFTGGTIVELHL
Q7VQA8_BLOFL          ----------------SMFLCILLCTSMIIK-----------GFNWGIDFTGGLLIEIES
E8Q616_BLOVB          ----------------FIFLCAISFIVMKLY-----------NFNWGLDFTGGLLIEVVS
Q493H0_BLOPB          ----------------SIFLFFISCCTMITR-----------GFNWGLDFTGGMLVEISS
A0KJ23_AERHH          ----------------STLLMVISLFFLFDR-----------GLNWGLDFTGGTTIEVGF
Q0HWQ6_SHESR          ----------------SAILVFGSLVSLATK-----------GINWGLDFTGGTVVEMEF
C4L7L0_TOLAT          ----------------SCILILLSIFTIATK-----------GFNWGLDFTGGTIAELKF
Q5QVF2_IDILO          ----------------SAVLVVASIVSLSVN-----------KLNFGLDFTGGTLLEVGF
Q5E3D5_ALIF1          ----------------SMLMIIASIATLSTK-----------WLNWGLDFTGGTLIEVGF
SECF_HAEIN            ----------------SALLMVISLFFIITK-----------GFNWGLDFTGGVVFDTHF
D4ZB75_SHEVD          ----------------SLSLMILSLSVIAVK-----------GFNWGLDFTGGVVTEVKL
C3LVV7_VIBCM          ----------------SVLLMVISLGAFAIK-----------GLNMGLDFTGGMVTEAII
E1SV06_FERBD          ----------------SILLTVAALLALGIR-----------GLNWGMDFTGGVITEVKM
A1S8J4_SHEAM          ----------------SVVALLLSVLAISTR-----------GFNLGLDFTGGAFAEVAM
B7VU09_VIBTL          ----------------SIVLFMSSVMLVAVK-----------GFNWGLDFTGGVVAEVQL
B7VQK9_VIBTL          ----------------SLILLTLSITSIVAR-----------GFNWGLDFTGGVVADIQT
Q15N35_PSEA6          ----------------AISLMLLSAIGLGFK-----------GLNLGLDFTGGYMTEFTT
Q3IL51_PSEHT          ----------------STVLVLLSVVTLAQK-----------GLNFGLDFTGGYLTEFTT
A0KLF0_AERHH          ----------------SVLLTVASIAVLAIN-----------GLSLGLDFTGGILLEFRI
Q2RTI2_RHORT          ----------------SAALLLVCLLALGLR-----------GLDLGIDFTGGLVVEART
C5ZWZ3_9HELI          ----------------SLILFIGSLILFVKP-----------GFTLGVDFAGGTIIQIQY
C3XE90_9HELI          ----------------SILLTLASFYLFFGV-----------GFNLGIDFAGGSTAQIQY
E7A9U2_HELFC          ----------------SGVLVLVCVFLMFFK-----------GFNLGVDFAGGSVVQVRF
A8ERU7_ARCB4          ----------------STILMIISLVLVFTR-----------GFNFGIDFVGGTIVQVKY
D1B3G6_SULD5          ----------------TLFLAAISLVLIVTK-----------GFDYGVDFAGGTVVQIKY
A6Q513_NITSB          ----------------STILVLGSWALVVFK-----------GLNFGIDFAGGTIVQVRY
E4U019_SULKY          ----------------SFVLFFLAIALIATK-----------GFSFGIDFTGGTVVQVKY
A7ZE41_CAMC1          ----------------SIFLFVGSIFLLATK-----------GLNYGIDFSGGTLIQLKY
E1YHR4_9DELT          ----------------SGLMILISIISLIFHG----------GLNYGIDFLGGSVIQLKF
A8ZW13_DESOH          ----------------SAAMILITIISLVAHG----------GPRYGIDFAGGTLVQVKF
B8F9E2_DESAL          ----------------SGILIAVSLVSLVMHG----------GPKMGVDFAGGAEMIFKF
E1QIL9_DESB2          ----------------SGLLILMTVIVLAING----------GPRYGVDFAGGVLVQVRF
C7LN35_DESBD          ----------------SAALLLAGFLSLLVKG----------GPQYGIDFAGGFNVQVKF
C4XR64_DESMR          ----------------SAAIVLAGFISLAVKG----------GPRFGVDFSGGLSIQVRF
C8X141_DESRD          ----------------SALVLLLGLGSLLLKG----------GPKYGIDFAGGITVQTQF
B8J2Q5_DESDA          ----------------SVALILIGIASAIWGN----------GLKMGIDFAGGVIVQVQF
A0A0H3AA07_DESVV      ----------------SIVVILIGFASIAMNG----------GLRYGIDFAGGAVVQVKF
Q1MSC2_LAWIP          ----------------SIIFILIGIRTIIVNG----------GVRYGVDFAGGIAVQLQF
Q3A3C5_PELCD          ----------------SLVLIVVGMGSLVVKG----------GPNYGIDFSGGTLIQVKF
Q2LVH3_SYNAS          ----------------SIVYILIGIASIFWHG----------GLNFGIDFAGGTLIQIRF
SECF_CALNY            ----------------SGVLIVISLFLIFTK-----------GLNLGIDFSGGTVIQLKY
D4H482_DENA2          ----------------SGLVFILSLGIVFTK-----------GFNFGIDFAGGTIIQMQF
SECF_MAGMM            ----------------SLFLIGVSLVSLFTQ-----------GLNFGIDFAGGTLIQVRF
SECF_DESIS            ----------------SAILVAIALISMGTR-----------GLNFGIDFTGGALVQLEF
E8T6K2_THEA1          ----------------TLIL-GTWLYGAFIK-----------GPKFGIDFTGGVLVLVKV
SECF_AQUAE            ----------------SALLILISLLSLLFR-----------GLNLGLDFTGGTLYEVKF
D3SMD0_THEAH          ----------------SLLLLVISLLSLGLK-----------GLNLGLDFTGGTLLEVRY
B4U6P7_HYDS0          ----------------SIILILLSAFSLYTR-----------GLNLGLDFTGGTMLEVRF
C0QRM5_PERMH          ----------------SILLVLLSLGVIFTK-----------GFNFGLDFTGGTSIQVRF
SECF_PETMO            ----------------SIALILFSVIVIFVK-----------GFNLGVDFSGGSEIIVSF
C5CF37_KOSOT          ----------------SLVLVALTLVMVFTK-----------GFNLGVDFTGGIEISVTV
A7HMQ5_FERNB          ----------------SAVLIIVSIISFFTK-----------GFNLGLEFIGGSEIVVKA
A6LP85_THEM4          ----------------SLLLIVASLVSIFSK-----------GFNLGVEFLGGSEIILSV
Q9WZW5_THEMA          ----------------SLILIAISIVSIFTK-----------GFNFGVEFTGGSEIIVRF
B8JH53_ANAD2          ----------------SLVVNLAIILWSLPFV---------HGLNMGVDFAGGTEMEVQF
Q1D3B7_MYXXD          ----------------STLLNLAIIVGIAAF-----------GFNFGVDFAGGTVVEVKF
E1X0T7_HALMS          ----------------SLLLVSVSLFGIITK------------MNYGVDFRGGAEIQLKF
Q6MKZ3_BDEBA          ----------------SLVLVVASLIYLAVH-----------GISYGIDFKGGTEIQVKF
A9F8C8_SORC5          ----------------SAVLLILSIISFIVP-----------GPTLGTDFKGGTEIEVAF
D0LJ87_HALO1          ----------------SIVLIAASIGMLFVNNAMRG-----SMLNWTIDFKGGTEVIFAF
B3T9T6_9ZZZZ          ----------------SALLVVPSLGALLGPMLPFVGSDLGSTLRPGIEFTGGSAMTVEF
D2BGI5_DEHMV          ----------------SALIILAGLASLLI-----------FGLKPGIDFSSGSILTVKF
A9WGQ9_CHLAA          ----------------SLLIILPGLYMLFLHPLLTTGRP-GIGLRPSIDFAGGALWELRF
A9B5U8_HERA2          ----------------SILTIIPGLISMLV-----------FGLNLGVDFSGGARWEIHI
SECF_ANATU            ----------------SLAMIIPGLIVMAI-----------FGLPLSIDFKGGSLLEVEF
SECF_THET1            ----------------SLLIIIPGTIYLLL-----------FGLRLGIDFEGGTFWQIQF
D1C4J4_SPHTD          ----------------SVLVILPGLVSLAV-----------NGLRVSIDFTGGTLWELQM
B4WJX7_SYNS7          ----------------SSILILVGIASMAFSWQQ-----YGAPIKPSLDFVGGTRLQLSR
SECF_ACAM1            ----------------SAALILAGVISMALSWNQ-----YQAPLKPGLDFTGGTRLQLER
A0A0H3K5W7_SYNP6      ----------------SAILVIVSIAGMATSWLQ-----FGGPVRPGLDFVGGTRLQLER
B8HQ25_CYAP4          ----------------SSLLILAGLIAMLLSWFNPA---IRAPLRPGLDFSGGTRLEFEL
SECF_SYNP2            ----------------SAIAILASVLFMGISFNQ-----LQAPLRPSLDFVGGTKIQVAL
SECF_SYNY3            ----------------SSLLVLISIFAMAISWAQ-----FQAPFRPGLDFVGGTRLQLQL
D3EPH1_ATETH          ----------------SSTIILSSIIGILISYSK-----FNAPLKLGLDFVGGTRLQLQL
Q2JKR7_SYNJB          ----------------SLAVLLVGLVSMAFSLAS-----LGTPLRLGLDFSGGTLLDLSF
Q7NDR5_GLOVI          ----------------SGIGLGIGLVAMVISLLT-----LGSPLRLGLDFTGGTLLQLKF
SECF_PROMA            ----------------SGFAVLISFLGFFFSWTNQS---IGFPLRPGFDFTGGTQIILER
A2CA57_PROM3          ----------------SGLFVVFSLVGLILCWLNPS---IGAPLRPGLDFTGGTQIQLER
Q46L53_PROMT          ----------------SFSLCLISIIGMLICLKSTS---INAPLNLGLDYTGGTQITLER
A5GTK4_SYNR3          ----------------TAVLVALSVLGLVLSWLSP----IKAPLKPGLDFTGGTSIQVER
Q7V1E6_PROMP          ----------------SSFLILLSLIGILYSTFNTS---FKKPINLGMDFIGGNELRIER
B5Y8Y1_COPPD          ----------------SIVVILVGFLFMGINYAR-----YHEPLNLGVDFSGGVVFTVTL
D4JXA7_9FIRM          ----------------PIVIAVIT-VIFNCIF----------GIEMAIEFKGGTMLTYSY
E6UEG8_RUMA7          ----------------SCGLIALF-IVLTFVL----------GLNVDIMFKGGTIMTYSY
D4LA66_RUMC1          ----------------SAIMILCA-IAGSLIF----------GVEVAIEFKGGTILNYSY
A0A2N0UMZ5_9FIRM      ----------------SLAIIIIG-IVCNFIF----------GTQLDIQFSGGATLKFSY
E1PK78_MAGIU          ----------------SSLLLLIG-IISAIVF----------GMKLDIQFKGGSIVKMSF
E6U7Q5_ETHHY          ----------------SISLIVIG-ILVSAIF----------GVKLDIQFKGGAIIQYSY
A3DDV8_HUNT2          ----------------STVLLLIGLVALIVRG----------GLNLDIQFRGGTQIEIEM
B8I6M7_RUMCH          ----------------SALIILAG-VAMYFVE----------GFKLDIEFEGGTIIEMRA
E0RMP8_PAEP6          ----------------SIIITLLG-ILSLSIF----------GLNYGVDFRSGSNVDVNL
C6D7X9_PAESJ          ----------------SAILTIVG-ILMVSIF----------HLNFGVDFKAGTNMDILV
C0ZAP7_BREBN          ----------------SSVIIIIG-LLFTLFQ----------GLHLGVDFKAGTRLDMFI
SECF_ALIAD            ----------------SGAITVAG-VIVFALF----------GFNLSTDFKSGSEVQFEL
Q5WHQ4_BACSK          ----------------SGLSIVLG-IVLLLTF----------GLNLGVDFESGSNVEIQA
D6XWY7_BACIE          ----------------SASTLLAG-IILLMTV----------GLNLGIDFTSGTTIDILA
B1YJQ6_EXIS2          ----------------TIALVVIS-VLLLTLR----------GLNLGIDFTEGTRVEISS
B7R9G0_9THEO          ----------------SGIMILIGIIAMFVNG-----------FNWGIDFTGGTIMEFKI
D9TNU6_THETC          ----------------SGIIILAGLIALFSMG-----------LNWGLDFTGGMVAEFNI
C6PXQ6_9CLOT          ----------------SSIIIVIGLFTAATKG-----------LEFGLDFKGGTVLEISI
Q892A5_CLOTE          ----------------SLAIMLLGLVFAIKDG-----------LNYGIDFKGGTLVQIKM
A6LTN3_CLOB8          ----------------SLIIIVIGMGFLCVRG-----------LNFGIDFKGGSEIVLQL
Q97GT8_CLOAB          ----------------SLTIIFLGIAFMIYRGVTTG-----KPLEFGIDFVGGNSMDIKI
D9SMV1_CLOC7          ----------------SVLIIIAGIVSLTTQG-----------LNMGIDFKGGTIVELSV
A6TQN5_ALKMQ          ----------------SAAVIILGLVLGLARG-----------INVGIDFTGGTLMEIEL
E3GFZ4_9FIRM          ----------------AIVLVLISVGSLLIRG-----------LNFGIDFVGGTIVTIDL
D9TIR8_CALOO          ----------------SILIMVIGLISYFVQG-----------FNYDIDFTGGTVLEINL
D9RXQ1_THEOJ          ----------------SLAVIALGLFYLVTRG-----------LNWGIDFTGGDILHYNI
D9QVJ2_ACEAZ          ----------------SALIIIVGLGSLVMQG-----------LNLGIDFTGGTLMEFTF
E4RIJ9_HALHG          ----------------SSILIGIGLVFLLING-----------LNLGIDFLGGTIMEFSV
B2A264_NATTJ          ----------------SLVILVIGLGSLMFNG-----------LNVGIDFTGGTLLHIKI
A0A1H8CTT8_9FIRM      ----------------SSLLIIASLFFMVTRG-----------FNMGIDFTGGTIMDLRF
D1BLM5_VEIPT          ----------------SSTLVIISLISIFTKG-----------FNFGIDYTGGTIVEVVF
SECF_ACIFV            ----------------TAVVLIVGIVSMFARG-----------FNLGIDFTGGSILDIKF
C8W4E2_DESAS          ----------------SLLVLIPGLISLFVQG-----------LNLGIDFTGGNIFEVRF
A5D3H0_PELTS          ----------------SVLIIVPGIISLFSQG-----------LNMGIDFSGGSLFDLKF
A4J545_DESRM          ----------------SLAIILIGMVSLLTKG-----------LNLGIDFTGGNIVELQF
B1I4K4_DESAP          ----------------SLLIIVPGIISLLFRG-----------LNLGIDFTGGSLVEVQF
C9R7V2_AMMDK          ----------------SLAVILPGLVSLFLRG-----------LNLGIDFTGGSLIEVEF
B0TF82_HELMI          ----------------SLLILIPGLISLLLQG-----------LNLGIDFTGGSMLQLKF
D5XEJ7_THEPJ          ----------------SLIIILAGIASMIIKTFTLG-----APLNLGIDFTGGNIITVSF
Q2RHU7_MOOTA          ----------------SLLVIIPGLIAMALHR---------PVLNFGIDFTGGNIIQVQF
D7CLE8_SYNLT          ----------------SLLLIIPGLVSLLWPG---------RGLNKGIDFTGGSLLRVKF
Q0AX23_SYNWW          ----------------SAILITLGLISIFVQG-----------FKLGIDFEGGSLLRFRM
SECF_SEBTE            ----------------STFMILFSLFSIFTKG-----------FNLGIDFTGGNIYQMKF
E3CUY4_9BACT          ----------------SCALMVLSLGLVIAK-----------GLNLSVDYTGGILLQVEF
D5EDU6_AMICL          ----------------SLGLIVVSLVLLFTK-----------GLNLGIDFTGGNLIQVEF
D4M8L9_9BACT          ----------------SAVLVLASLAFLFTR-----------GLNLGIDFTGGNVIQLEF
E6SLR1_THEM7          ----------------SLLLLAAGMVAWAVR-----------GLNYNVEFTGGTAWTLRF
B5H469_STRC2          RRPPRLMRYRRRWLGGCLGLLLCALAGIGVR-----------GLEFGVEFTGGRQIQYTA
SECF_GEMAT            ----------------GLTLAFIAAGFVSFAVTG--------GVNYSIEFTGGTLMQLQF
Q67LL9_SYMTH          ----------------TLVTVLLAAGALLFR-----------GLNLGIDFTGGLLLDLQF
C4RGU1_MICS3          ----------------AGALILIAVLSFAL-----------RGFTLGIEFAGGNSFQVPA
D2S9H9_GEOOG          ----------------TAVVVLLCIAAMVF-----------RGFNFGIDFAGGNSLRLPG
D3PYP6_STANL          ----------------SLVLMLVSLSGLGLAIGS-------NHMNWGIEFVGGTQFQGAV
SECF_MYCLE            ----------------GGVIVAVAVLSIIV-----------RGFTFGIDFKGGTTVSMPV
B1MCI7_MYCA9          ----------------SGAFMVVAILSIAI-----------KGFVFGIDFEGGTKVWFP-
Q5YTF3_NOCFA          ----------------TALIVLISLASMLV-----------RGFNFGIDFEGGSRIQFP-
D0LCM9_GORB4          ----------------TAVILLICALSIGL-----------RWFTLGIDFEGGTQISIPV
D6Z7I7_SEGRD          ----------------TAGILLVCLASFAI-----------RGFTFGIEFVGGTSISFPS
D5UNI8_TSUPD          ----------------TGIIIVIAILGILI-----------PGFKLSIDFEGGTQVSFPV
C3PGQ3_CORA7          ----------------AGVLLIASILAIVL-----------RGFNLSLDFEGGTKLNMP-
Q79VF7_CORGL          ----------------TGILLVISILFIAI-----------RGFSLSIDFQGGTKMSMP-
D9QAR8_CORP2          ----------------TAAILLVCLVSIAL-----------RGFSLGIDFVGGTKINMP-
C4LIX4_CORK4          ----------------YAIILVICLVSIIF-----------RGFTLGIDFEGGTKITMP-
Q4JVE2_CORJK          ----------------LVAVVVACLLSILV-----------RGFTLGIDFEGGTRMTMPP
B1VDK1_CORU7          ----------------LIAIFVLCIATIGF-----------RGFNLGIDFEGGTRISMPP
C6WCM8_ACTMD          ----------------FGAILVASVLLVIF-----------KGFNLGIDFTGGTRIQMPA
C7MR00_SACVD          ----------------FGALVLVCFVSMGL-----------KGFNFGIAFEGGTQIQLPA
C8XE15_NAKMY          ----------------SSALVVASILLIVF-----------RGFHYGIDFAGGTTLTFQP
A0LUK2_ACIC1          ----------------SAVVIVIGLIG-LGVR----------GLHLGLEFKGGTEFTFPD
D7BWW9_STRBB          ----------------SILITITAIVG-LAVR----------GLNLGIEFSGGAVFETPK
Q0RNU2_FRAAA          ----------------SGVILVICAVS-MIFR----------GFTLGIEFSGGAVFQLPS
D1AEV5_THECD          ----------------SALLLAFSIAG-LLVR----------GLTFGVEFTGGSVFTFKA
C7QJQ2_CATAD          ----------------SGALLLISALS-LLVF----------GLNFTLDFRGGSQFDIVS
D7BNQ3_ARCHD          ----------------AMALMVLSLLA-FVVK----------SPNTGIEFRGGSQFTVSG
D6ZHF3_MOBCV          ----------------GAILMAISVIG-IAIF----------GLNPSIEFTGGAEFVVTN
A0JXA8_ARTS2          ----------------AAVAVALSILLPVAKG----------GFNLGIEFRGGSEFTVSN
C5CCH8_MICLC          ----------------AALLLVLAGGLTALRG----------GFNLGIEFRGGSEFTVSQ
D2NT09_ROTMD          ----------------AAVLMAVSVLIPAVGG----------GFNLGIDFRGGSEFVVSK
B0REC3_CLAMS          ----------------AAICILVSVLGPLLRG----------GFTFGIEFTGGSEYTVSG
Q6AFB1_LEIXX          ----------------AAIMVVLSILVPVLKG----------GFNFSIEFRGGSQFQITS
A6WCH5_KINRD          ----------------AAVLVLVSAVL-LVKP----------GLTYGIEFEGGSEFRVTG
D1BGW3_SANKS          ----------------SVVIVLLSLVV-LLTR----------GFNLGIEFRGGSEFTVSD
D1BSK2_XYLCX          ----------------AVALAVASIAI-LGIK----------GLSLGIDFRGGTEISVEN
C7MCC3_BRAFD          ----------------SLALVVLLAVGSVLRG----------P-NLGIEFTGGSEFQIAG
E6SB76_INTC7          ----------------SAVLIAIALAG-ILLN----------GLNFGIEFRGGMEFRVLG
C7NI43_KYTSD          ----------------SAVLLALTLVG-LFGR----------GINLGLEFTGGTDFRVAG
Q83MZ6_TROWT          ----------------SFVILLVAILGPFFHG----------GYKFGIEFTGGSQFVISD
D4HDX0_CUTAS          ----------------TAVVIIISFIG-LLVR----------GLNLGIEFKGGVQFRAPA
D7GDS8_PROFC          ----------------SIVLIVISLAA-LLFR----------GLNLGIEFKGGSVFTVPV
D2PVF2_KRIFD          ----------------SLVLVAISLLG-LFAR----------GLALGIEFKGGVEYQANV
A1SJB0_NOCSJ          ----------------SVVIIVGSLLG-LAVK----------GLDMGIEFVGGAEYKVKV
C7LYS7_ACIFD          ----------------SLVVIAVGAAALGI-----------RGLNFGIDFRGGLAWQVSA
Q1AWC9_RUBXD          ----------------SGILLAAGILAIALGR-----------LEFGIDFQGGVQFTAAD
E1QZN4_OLSUV          ----------------SGMLVVLAIVGLVA-----------RGLVFGIEFKGGTEIDFHD
D8IEE2_BRAP9          ----------------SSILFIASIGLFINKLTTN-------SFNMGIDFAGGVELQVKI
                                                                       :          

E1R5K6_SEDSS          APVGFTLSYTGSGAATLDINSGTAVLEVRGDEGVTK-HRFPLADYSTIQALADVLNGIDG
E0RQA8_SPITD          AP----------------------------------------------------------
SECF_BORBU            EK----------------------------------------------------------
SECF_TREPA            APPAFSLVYTGTQSMQFFQDEQKVVFTVSSPGVLGERYEFLYTEYPTLRAFSEGAKKVEH
Q73PW5_TREDE          APTAVELSYEGPLTVSFSQGISDISITTTSLDGENKSYVFKFADNPTLKDFADGLASIDG
B0SPU5_LEPBP          PKDKSR------------------------------------------------------
Q72PD4_LEPIC          DQNMDR------------------------------------------------------
SECF_DICTD            YK----------------------------------------------------------
B0VHR6_CLOAI          KA----------------------------------------------------------
A1BCH7_CHLPD          EK----------------------------------------------------------
SECF_RHOM4            AR----------------------------------------------------------
Q9WXE9_PRERU          DK----------------------------------------------------------
D5MHP4_9BACT          NKPV--------------------------------------------------------
D8PI88_9BACT          EQAM--------------------------------------------------------
B6ANM4_9BACT          QKNV--------------------------------------------------------
B5ECA5_GEOBB          THPI--------------------------------------------------------
B3E2R7_GEOLS          DKPL--------------------------------------------------------
SECF_THEYD            SQPV--------------------------------------------------------
SECF_KORVE            AQTP--------------------------------------------------------
E8X5J9_GRATM          DSTP--------------------------------------------------------
Q029K3_SOLUE          ADTP--------------------------------------------------------
SECF_ELUMP            TESI--------------------------------------------------------
SECF_UNCTG            QNEV--------------------------------------------------------
D0RNY4_9PROT          -FDK--------------------------------------------------------
B6BPL7_9PROT          -TDA--------------------------------------------------------
B4WED0_9CAUL          PAGQ--------------------------------------------------------
D5VIW1_CAUST          -MSR--------------------------------------------------------
Q0BS57_GRABC          -TQG--------------------------------------------------------
C6XJ03_HIRBI          -TST--------------------------------------------------------
Q0ANE7_MARMM          -ALN--------------------------------------------------------
Q0C0W7_HYPNA          -QTD--------------------------------------------------------
E2CQN2_9RHOB          EGA---------------------------------------------------------
A7HXL1_PARL1          DGP---------------------------------------------------------
D8JWH2_HYPDA          KSG---------------------------------------------------------
E3I015_RHOVT          PTA---------------------------------------------------------
B0UI93_METS4          KAG---------------------------------------------------------
B2II62_BEII9          KEG---------------------------------------------------------
E6VHR2_RHOPX          KSG---------------------------------------------------------
A7IND7_XANP2          SQQ---------------------------------------------------------
D5BQT4_PUNMI          MTG---------------------------------------------------------
Q2W4A8_MAGSA          TTG---------------------------------------------------------
B6ISI3_RHOCS          QQ----------------------------------------------------------
Q2NBX9_ERYLH          VGEE--------------------------------------------------------
Q1GSE6_SPHAL          TGA---------------------------------------------------------
D4YYJ1_SPHJU          ETP---------------------------------------------------------
SECF_RHOCB            TTA---------------------------------------------------------
SECF_KETVY            SEN---------------------------------------------------------
D0D195_9RHOB          AQP---------------------------------------------------------
SECF_RICPR            DQ----------------------------------------------------------
A5CDU1_ORITB          SP----------------------------------------------------------
B9KH24_ANAMF          DDG---------------------------------------------------------
Q2GI09_EHRCR          D-----------------------------------------------------------
Q5GT97_WOLTR          S-----------------------------------------------------------
C6V4R4_NEORI          EK----------------------------------------------------------
C1D5X5_LARHH          AQT---------------------------------------------------------
B1XW93_LEPCP          AQS---------------------------------------------------------
B6BWI7_9PROT          EEK---------------------------------------------------------
A5EWX6_DICNV          TEA---------------------------------------------------------
C0N4C3_9GAMM          QEQ---------------------------------------------------------
A5CVL6_VESOH          QQS---------------------------------------------------------
A1WXP7_HALHL          EES---------------------------------------------------------
Q31FZ8_HYDCU          DKP---------------------------------------------------------
D3S9V5_THISK          PEA---------------------------------------------------------
D3RSH8_ALLVD          AQP---------------------------------------------------------
C7RB48_KANKD          EQD---------------------------------------------------------
A4GK29_9BACT          KENL--------------------------------------------------------
A4GHV4_9BACT          PDS---------------------------------------------------------
B8KFI4_9GAMM          QES---------------------------------------------------------
Q21KV9_SACD2          ETA---------------------------------------------------------
Q2SDV4_HAHCH          AKA---------------------------------------------------------
E4PKE9_MARAH          AEA---------------------------------------------------------
A6VYM8_MARMS          KEA---------------------------------------------------------
E1V6F3_HALED          ATA---------------------------------------------------------
Q0VS96_ALCBS          PTD---------------------------------------------------------
B3PDJ9_CELJU          DRP---------------------------------------------------------
Q8GEL5_PSEPU          ERP---------------------------------------------------------
D0SG96_ACIJO          SKP---------------------------------------------------------
Q1QBR5_PSYCK          EQS---------------------------------------------------------
Q83CH4_COXBU          FTKP--------------------------------------------------------
Q5ZU08_LEGPH          YSKA--------------------------------------------------------
A0A0B3WJC7_FRATU      STKS--------------------------------------------------------
B8L1U9_9GAMM          DKA---------------------------------------------------------
D0KW98_HALNC          AKA---------------------------------------------------------
B7J4R6_ACIF2          SKT---------------------------------------------------------
SECF_ECOLI            EKP---------------------------------------------------------
Q8D162_YERPE          ENP---------------------------------------------------------
Q1LSN7_BAUCH          EQT---------------------------------------------------------
Q7VQA8_BLOFL          EQD---------------------------------------------------------
E8Q616_BLOVB          DKD---------------------------------------------------------
Q493H0_BLOPB          EKD---------------------------------------------------------
A0KJ23_AERHH          QQS---------------------------------------------------------
Q0HWQ6_SHESR          TQP---------------------------------------------------------
C4L7L0_TOLAT          SKP---------------------------------------------------------
Q5QVF2_IDILO          DSA---------------------------------------------------------
Q5E3D5_ALIF1          EQP---------------------------------------------------------
SECF_HAEIN            SQS---------------------------------------------------------
D4ZB75_SHEVD          DSK---------------------------------------------------------
C3LVV7_VIBCM          NHS---------------------------------------------------------
E1SV06_FERBD          DAQ---------------------------------------------------------
A1S8J4_SHEAM          ATD---------------------------------------------------------
B7VU09_VIBTL          SDQ---------------------------------------------------------
B7VQK9_VIBTL          KPN---------------------------------------------------------
Q15N35_PSEA6          SQS---------------------------------------------------------
Q3IL51_PSEHT          SQS---------------------------------------------------------
A0KLF0_AERHH          QTL---------------------------------------------------------
Q2RTI2_RHORT          ATA---------------------------------------------------------
C5ZWZ3_9HELI          SKE---------------------------------------------------------
C3XE90_9HELI          TQQN--------------------------------------------------------
E7A9U2_HELFC          EKV---------------------------------------------------------
A8ERU7_ARCB4          DQT---------------------------------------------------------
D1B3G6_SULD5          EAK---------------------------------------------------------
A6Q513_NITSB          DKP---------------------------------------------------------
E4U019_SULKY          QGP---------------------------------------------------------
A7ZE41_CAMC1          DTK---------------------------------------------------------
E1YHR4_9DELT          DSS---------------------------------------------------------
A8ZW13_DESOH          ASP---------------------------------------------------------
B8F9E2_DESAL          ETL---------------------------------------------------------
E1QIL9_DESB2          NKA---------------------------------------------------------
C7LN35_DESBD          SQS---------------------------------------------------------
C4XR64_DESMR          AKT---------------------------------------------------------
C8X141_DESRD          AAD---------------------------------------------------------
B8J2Q5_DESDA          QEP---------------------------------------------------------
A0A0H3AA07_DESVV      DKP---------------------------------------------------------
Q1MSC2_LAWIP          SQP---------------------------------------------------------
Q3A3C5_PELCD          TEA---------------------------------------------------------
Q2LVH3_SYNAS          DQE---------------------------------------------------------
SECF_CALNY            EKP---------------------------------------------------------
D4H482_DENA2          SSA---------------------------------------------------------
SECF_MAGMM            EKP---------------------------------------------------------
SECF_DESIS            QQP---------------------------------------------------------
E8T6K2_THEA1          EEP---------------------------------------------------------
SECF_AQUAE            EKS---------------------------------------------------------
D3SMD0_THEAH          TPK---------------------------------------------------------
B4U6P7_HYDS0          QTP---------------------------------------------------------
C0QRM5_PERMH          SEP---------------------------------------------------------
SECF_PETMO            -DKS--------------------------------------------------------
C5CF37_KOSOT          SDLE--------------------------------------------------------
A7HMQ5_FERNB          S-KD--------------------------------------------------------
A6LP85_THEM4          Q-DN--------------------------------------------------------
Q9WZW5_THEMA          ENKE--------------------------------------------------------
B8JH53_ANAD2          GKP---------------------------------------------------------
Q1D3B7_MYXXD          DHP---------------------------------------------------------
E1X0T7_HALMS          KES---------------------------------------------------------
Q6MKZ3_BDEBA          DQG---------------------------------------------------------
A9F8C8_SORC5          RAP---------------------------------------------------------
D0LJ87_HALO1          RDAASGAPA---------------------------------------------------
B3T9T6_9ZZZZ          AD-----PV---------------------------------------------------
D2BGI5_DEHMV          DQ-----TI---------------------------------------------------
A9WGQ9_CHLAA          PDVTPETLS---------------------------------------------------
A9B5U8_HERA2          PSISETRDG---------------------------------------------------
SECF_ANATU            AS---KTLP---------------------------------------------------
SECF_THET1            EK-----PV---------------------------------------------------
D1C4J4_SPHTD          SR-----TV---------------------------------------------------
B4WJX7_SYNS7          DC-TVANNC---------------------------------------------------
SECF_ACAM1            DC-SKPDNC---------------------------------------------------
A0A0H3K5W7_SYNP6      DC-TKA-QC---------------------------------------------------
B8HQ25_CYAP4          ACATQTPTC---------------------------------------------------
SECF_SYNP2            DC-TVAGNC---------------------------------------------------
SECF_SYNY3            EC-ASSNNC---------------------------------------------------
D3EPH1_ATETH          EC-EIQKKC---------------------------------------------------
Q2JKR7_SYNJB          ER----------------------------------------------------------
Q7NDR5_GLOVI          VK----------------------------------------------------------
SECF_PROMA            KCDSECNKI---------------------------------------------------
A2CA57_PROM3          SCSKSCQSL---------------------------------------------------
Q46L53_PROMT          SCTDECISL---------------------------------------------------
A5GTK4_SYNR3          NCGDRCAEL---------------------------------------------------
Q7V1E6_PROMP          SCKEVCENI---------------------------------------------------
B5Y8Y1_COPPD          PENKDASEL---------------------------------------------------
D4JXA7_9FIRM          TGEIDTNA----------------------------------------------------
E6UEG8_RUMA7          TGDISTDD----------------------------------------------------
D4LA66_RUMC1          TGDVDTAQ----------------------------------------------------
A0A2N0UMZ5_9FIRM      SGEINQSE----------------------------------------------------
E1PK78_MAGIU          AGDVDLSK----------------------------------------------------
E6U7Q5_ETHHY          TGTLDLST----------------------------------------------------
A3DDV8_HUNT2          ENGDFDVI----------------------------------------------------
B8I6M7_RUMCH          NEKMFTAA----------------------------------------------------
E0RMP8_PAEP6          TKVVTQEQ----------------------------------------------------
C6D7X9_PAESJ          GKKISQEE----------------------------------------------------
C0ZAP7_BREBN          GKTFNPTD----------------------------------------------------
SECF_ALIAD            NQRVPEAR----------------------------------------------------
Q5WHQ4_BACSK          DQTLMQEQ----------------------------------------------------
D6XWY7_BACIE          DEPVTEQE----------------------------------------------------
B1YJQ6_EXIS2          TNTIKESE----------------------------------------------------
B7R9G0_9THEO          GKPFDT------------------------------------------------------
D9TNU6_THETC          HRTVTTTIN---------------------------------------------------
C6PXQ6_9CLOT          GKTFDKAD----------------------------------------------------
Q892A5_CLOTE          NKEFDKIE----------------------------------------------------
A6LTN3_CLOB8          DESINKDD----------------------------------------------------
Q97GT8_CLOAB          GKSFNKTD----------------------------------------------------
D9SMV1_CLOC7          GKTIDEAEE---------------------------------------------------
A6TQN5_ALKMQ          YEYVSTDE----------------------------------------------------
E3GFZ4_9FIRM          HTQFNTDD----------------------------------------------------
D9TIR8_CALOO          HKVPSAAEI---------------------------------------------------
D9RXQ1_THEOJ          GQPYSLDE----------------------------------------------------
D9QVJ2_ACEAZ          DKEVTTGQ----------------------------------------------------
E4RIJ9_HALHG          EENVGTED----------------------------------------------------
B2A264_NATTJ          GEDYQVSE----------------------------------------------------
A0A1H8CTT8_9FIRM      EKAVNIND----------------------------------------------------
D1BLM5_VEIPT          DQPVEVSQ----------------------------------------------------
SECF_ACIFV            DQPVTVAQ----------------------------------------------------
C8W4E2_DESAS          NKQVTVNE----------------------------------------------------
A5D3H0_PELTS          NQPTAVEQ----------------------------------------------------
A4J545_DESRM          KKSVTAES----------------------------------------------------
B1I4K4_DESAP          QKQVSVQE----------------------------------------------------
C9R7V2_AMMDK          HRPVEIAE----------------------------------------------------
B0TF82_HELMI          ERAVTVEN----------------------------------------------------
D5XEJ7_THEPJ          TKNVSVSD----------------------------------------------------
Q2RHU7_MOOTA          HQPVTSGQ----------------------------------------------------
D7CLE8_SYNLT          EQPVEVQQ----------------------------------------------------
Q0AX23_SYNWW          DAAVSSAE----------------------------------------------------
SECF_SEBTE            EKPVSKEA----------------------------------------------------
E3CUY4_9BACT          PAA---------------------------------------------------------
D5EDU6_AMICL          ASQ---------------------------------------------------------
D4M8L9_9BACT          DNL---------------------------------------------------------
E6SLR1_THEM7          EKP---------------------------------------------------------
B5H469_STRC2          GQP---------------------------------------------------------
SECF_GEMAT            KTP---------------------------------------------------------
Q67LL9_SYMTH          ERT---------------------------------------------------------
C4RGU1_MICS3          SVG---------------------------------------------------------
D2S9H9_GEOOG          GAE---------------------------------------------------------
D3PYP6_STANL          KEGV--------------------------------------------------------
SECF_MYCLE            SPGVG-------------------------------------------------------
B1MCI7_MYCA9          ------------------------------------------------------------
Q5YTF3_NOCFA          ------------------------------------------------------------
D0LCM9_GORB4          ------------------------------------------------------------
D6Z7I7_SEGRD          ------------------------------------------------------------
D5UNI8_TSUPD          G-----------------------------------------------------------
C3PGQ3_CORA7          ------------------------------------------------------------
Q79VF7_CORGL          ------------------------------------------------------------
D9QAR8_CORP2          ------------------------------------------------------------
C4LIX4_CORK4          ------------------------------------------------------------
Q4JVE2_CORJK          ------------------------------------------------------------
B1VDK1_CORU7          ------------------------------------------------------------
C6WCM8_ACTMD          QTG---------------------------------------------------------
C7MR00_SACVD          QGA---------------------------------------------------------
C8XE15_NAKMY          V-----------------------------------------------------------
A0LUK2_ACIC1          K-----------------------------------------------------------
D7BWW9_STRBB          T-----------------------------------------------------------
Q0RNU2_FRAAA          H-----------------------------------------------------------
D1AEV5_THECD          P-----------------------------------------------------------
C7QJQ2_CATAD          P-----------------------------------------------------------
D7BNQ3_ARCHD          T-----------------------------------------------------------
D6ZHF3_MOBCV          T-----------------------------------------------------------
A0JXA8_ARTS2          V-----------------------------------------------------------
C5CCH8_MICLC          T-----------------------------------------------------------
D2NT09_ROTMD          T-----------------------------------------------------------
B0REC3_CLAMS          V-----------------------------------------------------------
Q6AFB1_LEIXX          V-----------------------------------------------------------
A6WCH5_KINRD          S-----------------------------------------------------------
D1BGW3_SANKS          V-----------------------------------------------------------
D1BSK2_XYLCX          V-----------------------------------------------------------
C7MCC3_BRAFD          V-----------------------------------------------------------
E6SB76_INTC7          V-----------------------------------------------------------
C7NI43_KYTSD          V-----------------------------------------------------------
Q83MZ6_TROWT          V-----------------------------------------------------------
D4HDX0_CUTAS          H-----------------------------------------------------------
D7GDS8_PROFC          S-----------------------------------------------------------
D2PVF2_KRIFD          K-----------------------------------------------------------
A1SJB0_NOCSJ          A-----------------------------------------------------------
C7LYS7_ACIFD          P-----------------------------------------------------------
Q1AWC9_RUBXD          A-----------------------------------------------------------
E1QZN4_OLSUV          T-----------------------------------------------------------
D8IEE2_BRAP9          DNLE--------------------------------------------------------
                                                                                  

E1R5K6_SEDSS          ITASAQRPSARPSTIATGLDFPLSLSTEAQGVNVSPDGTESAVEINQIRDALAT--FDNP
E0RQA8_SPITD          ---------------------------------------SVSASIEDVRRALAG--IPGV
SECF_BORBU            -------------------------------------SNIKENEIKKIFSPIYK--TLDV
SECF_TREPA            LSVTLHAPETVYMRDTFSGAEGSTLSSASCF-VHYFSEDVRAPGVEELRRVLKD--VPSA
Q73PW5_TREDE          LKVKVTASGNVLLKNLFSNSESSSRLSANVFRLHHLEKGLKPINTDEVRHALSS--IPSV
B0SPU5_LEPBP          ---------------------------------TDLESYFQSKKIEAVVILLEK--EKNI
Q72PD4_LEPIC          ---------------------------------KKLENYFAENKIEAVLLLLDK--EKHH
SECF_DICTD            -----------------------------------LSSPLNSNQIANLRDI---------
B0VHR6_CLOAI          -----------------------------------LDPKVPAVPIENLRTVLTKNGFPEA
A1BCH7_CHLPD          -----------------------------------------NIDVAAVRSVLDNT-GMSG
SECF_RHOM4            -----------------------------------------EPGATAIREALTPVLGTEP
Q9WXE9_PRERU          -----------------------------------------QTPVEDVRKAMVGAFINTI
D5MHP4_9BACT          -------------------------------------------ELGQVRALLAENGLRDS
D8PI88_9BACT          -------------------------------------------KIDEARRALENNGLGSA
B6ANM4_9BACT          -------------------------------------------SLQSVRSLLEKDGFHGV
B5ECA5_GEOBB          -------------------------------------------PQEKARELLSDHLFREV
B3E2R7_GEOLS          -------------------------------------------ALADARKALHSGGIAEL
SECF_THEYD            -------------------------------------------TLAEVRTVLDKAGIKDA
SECF_KORVE            -------------------------------------------NLGDIRAAMDRSG--LK
E8X5J9_GRATM          -------------------------------------------NEDHVRAAMDKAG--IH
Q029K3_SOLUE          -------------------------------------------PLDKIRSAFAKSGKVKG
SECF_ELUMP            -------------------------------------------TIDQVRSAVEKY-NPEI
SECF_UNCTG            -------------------------------------------GLQDVRIAVEESGINSF
D0RNY4_9PROT          -----------------------------------------KYSATNIREALIQQ-ELGD
B6BPL7_9PROT          -----------------------------------------KINVSSLRDKFSQM-DLGD
B4WED0_9CAUL          -----------------------------------------AIELDRVREAV-NSLNLGD
D5VIW1_CAUST          -----------------------------------------PVPLADLRSAM-NQIGVHD
Q0BS57_GRABC          -----------------------------------------PADFDKIRATL-SAAHLEA
C6XJ03_HIRBI          -----------------------------------------KVDIGEIRDAL-SELDLDG
Q0ANE7_MARMM          -----------------------------------------TTSIEDLRSTA-NGLDLGE
Q0C0W7_HYPNA          -----------------------------------------SVTVADVRDRIPGGLTVNS
E2CQN2_9RHOB          ------------------------------------------ADIGKIRTDLGTL-NLGD
A7HXL1_PARL1          ------------------------------------------ADISQLRADIGGL-DLGE
D8JWH2_HYPDA          -----------------------------------------NADISALREKLNSI-GVGS
E3I015_RHOVT          ------------------------------------------AEAAKLRTTLTEI-GVGE
B0UI93_METS4          -----------------------------------------QSDVASVRHTANGF-GFGE
B2II62_BEII9          -----------------------------------------PADLVELRELGDHL-NIGD
E6VHR2_RHOPX          -----------------------------------------TADIAGMRATLGKL-GLGD
A7IND7_XANP2          -----------------------------------------VADVGALREHLTDL-DVGD
D5BQT4_PUNMI          -----------------------------------------PADISKVRNDLGTL-NLGD
Q2W4A8_MAGSA          -----------------------------------------PADLHGMRTTLGHL-GLGE
B6ISI3_RHOCS          -----------------------------------------TIDSAALRQQLGSL-GLGE
Q2NBX9_ERYLH          -----------------------------------------TAPVPEVRQTLTAIEGVGD
Q1GSE6_SPHAL          -----------------------------------------MPPIDEIREKVGAI-GLGE
D4YYJ1_SPHJU          ------------------------------------------PQTDRVRSVIDRL-GVGD
SECF_RHOCB            ------------------------------------------IDVGVYRAALEPL-ELGD
SECF_KETVY            ------------------------------------------VAVSEYRSALDQI-ELGD
D0D195_9RHOB          ------------------------------------------VDVGAYRQAIDAL-GIGD
SECF_RICPR            -----------------------------------------APDLPKMRAVLSALEIGEV
A5CDU1_ORITB          -----------------------------------------LQQLSSIRSALNNADLGKL
B9KH24_ANAMF          -----------------------------------------HSTVEQVRAALSDAGLSGL
Q2GI09_EHRCR          -----------------------------------------QVDVKSVNLKLQENGFVGF
Q5GT97_WOLTR          ------------------------------------------SEDHAVLNILKEN---GF
C6V4R4_NEORI          -----------------------------------------SIDITQLRDDFSKNQSLPT
C1D5X5_LARHH          ------------------------------------------APLEQIRTDIQTLKLGEP
B1XW93_LEPCP          ------------------------------------------ADIARVRGTIETMGLGEV
B6BWI7_9PROT          ------------------------------------------ANVDEIRGQLTQINLNEI
A5EWX6_DICNV          ------------------------------------------ADIPDVRKTVNQI-LPEA
C0N4C3_9GAMM          ------------------------------------------VDLNQLRSDLTEGGYPDA
A5CVL6_VESOH          ------------------------------------------VDLAEIRAILVNANFKRA
A1WXP7_HALHL          ------------------------------------------VEVAEVEAALQGTDYADA
Q31FZ8_HYDCU          ------------------------------------------AEVDTIRTSLQDSGFERA
D3S9V5_THISK          ------------------------------------------VELDPIRETLAEGGFAGA
D3RSH8_ALLVD          ------------------------------------------TELSDVRTALETEGLGSA
C7RB48_KANKD          ------------------------------------------ADLQKVRQQLTEIDINGA
A4GK29_9BACT          ------------------------------------------EDLEQIRGLLDEKNIDNY
A4GHV4_9BACT          ------------------------------------------ANISEIRQTLVLGGFEGA
B8KFI4_9GAMM          ------------------------------------------ADLNEIRSTLADSGYAGA
Q21KV9_SACD2          ------------------------------------------ADLNAIRATLEEAGYTGA
Q2SDV4_HAHCH          ------------------------------------------PQINDVRHQLEAHKYENF
E4PKE9_MARAH          ------------------------------------------PQLDEIRSRLTEAGYEQF
A6VYM8_MARMS          ------------------------------------------PQLDDVRTLLGENGYSDV
E1V6F3_HALED          ------------------------------------------PALSMVRETLEAAGFKDV
Q0VS96_ALCBS          ------------------------------------------VELSQARDDLTEAGFGDA
B3PDJ9_CELJU          ------------------------------------------ADLDKIRDVLEAEELKSP
Q8GEL5_PSEPU          ------------------------------------------ADLKAVRAELVNSGFHEA
D0SG96_ACIJO          ------------------------------------------VKSADVSAALTKAGFHDP
Q1QBR5_PSYCK          ------------------------------------------VEQGDVVTALADNGFDDA
Q83CH4_COXBU          ------------------------------------------VDTNQIRKNLAEAGFPQA
Q5ZU08_LEGPH          ------------------------------------------ADLPLIRENLNKAGFKEA
A0A0B3WJC7_FRATU      ------------------------------------------QDSETMTKELAKAGFEHT
B8L1U9_9GAMM          ------------------------------------------VDVEQVRTKLEENGFDGA
D0KW98_HALNC          ------------------------------------------ADLDAIRDDLKQNKFKEA
B7J4R6_ACIF2          ------------------------------------------PDLGAVRGTLTQAGFHDA
SECF_ECOLI            ------------------------------------------AEIDVMRDALQKAGFEEP
Q8D162_YERPE          ------------------------------------------ADLDQLRDTLQNAGFESP
Q1LSN7_BAUCH          ------------------------------------------IDIDQIRKAIEQSGFKEA
Q7VQA8_BLOFL          ------------------------------------------LDIVKIRKYFVQLGYNNT
E8Q616_BLOVB          ------------------------------------------LDIDKIRNSFIKFGFKTP
Q493H0_BLOPB          ------------------------------------------VNLINIQNILVQSGFKNP
A0KJ23_AERHH          ------------------------------------------VSLDKVHQVLDEQKIEGA
Q0HWQ6_SHESR          ------------------------------------------VDLNVLRTKLSAPELDGA
C4L7L0_TOLAT          ------------------------------------------ADLDVVRSALNKQGLEGA
Q5QVF2_IDILO          ------------------------------------------ADLSRVRGALDEEGFSDA
Q5E3D5_ALIF1          ------------------------------------------AQLPDIRSALEAKGFGDA
SECF_HAEIN            ------------------------------------------ANLEQIRSKLHENGIESP
D4ZB75_SHEVD          ------------------------------------------VASKDISDLLSLASDQEV
C3LVV7_VIBCM          ------------------------------------------VTKSQLMDQLQPVLGESV
E1SV06_FERBD          ------------------------------------------YSGLDLTSRLEQGLGQTV
A1S8J4_SHEAM          ------------------------------------------TRIDEVETALAHLGDGSI
B7VU09_VIBTL          ------------------------------------------VTKDALKTKLDTAFQQDV
B7VQK9_VIBTL          ------------------------------------------VTQVQLKSHLDSALSQDV
Q15N35_PSEA6          ------------------------------------------INKKQMQDQLATHLTGDF
Q3IL51_PSEHT          ------------------------------------------IELKQLKTFIAKNHNGEF
A0KLF0_AERHH          ------------------------------------------KEAHELNALLTAPLAGVV
Q2RTI2_RHORT          ------------------------------------------MDPVDLRQSLRASVVGEV
C5ZWZ3_9HELI          -----------------------------------------APLADIRQKLESVEDFKGA
C3XE90_9HELI          -----------------------------------------APMAEIRKLLATDERFKNA
E7A9U2_HELFC          -----------------------------------------VSVAKVREVVST--QFKGV
A8ERU7_ARCB4          -----------------------------------------APIEKIREVL-KDTKYASA
D1B3G6_SULD5          -----------------------------------------APLDKIREDLAKDKMFAGA
A6Q513_NITSB          -----------------------------------------VDIAAIRKALKKSEIFQDA
E4U019_SULKY          -----------------------------------------APIDKVREALEKDELFKHA
A7ZE41_CAMC1          -----------------------------------------APLDKIRDAFGTNEVLKNA
E1YHR4_9DELT          ------------------------------------------VEIAKIKSGLESVDIRKA
A8ZW13_DESOH          ------------------------------------------VSTNTIASSLKTVGIDVS
B8F9E2_DESAL          ------------------------------------------PTAQEVRSALATIGLDKA
E1QIL9_DESB2          ------------------------------------------TDAGQIKKALAPLGMADA
C7LN35_DESBD          ------------------------------------------VELDKIRMALDSPALTGL
C4XR64_DESMR          ------------------------------------------MDAERIDKAVEEVGLKNV
C8X141_DESRD          ------------------------------------------VSLKDIKAALATAELPSL
B8J2Q5_DESDA          ------------------------------------------VADEALKKSLDIPALPGI
A0A0H3AA07_DESVV      ------------------------------------------VEDEAIKKSLADADLPGL
Q1MSC2_LAWIP          ------------------------------------------IEDEHIKEALTKLNLPGL
Q3A3C5_PELCD          ------------------------------------------TKAAQIKSALKEMDMKGL
Q2LVH3_SYNAS          ------------------------------------------TSVEKLRQTLEPIGMENS
SECF_CALNY            ------------------------------------------ADLNKLRQGIGNLKIGDV
D4H482_DENA2          ------------------------------------------PDVDKIRSAMDSLDIGEV
SECF_MAGMM            ------------------------------------------MDLAPVRQAIAPLDLGDT
SECF_DESIS            ------------------------------------------PVIEEIRSHLSAVGLGDS
E8T6K2_THEA1          ------------------------------------------GITTGKIREIFKGSVEGV
SECF_AQUAE            ------------------------------------------VDIGKLRKTISSAGIKGF
D3SMD0_THEAH          ------------------------------------------QSTADIRKVLERSGVSAF
B4U6P7_HYDS0          ------------------------------------------VSVKQVDDALYKVDIKDA
C0QRM5_PERMH          ------------------------------------------VNTGDVRNALRIVNLQDS
SECF_PETMO            ------------------------------------------YTIDELRNGLQTINQEYA
C5CF37_KOSOT          ------------------------------------------MSVGEMRGLLSSVNPIFE
A7HMQ5_FERNB          ------------------------------------------MTVADVRQKISSLGQEFT
A6LP85_THEM4          ------------------------------------------VDESFVRETIKNLAPEFE
Q9WZW5_THEMA          ------------------------------------------VTENDIRAAISQISEEFA
B8JH53_ANAD2          ------------------------------------------VDPADIRKTVEDLGFKGA
Q1D3B7_MYXXD          ------------------------------------------ITAEEVRERADKGGLPDV
E1X0T7_HALMS          ------------------------------------------INLDGLRKELADAGFKGI
Q6MKZ3_BDEBA          ------------------------------------------VTIDQVRDSVAGLDLGEV
A9F8C8_SORC5          ------------------------------------------VSSAEVREAVTKAGFDSP
D0LJ87_HALO1          -----------------------------------------KVGVGEVRQSLEGAGFDGI
B3T9T6_9ZZZZ          ---------------------------------------SSLVVREQLSAIGHE-----G
D2BGI5_DEHMV          ---------------------------------------SIDELTQELRSLGHN-----E
A9WGQ9_CHLAA          ---------------------------------------TDR-IAQAFAEAGFE-----S
A9B5U8_HERA2          ---------------------------------------LENDVNAVFAESGIE-----G
SECF_ANATU            ---------------------------------------APAEVVALYNDLGIT-----D
SECF_THET1            ---------------------------------------RIEDVRSALAQAGYN-----E
D1C4J4_SPHTD          ---------------------------------------QPGEVQRVLAANGYD-----G
B4WJX7_SYNS7          ---------------------------------------TDPIDISEVRQVLNS------
SECF_ACAM1            ---------------------------------------KTPIQIAEVRQILDE------
A0A0H3K5W7_SYNP6      ---------------------------------------DRRLEAGAIREVLTS------
B8HQ25_CYAP4          ---------------------------------------AKPIDITTVREVMSE------
SECF_SYNP2            ---------------------------------------TDPLETATIQNVVNN------
SECF_SYNY3            ---------------------------------------PAAIDVAEVQDILGG------
D3EPH1_ATETH          ---------------------------------------ITPIDTKIVRDILST------
Q2JKR7_SYNJB          -----------------------------------------PVTTEELRRALQE------
Q7NDR5_GLOVI          ----------------------------------------AIPDIAKVRAEVGE------
SECF_PROMA            ---------------------------------------TTINISEAFNNAKFS--NQE-
A2CA57_PROM3          ---------------------------------------KTKSVEEVLGALELP--ADKD
Q46L53_PROMT          ---------------------------------------NTSEISNNIIALKKQDKSFSS
A5GTK4_SYNR3          ---------------------------------------TVQQVQDALPA----------
Q7V1E6_PROMP          ---------------------------------------SPDLVIEKLRSFSNN------
B5Y8Y1_COPPD          ---------------------------------------TRIALEAGIHDPIVR------
D4JXA7_9FIRM          -----------------------------------------VKKTVE-GENYG-------
E6UEG8_RUMA7          -----------------------------------------VQDVVT-EVLDQ-------
D4LA66_RUMC1          -----------------------------------------VETLAK-GILNT-------
A0A2N0UMZ5_9FIRM      -----------------------------------------LTDFIQVETTED-------
E1PK78_MAGIU          -----------------------------------------AEEVVSNAIKKP-------
E6U7Q5_ETHHY          -----------------------------------------AQTLANKTIAGG-------
A3DDV8_HUNT2          -----------------------------------------KAENIAKEAIG--------
B8I6M7_RUMCH          -----------------------------------------NTQDLQTQIADFVT--ETI
E0RMP8_PAEP6          -----------------------------------------IQTLLD-------------
C6D7X9_PAESJ          -----------------------------------------AKDILS-------------
C0ZAP7_BREBN          -----------------------------------------VEEVIK-------------
SECF_ALIAD            -----------------------------------------VRQMFA-------------
Q5WHQ4_BACSK          -----------------------------------------LLDDFA-------------
D6XWY7_BACIE          -----------------------------------------VMAEFE-------------
B1YJQ6_EXIS2          -----------------------------------------VRSVIE-------------
B7R9G0_9THEO          ---------------------------------------KDIIKILNDYKVKD-------
D9TNU6_THETC          ---------------------------------------NEITNILRSNGVKE-------
C6PXQ6_9CLOT          -----------------------------------------VDSIVKKY-DSE-------
Q892A5_CLOTE          -----------------------------------------VEKILKKY-TND-------
A6LTN3_CLOB8          -----------------------------------------VDTIIRSY-APD-------
Q97GT8_CLOAB          -----------------------------------------VEKIVDKY-IKD-------
D9SMV1_CLOC7          ---------------------------------------AKIIDIVRTY-DAD-------
A6TQN5_ALKMQ          -----------------------------------------IREITDQY-DPG-------
E3GFZ4_9FIRM          -----------------------------------------ARQITDQY-DKS-------
D9TIR8_CALOO          ---------------------------------------ADLEKLTKQITGTQ-------
D9RXQ1_THEOJ          -----------------------------------------AKKLMESFNLRT-------
D9QVJ2_ACEAZ          -----------------------------------------IREVLAGFDLDK-------
E4RIJ9_HALHG          -----------------------------------------VRAVLQQIGIAE-------
B2A264_NATTJ          -----------------------------------------VRDIMGEHGL-E-------
A0A1H8CTT8_9FIRM      -----------------------------------------VRAVLNEYNLSN-------
D1BLM5_VEIPT          -----------------------------------------VRDVLKEYNLEN-------
SECF_ACIFV            -----------------------------------------VRTVLSDHQLGS-------
C8W4E2_DESAS          -----------------------------------------LRNALSEYELQD-------
A5D3H0_PELTS          -----------------------------------------VRSVLGGFGLEG-------
A4J545_DESRM          -----------------------------------------VRAVLAEYKLAD-------
B1I4K4_DESAP          -----------------------------------------VRAVLTGHGLER-------
C9R7V2_AMMDK          -----------------------------------------VRQVMASFGLQD-------
B0TF82_HELMI          -----------------------------------------VRDVLDKANVGS-------
D5XEJ7_THEPJ          -----------------------------------------VRQALDKLDLGN-------
Q2RHU7_MOOTA          -----------------------------------------VRDVLDGLNLGK-------
D7CLE8_SYNLT          -----------------------------------------VRSVLDSLDLGE-------
Q0AX23_SYNWW          -----------------------------------------VRSTLEELKFIDQ------
SECF_SEBTE            -----------------------------------------MDKTLKEMASKYPS--LK-
E3CUY4_9BACT          ------------------------------------------VEVGQVREALAGVGQGQA
D5EDU6_AMICL          ------------------------------------------VPVGDVRDVLAEIGQKQA
D4M8L9_9BACT          ------------------------------------------PEVAEVRKVVSGVVAQEA
E6SLR1_THEM7          ------------------------------------------VEAGAIRSVLAEQGLDDA
B5H469_STRC2          ------------------------------------------VDADRARQAVADAGFPRA
SECF_GEMAT            ------------------------------------------PDVAEVRSALDAAGIQGA
Q67LL9_SYMTH          ------------------------------------------VTIEQVRTVIDSALGIDA
C4RGU1_MICS3          --------------------------------------TLDDAERTVDAALASTAAGAEV
D2S9H9_GEOOG          --------------------------------------QLAEVEE------AAEEAGAEV
D3PYP6_STANL          --------------------------------------SLTEVEA------AVEADGVEV
SECF_MYCLE            --------------------------------------GTGAIEVAQVADVFKKTLGSDP
B1MCI7_MYCA9          ---------------------------------------KGDATVQQTEDVFSQTLGHDA
Q5YTF3_NOCFA          ---------------------------------------AGDATTSEVETVYHNTLGTDP
D0LCM9_GORB4          ---------------------------------------SSGITADSVEKVVTDALGSAP
D6Z7I7_SEGRD          ---------------------------------------DGKTDNGAVSRVVAEATGQEP
D5UNI8_TSUPD          ---------------------------------------SAQADTAKAREVVQSATGIAP
C3PGQ3_CORA7          ---------------------------------------AGDLSTEQVEETFTEATGVTP
Q79VF7_CORGL          ---------------------------------------ASDYSTEQVEETFTEATGITP
D9QAR8_CORP2          ---------------------------------------AGNLETASVSKTFEDATGVEP
C4LIX4_CORK4          ---------------------------------------AGDVSKTEVADTFHEATGVEA
Q4JVE2_CORJK          ---------------------------------------AGGATESSVSEIFENATGIAP
B1VDK1_CORU7          ---------------------------------------SANVQQDAVERVFTEATGVAP
C6WCM8_ACTMD          --------------------------------------EGTSISQEAVQDSFKKSVGEDA
C7MR00_SACVD          --------------------------------------NGT-ITTEEAQEVFSDTLGRNP
C8XE15_NAKMY          --------------------------------------DSASVSNSQIAQTVTSATGVET
A0LUK2_ACIC1          --------------------------------------GYST---SQVADVV--SGAGVS
D7BWW9_STRBB          --------------------------------------SVSA---SHAREVAE-SASGGH
Q0RNU2_FRAAA          --------------------------------------GGTV---EQVEQTLSSVGIDPA
D1AEV5_THECD          --------------------------------------QASI---EQVRATV--AEAGAH
C7QJQ2_CATAD          --------------------------------------TAST---QTIQKSV---SSIVK
D7BNQ3_ARCHD          --------------------------------------SITE--HKPAYDVI-KTVGKD-
D6ZHF3_MOBCV          --------------------------------------VKNPP-QQPAYNAV-KAAGLN-
A0JXA8_ARTS2          --------------------------------------KTTE--ASLGEKAV-QDVVEG-
C5CCH8_MICLC          --------------------------------------ASTD--VAAGERAV-TDVLAD-
D2NT09_ROTMD          --------------------------------------AHVD--TATGERII-HEKAKDA
B0REC3_CLAMS          --------------------------------------QSQS--QDIASDAV-ATVTP--
Q6AFB1_LEIXX          --------------------------------------QNTD--TRKAQSAL-ASVVPN-
A6WCH5_KINRD          --------------------------------------SDV----DAAREAV-ESVLPG-
D1BGW3_SANKS          --------------------------------------STLS--QQEALDAV-ASVAPA-
D1BSK2_XYLCX          --------------------------------------STTT--QGPAIDAV-RAVVPG-
C7MCC3_BRAFD          --------------------------------------SDTE--QTSARDVV-RDHLPG-
E6SB76_INTC7          --------------------------------------TNTQNYEAKAQEAI-GEA-GIP
C7NI43_KYTSD          --------------------------------------SDTTGYEERASDAL-SDSVGAG
Q83MZ6_TROWT          --------------------------------------KQKS--IELAREVV-KKTVDK-
D4HDX0_CUTAS          --------------------------------------VATS-TIDDVRKSVLSSGAPDM
D7GDS8_PROFC          --------------------------------------STSSQSVDQVRKAVDESKVPDL
D2PVF2_KRIFD          --------------------------------------VTDS-TVDDFSNAVKATNAEDL
A1SJB0_NOCSJ          --------------------------------------SADQALADQLRTDVAATGIDAA
C7LYS7_ACIFD          --------------------------------------------TLSVTQARSALAGLPL
Q1AWC9_RUBXD          ------------------------------------------SRRLGEGELRDQLPPFVR
E1QZN4_OLSUV          ----------------------------------------GSISIGQMRSALVSAGEEDP
D8IEE2_BRAP9          -----------------------------------------VINIAEIRNLYRNFGTETV
                                                                                  

E1R5K6_SEDSS          QVQVVGDPS-------------------------RQEFLLRIADPA--------------
E0RQA8_SPITD          QVQTIGDPE-------------------------AQEFLIKVKEEE--------------
SECF_BORBU            NSIFSPDQN-------------------------KSEFSIMVKSDV--------------
SECF_TREPA            VVQQVGVRA-------------------------EHTFQVRVAAETAFPSSLLPEQGGTA
Q73PW5_TREDE          SVQQLGTPE-------------------------DRYFQIRLADDGKYEDANK-------
B0SPU5_LEPBP          FQLDVGLGS-------------------------LSTIETLYKEIP--------------
Q72PD4_LEPIC          YQIDIGLGS-------------------------VDSILLKYREKNGL------------
SECF_DICTD            ----------------------------------ARSFYSKSTIQTGSNGKE--------
B0VHR6_CLOAI          EITYIGNPA-------------------------NSTFQIKIKSVGKGTDLS--------
A1BCH7_CHLPD          TLKQYGLDR-------------------------SFLFSTAFNGQTNELKS---------
SECF_RHOM4            EVKTYGAE--------------------------DILIRVAAEGDINEVQR---------
Q9WXE9_PRERU          GEKANQEAN-------------------------TSVIALGTDGKTVRISTNWDIESNNP
D5MHP4_9BACT          EPQQFAE---------------------------GDRIMVRLKRAED-------------
D8PI88_9BACT          ELQEFTQ---------------------------DNKLLIRVKASTT-------------
B6ANM4_9BACT          QIQNIQS---------------------------SSDILIRTKVGKK-------------
B5ECA5_GEOBB          NLQEIKG---------------------------GNRILVKVGKS---------------
B3E2R7_GEOLS          ELQEVKE---------------------------GNKLLVKLPRKSAL------------
SECF_THEYD            DIQELPT---------------------------EKKILIKLKKQ---------------
SECF_KORVE            DPKIQTYGGPA--NNEVLIALEQKETSEQALDAGKNTIIKALETNPASGKNDLNNVGSTT
E8X5J9_GRATM          DARIQRISGAA--NEV------------------SNQVVIALPESTATDSN---------
Q029K3_SOLUE          EVSVQSFTDPSAKNEVEIGTELADERLLAANRQAMEEVLAAAFGQPSSGKLDFNGASQQQ
SECF_ELUMP            QSYVGKN-------------------------TYMIKIKGSQENVNE-------------
SECF_UNCTG            ELQSSGN-------------------------LVMIRIKKDLEAQEE-------------
D0RNY4_9PROT          VKVKEFGNS--------------------------QTFLAIFEK----------------
B6BPL7_9PROT          VSVKKFGND--------------------------KDYLIKFEN----------------
B4WED0_9CAUL          VQVQGIARRDTN------------------VD-DGSTAILRFQVPE--------------
D5VIW1_CAUST          AQVQGFASQP-------------------------NSAMVKFLPAE--------------
Q0BS57_GRABC          AGVQRFGAED-------------------------DVLIRLDSQPN--------------
C6XJ03_HIRBI          VEVTEIKDNLVA------------------EETGTTIALIKTKAPDAEGEA---------
Q0ANE7_MARMM          ARVQGAGS--VG------------------DD--RTTYLISLPLQAGEGLE---------
Q0C0W7_HYPNA          ATDSNGAELVVI------------------RFGEVDASLLGPEFAELTDEEK--------
E2CQN2_9RHOB          VQVQQFGGE--------------------------DEVLIRVEE----------------
A7HXL1_PARL1          VQIQEFGQA--------------------------DDVLIRVQSP---------------
D8JWH2_HYPDA          VQIQEFGSP--------------------------DDVLVRLEE----------------
E3I015_RHOVT          IQIQNFGKD--------------------------DELLIRFPE----------------
B0UI93_METS4          TEVQEFGNQ--------------------------GAISIRFPL----------------
B2II62_BEII9          IEVQGFGTP--------------------------SDVTVRFGL----------------
E6VHR2_RHOPX          VQLQQFGGP--------------------------SEVLIRLAE----------------
A7IND7_XANP2          VQIQEFGSP--------------------------RDVLIRVGA----------------
D5BQT4_PUNMI          VSLQGFGTE--------------------------TDVLIRIQR----------------
Q2W4A8_MAGSA          VSLQEFGTTG-------------------------RDVMIRVQR----------------
B6ISI3_RHOCS          VQLQQFGGP--------------------------NDVLIRVQQ----------------
Q2NBX9_ERYLH          PVVQRFGEP--------------------------NEISIRVKLPP--------------
Q1GSE6_SPHAL          ATIQQFGSD--------------------------KAVSIRTALP---------------
D4YYJ1_SPHJU          GSLQQFGDP--------------------------KTVQIRLPLP---------------
SECF_RHOCB            VIISEVRDPSF-----------------------REDQHVAMIRIQ--------------
SECF_KETVY            VTITEVFDPGF-----------------------RADQFVKQVRIQ--------------
D0D195_9RHOB          STISEVFDPSF-----------------------GPEQNVAMVRIQ--------------
SECF_RICPR            VLQNFG-SERD--------------------------LSIRFGS----------------
A5CDU1_ORITB          SIHNFG-AEDV--------------------------FSIKIAN----------------
B9KH24_ANAMF          SVQGFGDSGQE--------------------------FMVVFRG----------------
Q2GI09_EHRCR          SVQGFKNNDRE--------------------------LMVRFKN----------------
Q5GT97_WOLTR          TIQSSK-AGNN--------------------------LVMYFRE----------------
C6V4R4_NEORI          ASIHYLEDQKH--------------------------IMIKVRS----------------
C1D5X5_LARHH          TVQALGTSHD---------------------------VLIRLP-----------------
B1XW93_LEPCP          QVQKFGTSRD---------------------------VLIRLPLREGVKQN---------
B6BWI7_9PROT          QVQNFGTDKD---------------------------VLIRMPL----------------
A5EWX6_DICNV          TVLQYGSARD---------------------------VQIRFAD----------------
C0N4C3_9GAMM          TVQNFGSIHD---------------------------VLIRLPVIE--TQN---------
A5CVL6_VESOH          NVQYFGSTNE---------------------------ILIRLEPQL--ISN---------
A1WXP7_HALHL          QVLHFGSPRE---------------------------IMVRIPPME--GVE---------
Q31FZ8_HYDCU          VVQNFGSAED---------------------------VLIRIAPKE--GVN---------
D3S9V5_THISK          QVQTFGTSRD---------------------------VLIRLPPSED-DDD---------
D3RSH8_ALLVD          TIQYFGSRTD---------------------------ILIRLAPQDGEEEA---------
C7RB48_KANKD          VVQNFGSAKV---------------------------VQIRMPQQD--HIE---------
A4GK29_9BACT          VLNFSGSQND---------------------------VSIKIPGGADSSN----------
A4GHV4_9BACT          QVANFGSSKE---------------------------VLIKLPGTVSDSL----------
B8KFI4_9GAMM          IVVSFGTDRD---------------------------VLIRLPDGYSDAQ----------
Q21KV9_SACD2          VVVNYGSDTN---------------------------VLMSLQQSVPPSAD---------
Q2SDV4_HAHCH          VVQKFGSDTS---------------------------ILVRLQQEHSESI----------
E4PKE9_MARAH          SVQNFGADTT---------------------------VLVRMAEADNDQL----------
A6VYM8_MARMS          VVQNFGSPTD---------------------------VVVRMANSYTATL----------
E1V6F3_HALED          AVQTFGASTE---------------------------VLIRLQQAFDADV----------
Q0VS96_ALCBS          VVQHYGSPKE---------------------------VNIRVAPKDDADAD---------
B3PDJ9_CELJU          VAVLFGSDRE---------------------------VMIRTQDQMKEKAL---------
Q8GEL5_PSEPU          VVQSFGATTD---------------------------LLVRMPGD---------------
D0SG96_ACIJO          VVQTIGSDRD---------------------------LIVRMPVQEDTA-----------
Q1QBR5_PSYCK          VVQYLGTSQE---------------------------LLIRLPPQSDN------------
Q83CH4_COXBU          VVRVYDV-RH---------------------------ISVRVAPHKELTQ----------
Q5ZU08_LEGPH          QVVSYGTSKD---------------------------VLISIAPRADKQQ----------
A0A0B3WJC7_FRATU      TITTFGDNNN---------------------------FLIKFAPDEVNTKA---------
B8L1U9_9GAMM          QVQSVGGNTD---------------------------LLIRLAPHGEHAPG---------
D0KW98_HALNC          VVQYFGSSET---------------------------VMIRLPPAKGQ------------
B7J4R6_ACIF2          VVQTFGGDRD---------------------------LLIRLRTVPGE------------
SECF_ECOLI            MLQNFGSSHD---------------------------IMVRMPPAEGE-T----------
Q8D162_YERPE          ILQNFGSSRD---------------------------VMVRMPPATG--T----------
Q1LSN7_BAUCH          IVQNFGSSQD---------------------------IIVRMPFMAN-------------
Q7VQA8_BLOFL          VVQCFNNTKN---------------------------IIVRLPLAHNFDK----------
E8Q616_BLOVB          VIQYLNNTNGG--------------------------VIIRVPLMKGVSC----------
Q493H0_BLOPB          IVQHFGSQKD---------------------------IMIRLPLDPNENK----------
A0KJ23_AERHH          TLQHFGSSRD---------------------------VLFRLTPKEGV------------
Q0HWQ6_SHESR          VVQNFGSSRD---------------------------VLVRLSVKEGV------------
C4L7L0_TOLAT          VVQYYGSTKD---------------------------VVIRIAPKGEL------------
Q5QVF2_IDILO          VVQNYGSQEE---------------------------ILIRLEPREGV------------
Q5E3D5_ALIF1          TVQNFGTARD---------------------------VIVRLQPRENV------------
SECF_HAEIN            IVQTTGSVQD---------------------------VMIRLPASN--------------
D4ZB75_SHEVD          SVISAGEPGRW--------------------------VLRYSLPSTQEDVS---------
C3LVV7_VIBCM          SATPSGEEGRW--------------------------VIRYPLAAEDAT-----------
E1SV06_FERBD          SLVQAGEPGRW--------------------------LIRTGPVDPQAS-----------
A1S8J4_SHEAM          SVV-ATEPGRF--------------------------LIRMGGTLDAHT-----------
B7VU09_VIBTL          QVVGMAEQDRW--------------------------TIRYSQLTDAPQ-----------
B7VQK9_VIBTL          QVTAAGSEGNW--------------------------QLRFNDTDLDLR-----------
Q15N35_PSEA6          ELNSSGANTQW--------------------------TIRQADGANHVIDK---------
Q3IL51_PSEHT          ELTAQG-NNHF--------------------------QLREAPAINQSASN---------
A0KLF0_AERHH          ELHGAGVPGEW--------------------------LIKLPPHELPWAA----------
Q2RTI2_RHORT          DVTTYGEDGRS--------------------------VTVRVGRQTGGDQ----------
C5ZWZ3_9HELI          QVSEFG--SPQ-------------------------EILIRLATATS-------------
C3XE90_9HELI          QVSRFG--ADN-------------------------EIIIKIPFNEN-------------
E7A9U2_HELFC          QVSEFG--APE-------------------------EMVIKIPLLAT-------------
A8ERU7_ARCB4          VVTEFG--STE-------------------------EVTIRITGSSS-------------
D1B3G6_SULD5          QITEFG--SDE-------------------------EIVIRFSTVSE-------------
A6Q513_NITSB          SVTKFG--SDN-------------------------EIVIRIKSSTK-------------
E4U019_SULKY          AVSEFG--SPE-------------------------EIVIKTAASTD-------------
A7ZE41_CAMC1          SVTEFG--SED-------------------------EAVIRFSGSSS-------------
E1YHR4_9DELT          TVQTFGEDKNN-------------------------EYLVRTDTPVT-------------
A8ZW13_DESOH          TVQAYGHPKEGD------------------C-----QYLVNSAMDMT-------------
B8F9E2_DESAL          TVQETHVEGQT-------------------------EFLIRTDVADG-------------
E1QIL9_DESB2          TVQFFGGDDKR-------------------------EFLVRTEKQDM-------------
C7LN35_DESBD          VVQDFGDVGDN-------------------------EVLLRA-SFS--------------
C4XR64_DESMR          TVQRFGNEEAN-------------------------EFLIRA-SDH--------------
C8X141_DESRD          NVQKFGTEGGN-------------------------EYLFRV-AAV--------------
B8J2Q5_DESDA          STQRFG-EGGR-------------------------DYLLRF-SSAE-------------
A0A0H3AA07_DESVV      SIQRFG-EGDE-------------------------DYLIRI-SDT--------------
Q1MSC2_LAWIP          TIQQFG-EDNK-------------------------AYLVRF-SSS--------------
Q3A3C5_PELCD          LVQNFEGDSHE--------------------------FLLRAQDTS--------------
Q2LVH3_SYNAS          IIQQFG---PN-------------------------EMVVRTAASS--------------
SECF_CALNY            SIQNFG--NPE-------------------------EVLIRLGKTR--------------
D4H482_DENA2          VIQNFG--APE-------------------------EILIRVEKT---------------
SECF_MAGMM            VVQSFG--TPE-------------------------EVLIRVEKQGAD------------
SECF_DESIS            TIQHFG--SDR-------------------------EILVRAPIISDE------------
E8T6K2_THEA1          TVQNVQ--GEN-------------------------EFMIKAPATGD-------------
SECF_AQUAE            LIQETKEG----------------------------TFVIKVKTGEP-------------
D3SMD0_THEAH          QVQDTAQG----------------------------TILVRLKVDEP-------------
B4U6P7_HYDS0          VVQRTNTG----------------------------DIIVKIRVGEK-------------
C0QRM5_PERMH          VIQEIGTDKREY------------------------EIRVSLKKGKS-------------
SECF_PETMO            TAKIIQTNPGG-------------------------GASDQFFYIITVRD----------
C5CF37_KOSOT          SARIIKQKPLTQ-----------------------EGSSDQLARFSIVVN----------
A7HMQ5_FERNB          NARILEVHALGQ-----------------------ETDKT-FSIVVAPKDEKG-------
A6LP85_THEM4          SARVTQIKSIDD-----------------------PKGITKFSIVVSPRDENG-------
Q9WZW5_THEMA          NARIVEVRSAGD-----------------------PSNVQKYSIIVP-------------
B8JH53_ANAD2          SVQTYGAEAE-------------------------HTFLIRVERISLLTEADVARVADAV
Q1D3B7_MYXXD          SVQNIGAAEE-------------------------NTFLLRMGGVTQLNEESGAKGKEAL
E1X0T7_HALMS          AAQTIGERSQ-------------------------NEFLVKVQG----------------
Q6MKZ3_BDEBA          GVQSFGEGNE---------------------------FIIRFQGREGKTDKE--------
A9F8C8_SORC5          DVVSVADQANP------------------------NRYLIRVHEVSTLSEQQKAAVRDRM
D0LJ87_HALO1          EVSGYSFNEDLPNGESRA----------------VEGILVRTPTFGVADEQESEQILDSF
B3T9T6_9ZZZZ          AIVQATGGNS---------------------------FFIRLGELEQEELDG--------
D2BGI5_DEHMV          AIVQITGDGD---------------------------YLIRTTELDVSQK----------
A9WGQ9_CHLAA          AQVQLSPTVIDGQP--------------------VAAALVRTRPLSESDP----------
A9B5U8_HERA2          ARTQLSQGTTNNQQ--------------------FVIAFVRSKSVQ-SD-----------
SECF_ANATU            AQVTTTGNNT---------------------------LLVRSSFID--------------
SECF_THET1            AFVQSFGQQSNTAQG-----------------TVTRGVSMRLPEIK--EN----------
D1C4J4_SPHTD          SMVQTS--EDN-------------------------VVLIRTKEIQ--EG----------
B4WJX7_SYNS7          ---QDLTGSSIQLSG-----------------EDQQSIVVRTRNLDVDQR----------
SECF_ACAM1            ---QKLAESNVQVIG-----------------QNAQGVAIRTKDLNQEER----------
A0A0H3K5W7_SYNP6      ---AGLERSNVQVIG-----------------QEQQGFVISTGDLSPEAR----------
B8HQ25_CYAP4          ---EGLGNSSIQIL-------------------DQYGVSIRTQALDVDRR----------
SECF_SYNP2            ---QGVGSSTVQILG-----------------QERTTFSVRTPQLDVDQR----------
SECF_SYNY3            ---VGLGNSSVQVI-------------------EDYTLSIRQQTLDVEQR----------
D3EPH1_ATETH          ---RNLNDNTIQVL-------------------ENNILSIQTKALDVEQR----------
Q2JKR7_SYNJB          ---HNLGSSIIQLDT-----------------QTGQEALIRMPPLSETER----------
Q7NDR5_GLOVI          ---AGYPNSVVQQI-------------------GSDTIAVRTRPLSQPER----------
SECF_PROMA            -TSQKLFDARIQFL------------------DGYKSLLIRSPELSPSES----------
A2CA57_PROM3          KVAPNLSRARVQLL------------------DGGQSLVLRLPFLSAAQG----------
Q46L53_PROMT          NTSPNLSRSQIQLL------------------DNSQLISIRLPFLSANQS----------
A5GTK4_SYNR3          -------AAVVQLL------------------DDGQAVSIRSSALSPADS----------
Q7V1E6_PROMP          --KNLLNNIKLQIQ------------------NNNSLISIRTPYLTIEES----------
B5Y8Y1_COPPD          ------------------------------------KSGANEYELRAKID----------
D4JXA7_9FIRM          ----AVTVTTGSSMN-----------------S---SLEVIEISFS-SSEG---------
E6UEG8_RUMA7          ----KSTVTKGENAA-----------------T---KQTTVKIQLS-STGG---------
D4LA66_RUMC1          ----PVTIQTGEALG-----------------DG--SGKTMTISFS-CAEGS--------
A0A2N0UMZ5_9FIRM      ----RITTTYAQDLM-----------------GD--SGTTVTVQFS-GNDS---------
E1PK78_MAGIU          ----VSMQIISSLES-----------------SSEKKVRSLVINVA-DNQA---------
E6U7Q5_ETHHY          ----DFTVQVDKVPA-----------------S-----HTQLLVLQ-TTKA---------
A3DDV8_HUNT2          KSGIHVQKSYTFNPT-----------------NSDEAISFLVIK----SSGK--------
B8I6M7_RUMCH          NKPAKVQKSTAYDVS-----------------KNKNAESFDVITISIGSKDT--------
E0RMP8_PAEP6          ----KQG--IGKEVD-----------------YT---PGK--ERFGIRFSQV--------
C6D7X9_PAESJ          ----QSG--YSDITP-----------------TV---GGTNGDRVSARFDDV--------
C0ZAP7_BREBN          ----KEV--PNVNFS-----------------KV---TPYGENQAYTRFDQT--------
SECF_ALIAD            ----SIGLPLGDTSL-----------------TV---GGIQQNVVMVTLPEQ--------
Q5WHQ4_BACSK          ----AINESYTPNIT-----------------LG---GEQS-QSATARFTVE--------
D6XWY7_BACIE          ----NIG-YIPDDLT-----------------LA---GDTN-EIGRAQFIGD--------
B1YJQ6_EXIS2          ----DAGIDAAEING-----------------VQ---FAQGGKLANVTFVGE--------
B7R9G0_9THEO          ---YQIQKIG----------------------TKGDHVSIKTSP----------------
D9TNU6_THETC          ---SQVKAIG----------------------PNNTHVSITTPS----------------
C6PXQ6_9CLOT          ---FQSNKV------------------------NNTSIEIKSAK----------------
Q892A5_CLOTE          ---YTTNEARDK--------------------DNNIQLEIRSNS----------------
A6LTN3_CLOB8          ---ASTNTI------------------------NNNQYEIKSAD----------------
Q97GT8_CLOAB          ---STITTV------------------------NNTEVEIKSST----------------
D9SMV1_CLOC7          ---VIYNTAVDSKV------------------NDSTQIDLKSNSGN--------------
A6TQN5_ALKMQ          ---ASINHLG----------------------NERTTIQIRTIE-D--------------
E3GFZ4_9FIRM          ---AEITYAG----------------------DGQDRIVISTKE-S--------------
D9TIR8_CALOO          ---TPIVRKVE----------------------DGKKIMINAHEVHGKNKTE--------
D9RXQ1_THEOJ          ---VEVREAG----------------------DDRQELIVRTVV----------------
D9QVJ2_ACEAZ          ---KSVVQNT-----------------------GEMGILIRTVN----------------
E4RIJ9_HALHG          ---DATIQETDQD--------------------GLRGIMIRGQA----------------
B2A264_NATTJ          ---DSVIQEAGGDE------------------AEEREVIIRTVS----------------
A0A1H8CTT8_9FIRM      ---STIQLSGESSSS-----------------TESENVMIRTVD----------------
D1BLM5_VEIPT          ---AQIQLSGDTTGD-----------------TAGEDVMIRTRN----------------
SECF_ACIFV            ---SVIQLGSSDQQV-----------------ESSQSVLIRTGL----------------
C8W4E2_DESAS          ---SVIQQSGG------------------------NDYIIRTKE----------------
A5D3H0_PELTS          ---ASIQRSNE------------------------TDFLIRTRE----------------
A4J545_DESRM          ---SKVQTSGE------------------------NTYLIRTHA----------------
B1I4K4_DESAP          ---SVIQLSGD------------------------RQVLIRTGV----------------
C9R7V2_AMMDK          ---ALIQKSGT------------------------SVFLIRTRP----------------
B0TF82_HELMI          ---STIQLAEG------------------------NSVIVRTHT----------------
D5XEJ7_THEPJ          ---SVIQKTAT------------------------GEFIIRTKT----------------
Q2RHU7_MOOTA          ---SSIQESGS------------------------NQFLIRTTE----------------
D7CLE8_SYNLT          ---SSIQRSGD------------------------REFFIRTRM----------------
Q0AX23_SYNWW          ---SSIQKSG-------------------------NEFLIRTRE----------------
SECF_SEBTE            --SNKVQYSEG------------------------NTVLLRTQI----------------
E3CUY4_9BACT          TIQAYSD----------------------------RGVIVRFQSQSG-------------
D5EDU6_AMICL          VIQGYSD----------------------------NGVIIRVNVDTE-------------
D4M8L9_9BACT          MIQKFGE----------------------------KGVIIRTNEDTE-------------
E6SLR1_THEM7          IVQLSEEG---------------------------RVAFLRTPHVDQ-------------
B5H469_STRC2          VVQKTGE----------------------------RGITVRTGELDN-------------
SECF_GEMAT            EIQQFGANTDFTIRAR-------------------DEKQVEAQDAGAE------------
Q67LL9_SYMTH          QIQQVEPKGAASPEA--------------------TEFLVRTPELSAE------------
C4RGU1_MICS3          VTAQKVGGTGG------------------------DFYEMRTSQLTAEQ-----------
D2S9H9_GEOOG          ASAQVVGGNA---------------------------LLLRTGALDNET-----------
D3PYP6_STANL          VTAQTAGTGDD------------------------ATVVVRTESLPNKE-----------
SECF_MYCLE            ESVVVVGNGAS------------------------ATVRISSKTLSNDQ-----------
B1MCI7_MYCA9          ESIVVTGTGDS------------------------ASIQIRTEKLDNEQ-----------
Q5YTF3_NOCFA          VSVQTVGSGST------------------------ATMLIRSEALSTEQ-----------
D0LCM9_GORB4          ESVQTAGSGAS------------------------ETVQVRTEALELTQ-----------
D6Z7I7_SEGRD          VSVQTVGAGSS------------------------ATVQVRTGDLNNAQ-----------
D5UNI8_TSUPD          SAVQTAGSGAS------------------------QTYQISTSELSADQ-----------
C3PGQ3_CORA7          ELVQIVGAGSS------------------------ETLEITSERLSQDE-----------
Q79VF7_CORGL          EIVQIVGSGDA------------------------RTLEIYSERLSDED-----------
D9QAR8_CORP2          KLVQIVGAGDT------------------------RILEINSKRLSEEQ-----------
C4LIX4_CORK4          QQVQIIGSGNA------------------------RNVEIESKHLNDDE-----------
Q4JVE2_CORJK          QSTQTVGSGDA------------------------ESIEITSERLSEEQ-----------
B1VDK1_CORU7          NAVQTVGSGDS------------------------QVIEINSERLSEDQ-----------
C6WCM8_ACTMD          TSVQTVGTGDA------------------------ATFQIRSETLTTQQ-----------
C7MR00_SACVD          AETQQVGTGEA------------------------ATIQLRSETLTPAE-----------
C8XE15_NAKMY          ESVQTVGN----------------------------QIQVTSSSLSVDQ-----------
A0LUK2_ACIC1          DPVVQHLSRPGVGG---------------------ATFQVQTKALDKSA-----------
D7BWW9_STRBB          TAVVQELGRGG--------------------------LRIQISELGTKE-----------
Q0RNU2_FRAAA          DGVVQQLETSK-------------------------QFRVQTPTLTDAQ-----------
D1AEV5_THECD          QVIVQETATSG--------------------------WRVTTESLNTAE-----------
C7QJQ2_CATAD          DPTVQTSNDSQ--G---------------------RHVVVKTTPLSTDQ-----------
D7BNQ3_ARCHD          DSPRVASLGSS-------------------------SIRVQTVKLDDKQ-----------
D6ZHF3_MOBCV          EQTKVAQMGTN-------------------------GLRVQTSQQPNDV-----------
A0JXA8_ARTS2          SIPRVANVAGN-------------------------TMRIQTDKLTDDE-----------
C5CCH8_MICLC          GHATVTNVAPG-------------------------TVRVQTEQLDDAQ-----------
D2NT09_ROTMD          SDVRVTNIAPG-------------------------TIRAQMSKLSDDE-----------
B0REC3_CLAMS          VPARVSSVGSD-------------------------GVRVQTDQLQPAD-----------
Q6AFB1_LEIXX          AVSHVSVVGRD-------------------------AVQVQTDQLSETQ-----------
A6WCH5_KINRD          TVPTVTTVGSD-------------------------GVRVQTETVTTGE-----------
D1BGW3_SANKS          EQPRISSVGSS-------------------------ALRVQTAALDEDE-----------
D1BSK2_XYLCX          DEPRVASLGAN-------------------------ALRIQTTTLTPEE-----------
C7MCC3_BRAFD          NEPKITVLGGS-------------------------TLRVQTEELDSDE-----------
E6SB76_INTC7          GTVTATVVGAN-------------------------TVRVQTETAQDKT-----------
C7NI43_KYTSD          EAVRSSIIGGD-------------------------TVRVQAASLEGGTQA---------
Q83MZ6_TROWT          --PSVVTTFGK-------------------------GLVVRTDQLSDTQ-----------
D4HDX0_CUTAS          DATEVVSLGSD-------------------------AVQVQTRALNNDE-----------
D7GDS8_PROFC          TGAQATAVGTG-------------------------TVRVQVRSLSTDE-----------
D2PVF2_KRIFD          GDPVVTTIGTD-------------------------KVRVQTRPLSQDD-----------
A1SJB0_NOCSJ          QQPVVTTSGKD-------------------------AVLIQVKPLTTAE-----------
C7LYS7_ACIFD          SGTTVVSLGTG--Q---------------------HRTIEVEADLPTSGAR---------
Q1AWC9_RUBXD          QDAVIQRLGEE-------------------------GYEVRTPVLNRQQ-----------
E1QZN4_OLSUV          TVQTSVTEGAQ-------------------------GFLVRSDTIDPKT-----------
D8IEE2_BRAP9          NIQELEGEDN------------------------INAFLLRFRGSNE-------------
                                                                                  

E1R5K6_SEDSS          ------------------------------------------------------------
E0RQA8_SPITD          ------------------------------------------------------------
SECF_BORBU            ------------------------------------------------------------
SECF_TREPA            LA--------------------QSDA----------------------------------
Q73PW5_TREDE          ------------------------------------------------------------
B0SPU5_LEPBP          ------------------------------------------------------------
Q72PD4_LEPIC          ------------------------------------------------------------
SECF_DICTD            ------------------------------------------------------------
B0VHR6_CLOAI          ------------------------------------------------------------
A1BCH7_CHLPD          ------------------------------------------------------------
SECF_RHOM4            ------------------------------------------------------------
Q9WXE9_PRERU          EV--------------------DDKAETIL------------------------------
D5MHP4_9BACT          ------------------------------------------------------------
D8PI88_9BACT          ------------------------------------------------------------
B6ANM4_9BACT          ------------------------------------------------------------
B5ECA5_GEOBB          ------------------------------------------------------------
B3E2R7_GEOLS          ------------------------------------------------------------
SECF_THEYD            ------------------------------------------------------------
SECF_KORVE            IR--------------------DYLMSKDPLHEVVDPGAKYQQIASQIVDYRDKERGG--
E8X5J9_GRATM          ---------------------------------------------------HDQGR----
Q029K3_SOLUE          LI--------------------DRLREPLARAGVPMSDPQLQKLVADMMNFRDTPPRSGM
SECF_ELUMP            ------------------------------------------------------------
SECF_UNCTG            ------------------------------------------------------------
D0RNY4_9PROT          ------------------------------------------------------------
B6BPL7_9PROT          ------------------------------------------------------------
B4WED0_9CAUL          ------------------------------------------------------------
D5VIW1_CAUST          ------------------------------------------------------------
Q0BS57_GRABC          ------------------------------------------------------------
C6XJ03_HIRBI          -----------------------------------------------------------V
Q0ANE7_MARMM          -----------------------------------------------------------G
Q0C0W7_HYPNA          -----------------------------------------------------------A
E2CQN2_9RHOB          ------------------------------------------------------------
A7HXL1_PARL1          ------------------------------------------------------------
D8JWH2_HYPDA          ------------------------------------------------------------
E3I015_RHOVT          ------------------------------------------------------------
B0UI93_METS4          ------------------------------------------------------------
B2II62_BEII9          ------------------------------------------------------------
E6VHR2_RHOPX          ------------------------------------------------------------
A7IND7_XANP2          ------------------------------------------------------------
D5BQT4_PUNMI          ------------------------------------------------------------
Q2W4A8_MAGSA          ------------------------------------------------------------
B6ISI3_RHOCS          ------------------------------------------------------------
Q2NBX9_ERYLH          -----------------------------------------------------------E
Q1GSE6_SPHAL          ------------------------------------------------------------
D4YYJ1_SPHJU          ------------------------------------------------------------
SECF_RHOCB            -----------------------------------------------------------M
SECF_KETVY            -----------------------------------------------------------A
D0D195_9RHOB          -----------------------------------------------------------A
SECF_RICPR            ------------------------------------------------------------
A5CDU1_ORITB          ------------------------------------------------------------
B9KH24_ANAMF          ------------------------------------------------------------
Q2GI09_EHRCR          ------------------------------------------------------------
Q5GT97_WOLTR          ------------------------------------------------------------
C6V4R4_NEORI          ------------------------------------------------------------
C1D5X5_LARHH          ------------------------------------------------------------
B1XW93_LEPCP          ------------------------------------------------------------
B6BWI7_9PROT          ------------------------------------------------------------
A5EWX6_DICNV          ------------------------------------------------------------
C0N4C3_9GAMM          ------------------------------------------------------------
A5CVL6_VESOH          ------------------------------------------------------------
A1WXP7_HALHL          ------------------------------------------------------------
Q31FZ8_HYDCU          ------------------------------------------------------------
D3S9V5_THISK          ------------------------------------------------------------
D3RSH8_ALLVD          ------------------------------------------------------------
C7RB48_KANKD          ------------------------------------------------------------
A4GK29_9BACT          ------------------------------------------------------------
A4GHV4_9BACT          ------------------------------------------------------------
B8KFI4_9GAMM          ------------------------------------------------------------
Q21KV9_SACD2          ------------------------------------------------------------
Q2SDV4_HAHCH          ------------------------------------------------------------
E4PKE9_MARAH          ------------------------------------------------------------
A6VYM8_MARMS          ------------------------------------------------------------
E1V6F3_HALED          ------------------------------------------------------------
Q0VS96_ALCBS          ------------------------------------------------------------
B3PDJ9_CELJU          ------------------------------------------------------------
Q8GEL5_PSEPU          ------------------------------------------------------------
D0SG96_ACIJO          ------------------------------------------------------------
Q1QBR5_PSYCK          ------------------------------------------------------------
Q83CH4_COXBU          ------------------------------------------------------------
Q5ZU08_LEGPH          ------------------------------------------------------------
A0A0B3WJC7_FRATU      ------------------------------------------------------------
B8L1U9_9GAMM          ------------------------------------------------------------
D0KW98_HALNC          ------------------------------------------------------------
B7J4R6_ACIF2          ------------------------------------------------------------
SECF_ECOLI            ------------------------------------------------------------
Q8D162_YERPE          ------------------------------------------------------------
Q1LSN7_BAUCH          ------------------------------------------------------------
Q7VQA8_BLOFL          ------------------------------------------------------------
E8Q616_BLOVB          ------------------------------------------------------------
Q493H0_BLOPB          ------------------------------------------------------------
A0KJ23_AERHH          ------------------------------------------------------------
Q0HWQ6_SHESR          ------------------------------------------------------------
C4L7L0_TOLAT          ------------------------------------------------------------
Q5QVF2_IDILO          ------------------------------------------------------------
Q5E3D5_ALIF1          ------------------------------------------------------------
SECF_HAEIN            ------------------------------------------------------------
D4ZB75_SHEVD          ------------------------------------------------------------
C3LVV7_VIBCM          ------------------------------------------------------------
E1SV06_FERBD          ------------------------------------------------------------
A1S8J4_SHEAM          ------------------------------------------------------------
B7VU09_VIBTL          ------------------------------------------------------------
B7VQK9_VIBTL          ------------------------------------------------------------
Q15N35_PSEA6          ------------------------------------------------------------
Q3IL51_PSEHT          ------------------------------------------------------------
A0KLF0_AERHH          ------------------------------------------------------------
Q2RTI2_RHORT          ------------------------------------------------------------
C5ZWZ3_9HELI          ------------------------------------------------------------
C3XE90_9HELI          ------------------------------------------------------------
E7A9U2_HELFC          ------------------------------------------------------------
A8ERU7_ARCB4          ------------------------------------------------------------
D1B3G6_SULD5          ------------------------------------------------------------
A6Q513_NITSB          ------------------------------------------------------------
E4U019_SULKY          ------------------------------------------------------------
A7ZE41_CAMC1          ------------------------------------------------------------
E1YHR4_9DELT          ------------------------------------------------------------
A8ZW13_DESOH          ------------------------------------------------------------
B8F9E2_DESAL          ------------------------------------------------------------
E1QIL9_DESB2          ------------------------------------------------------------
C7LN35_DESBD          ------------------------------------------------------------
C4XR64_DESMR          ------------------------------------------------------------
C8X141_DESRD          ------------------------------------------------------------
B8J2Q5_DESDA          ------------------------------------------------------------
A0A0H3AA07_DESVV      ------------------------------------------------------------
Q1MSC2_LAWIP          ------------------------------------------------------------
Q3A3C5_PELCD          ------------------------------------------------------------
Q2LVH3_SYNAS          ------------------------------------------------------------
SECF_CALNY            ------------------------------------------------------------
D4H482_DENA2          ------------------------------------------------------------
SECF_MAGMM            ------------------------------------------------------------
SECF_DESIS            ------------------------------------------------------------
E8T6K2_THEA1          ------------------------------------------------------------
SECF_AQUAE            ------------------------------------------------------------
D3SMD0_THEAH          ------------------------------------------------------------
B4U6P7_HYDS0          ------------------------------------------------------------
C0QRM5_PERMH          ------------------------------------------------------------
SECF_PETMO            ------------------------------------------------------------
C5CF37_KOSOT          ------------------------------------------------------------
A7HMQ5_FERNB          ------------------------------------------------------------
A6LP85_THEM4          ------------------------------------------------------------
Q9WZW5_THEMA          ------------------------------------------------------------
B8JH53_ANAD2          KTKLPVAGFAFNPEFGDKIDFQFSGAVDAAAVRAAVEAAGVKVRDVREEQGL------TA
Q1D3B7_MYXXD          EA-LGGVRNVYSDLPNGIIRFRAAQPMDSDAVKKAVESAGIGVQEVRDLGEA------QG
E1X0T7_HALMS          ------------------------------------------------------------
Q6MKZ3_BDEBA          ------------------------------------------------------------
A9F8C8_SORC5          CL----------PPENGSVPEDRCPPAVRATEVKFSPGGDKISTRYDTAPDL------EG
D0LJ87_HALO1          EERFADRGLTSLTWSGNRIYVRAQTMITEAEASTFFSEQGKEMKPWDEVQSERFSTLNQA
B3T9T6_9ZZZZ          ------------------------------------------------------------
D2BGI5_DEHMV          ------------------------------------------------------------
A9WGQ9_CHLAA          ------------------------------------------------------------
A9B5U8_HERA2          ------------------------------------------------------------
SECF_ANATU            ------------------------------------------------------------
SECF_THET1            ------------------------------------------------------------
D1C4J4_SPHTD          ------------------------------------------------------------
B4WJX7_SYNS7          ------------------------------------------------------------
SECF_ACAM1            ------------------------------------------------------------
A0A0H3K5W7_SYNP6      ------------------------------------------------------------
B8HQ25_CYAP4          ------------------------------------------------------------
SECF_SYNP2            ------------------------------------------------------------
SECF_SYNY3            ------------------------------------------------------------
D3EPH1_ATETH          ------------------------------------------------------------
Q2JKR7_SYNJB          ------------------------------------------------------------
Q7NDR5_GLOVI          ------------------------------------------------------------
SECF_PROMA            ------------------------------------------------------------
A2CA57_PROM3          ------------------------------------------------------------
Q46L53_PROMT          ------------------------------------------------------------
A5GTK4_SYNR3          ------------------------------------------------------------
Q7V1E6_PROMP          ------------------------------------------------------------
B5Y8Y1_COPPD          ------------------------------------------------------------
D4JXA7_9FIRM          ------------------------------------------------------------
E6UEG8_RUMA7          ------------------------------------------------------------
D4LA66_RUMC1          ------------------------------------------------------------
A0A2N0UMZ5_9FIRM      ------------------------------------------------------------
E1PK78_MAGIU          ------------------------------------------------------------
E6U7Q5_ETHHY          ------------------------------------------------------------
A3DDV8_HUNT2          ------------------------------------------------------------
B8I6M7_RUMCH          ------------------------------------------------------------
E0RMP8_PAEP6          ------------------------------------------------------------
C6D7X9_PAESJ          ------------------------------------------------------------
C0ZAP7_BREBN          ------------------------------------------------------------
SECF_ALIAD            ------------------------------------------------------------
Q5WHQ4_BACSK          ------------------------------------------------------------
D6XWY7_BACIE          ------------------------------------------------------------
B1YJQ6_EXIS2          ------------------------------------------------------------
B7R9G0_9THEO          ------------------------------------------------------------
D9TNU6_THETC          ------------------------------------------------------------
C6PXQ6_9CLOT          ------------------------------------------------------------
Q892A5_CLOTE          ------------------------------------------------------------
A6LTN3_CLOB8          ------------------------------------------------------------
Q97GT8_CLOAB          ------------------------------------------------------------
D9SMV1_CLOC7          ------------------------------------------------------------
A6TQN5_ALKMQ          ------------------------------------------------------------
E3GFZ4_9FIRM          ------------------------------------------------------------
D9TIR8_CALOO          ------------------------------------------------------------
D9RXQ1_THEOJ          ------------------------------------------------------------
D9QVJ2_ACEAZ          ------------------------------------------------------------
E4RIJ9_HALHG          ------------------------------------------------------------
B2A264_NATTJ          ------------------------------------------------------------
A0A1H8CTT8_9FIRM      ------------------------------------------------------------
D1BLM5_VEIPT          ------------------------------------------------------------
SECF_ACIFV            ------------------------------------------------------------
C8W4E2_DESAS          ------------------------------------------------------------
A5D3H0_PELTS          ------------------------------------------------------------
A4J545_DESRM          ------------------------------------------------------------
B1I4K4_DESAP          ------------------------------------------------------------
C9R7V2_AMMDK          ------------------------------------------------------------
B0TF82_HELMI          ------------------------------------------------------------
D5XEJ7_THEPJ          ------------------------------------------------------------
Q2RHU7_MOOTA          ------------------------------------------------------------
D7CLE8_SYNLT          ------------------------------------------------------------
Q0AX23_SYNWW          ------------------------------------------------------------
SECF_SEBTE            ------------------------------------------------------------
E3CUY4_9BACT          ------------------------------------------------------------
D5EDU6_AMICL          ------------------------------------------------------------
D4M8L9_9BACT          ------------------------------------------------------------
E6SLR1_THEM7          ------------------------------------------------------------
B5H469_STRC2          ------------------------------------------------------------
SECF_GEMAT            ------------------------------------------------------------
Q67LL9_SYMTH          ------------------------------------------------------------
C4RGU1_MICS3          ------------------------------------------------------------
D2S9H9_GEOOG          ------------------------------------------------------------
D3PYP6_STANL          ------------------------------------------------------------
SECF_MYCLE            ------------------------------------------------------------
B1MCI7_MYCA9          ------------------------------------------------------------
Q5YTF3_NOCFA          ------------------------------------------------------------
D0LCM9_GORB4          ------------------------------------------------------------
D6Z7I7_SEGRD          ------------------------------------------------------------
D5UNI8_TSUPD          ------------------------------------------------------------
C3PGQ3_CORA7          ------------------------------------------------------------
Q79VF7_CORGL          ------------------------------------------------------------
D9QAR8_CORP2          ------------------------------------------------------------
C4LIX4_CORK4          ------------------------------------------------------------
Q4JVE2_CORJK          ------------------------------------------------------------
B1VDK1_CORU7          ------------------------------------------------------------
C6WCM8_ACTMD          ------------------------------------------------------------
C7MR00_SACVD          ------------------------------------------------------------
C8XE15_NAKMY          ------------------------------------------------------------
A0LUK2_ACIC1          ------------------------------------------------------------
D7BWW9_STRBB          ------------------------------------------------------------
Q0RNU2_FRAAA          ------------------------------------------------------------
D1AEV5_THECD          ------------------------------------------------------------
C7QJQ2_CATAD          ------------------------------------------------------------
D7BNQ3_ARCHD          ------------------------------------------------------------
D6ZHF3_MOBCV          ------------------------------------------------------------
A0JXA8_ARTS2          ------------------------------------------------------------
C5CCH8_MICLC          ------------------------------------------------------------
D2NT09_ROTMD          ------------------------------------------------------------
B0REC3_CLAMS          ------------------------------------------------------------
Q6AFB1_LEIXX          ------------------------------------------------------------
A6WCH5_KINRD          ------------------------------------------------------------
D1BGW3_SANKS          ------------------------------------------------------------
D1BSK2_XYLCX          ------------------------------------------------------------
C7MCC3_BRAFD          ------------------------------------------------------------
E6SB76_INTC7          ------------------------------------------------------------
C7NI43_KYTSD          ------------------------------------------------------------
Q83MZ6_TROWT          ------------------------------------------------------------
D4HDX0_CUTAS          ------------------------------------------------------------
D7GDS8_PROFC          ------------------------------------------------------------
D2PVF2_KRIFD          ------------------------------------------------------------
A1SJB0_NOCSJ          ------------------------------------------------------------
C7LYS7_ACIFD          ------------------------------------------------------------
Q1AWC9_RUBXD          ------------------------------------------------------------
E1QZN4_OLSUV          ------------------------------------------------------------
D8IEE2_BRAP9          ------------------------------------------------------------
                                                                                  

E1R5K6_SEDSS          ----GGN--KDAYEKKIVLDLEKAFG----------------------------------
E0RQA8_SPITD          ----GAENFRETTRTAILSALSAAFG----------------------------------
SECF_BORBU            ----IDYAFKTEVQKTILDKLKETF-----------------------------------
SECF_TREPA            ---PDLVTPQGAVESVVYAALVRAYG----------------------------------
Q73PW5_TREDE          -----------ELRSIINTALNAAYG----------------------------------
B0SPU5_LEPBP          ---EEKRETSTSAIDRFVQLLRFEFS----------------------------------
Q72PD4_LEPIC          ---KPTDKVELSGIDALISILIADFR----------------------------------
SECF_DICTD            ---VWIRTKFLEENELKRLTSEVEKV----------------------------------
B0VHR6_CLOAI          ---TETRTKLLEIIQQNFPEYVQGRD----------------------------------
A1BCH7_CHLPD          -----------LISNSLNDRLKG-------------------------------------
SECF_RHOM4            -----------RIVETIRQRFPE-------------------------------------
Q9WXE9_PRERU          ---FNSLKKAGLVSQESADKFKNPDV----------------------------------
D5MHP4_9BACT          --------SRVGMAQRVQDIFVKALP----------------------------------
D8PI88_9BACT          --------IEEKVAERVMAVFSKEFP----------------------------------
B6ANM4_9BACT          --------DGSPVSSALLKDLRSGFP----------------------------------
B5ECA5_GEOBB          ---------GADVSETITAVFKKEFP----------------------------------
B3E2R7_GEOLS          --------VVGKAAEVVPAALVKAYP----------------------------------
SECF_THEYD            ---------QEGIQDTIEKALKENLT----------------------------------
SECF_KORVE            -VLSSVDELQGHVPADVVNALKTDYF----------------------------------
E8X5J9_GRATM          --------------SAVENALKANYS----------------------------------
Q029K3_SOLUE          ITDFNQLASVPGVNTAIINTLKQESY----------------------------------
SECF_ELUMP            ------------VRSDVETSLTAAKL----------------------------------
SECF_UNCTG            ------------FETLIKSSIQLRFP----------------------------------
D0RNY4_9PROT          KSGKSD------FIPNVKTQLEKSLT----------------------------------
B6BPL7_9PROT          KDNKKN------IIEEIKNNLDKSFG----------------------------------
B4WED0_9CAUL          GRDQTQ------VVNQVETAISQTVG----------------------------------
D5VIW1_CAUST          GQAPSA------ASANVERELVKRFP----------------------------------
Q0BS57_GRABC          EAATQQ------AANTVRESLAKALP----------------------------------
C6XJ03_HIRBI          EAAVQA------TASGILSALKDKFG----------------------------------
Q0ANE7_MARMM          EAAQNT------ARQALEAALTTTFP----------------------------------
Q0C0W7_HYPNA          DRASAA------SNTFVVNTLKQEFGL---------------------------------
E2CQN2_9RHOB          QPGGEL------AQQAVVGKIRTLFAE---------------------------------
A7HXL1_PARL1          RDGGEE------ASQEVVNKIRGQLG----------------------------------
D8JWH2_HYPDA          QPGGEA------EQQAALKKVVDATS----------------------------------
E3I015_RHOVT          QEGGPE------AQKVAADKVLAALP----------------------------------
B0UI93_METS4          QAGGET------GQTLVMQKAHEAFD----------------------------------
B2II62_BEII9          QPGGDA------AQEAAVNRVRQTIG----------------------------------
E6VHR2_RHOPX          QPGGDQ------AQQDAVQKVRAALG----------------------------------
A7IND7_XANP2          FGTTDE------AQQAIITKVRDVLG----------------------------------
D5BQT4_PUNMI          QEGDEK------AQIAAIKAVTDMLG----------------------------------
Q2W4A8_MAGSA          QEGDEK------TQMAALSKVKASLG----------------------------------
B6ISI3_RHOCS          QEGGDA------AQNEAVQKVRTALG----------------------------------
Q2NBX9_ERYLH          AEGDKE------FADRLTREITAALRDDH-------------------------------
Q1GSE6_SPHAL          -EGDKA------AAERAGQRLVAGIADAF-------------------------------
D4YYJ1_SPHJU          EQGGAG------AANAIVEKARKAMTAEF-------------------------------
SECF_RHOCB            QEDGQGAEGQGAQGQELVNKVETALTAVD-------------------------------
SECF_KETVY            ANETE-------VSNALIGQVEAALQVVD-------------------------------
D0D195_9RHOB          QDDEE------AVTPETIAAVEAALQQVA-------------------------------
SECF_RICPR            SSEEN----LMKNIDIIKTSLRNNFP----------------------------------
A5CDU1_ORITB          KSQDNNN--IGLITNKVKSILETQLN----------------------------------
B9KH24_ANAMF          TAGPGG----SDELQRIKDAINGI------------------------------------
Q2GI09_EHRCR          EKDSDQ----SDTVEKIKGVLNKIL-----------------------------------
Q5GT97_WOLTR          EGNEG-------KIKKIKSVLEEKLG----------------------------------
C6V4R4_NEORI          QDFQDG-------LTKMKSFLKPY------------------------------------
C1D5X5_LARHH          --NIKDRT-SAQLSNDVLAVLKKD------------------------------------
B1XW93_LEPCP          --ELVGRV-FTQLCTAEQGTVSQQQTTTDKGETISRQVCQTA------------------
B6BWI7_9PROT          ---NEDIS-IAELSELVNQELSKL------------------------------------
A5EWX6_DICNV          ---DGRGS-IDNLMQEVVTTIKAR------------------------------------
C0N4C3_9GAMM          --M-------AQLSNEVVSMLQAKNE----------------------------------
A5CVL6_VESOH          ----------AKLSSKIIYLLG--------------------------------------
A1WXP7_HALHL          --Q-------AAISEEVLAKLREAH-----------------------------------
Q31FZ8_HYDCU          --S-------AQISNQVMEALRENHS----------------------------------
D3S9V5_THISK          --P-------ATLSNRVLNALQDGGP----------------------------------
D3RSH8_ALLVD          --S-------AQLSDRVFAALSRAAE----------------------------------
C7RB48_KANKD          --N-------AQVSDVVLATLASDG-----------------------------------
A4GK29_9BACT          -------------AESLKIVLEE-------------------------------------
A4GHV4_9BACT          -------------GSEIVSLLSSSS-----------------------------------
B8KFI4_9GAMM          -------------GTEMLQTLQAS------------------------------------
Q21KV9_SACD2          --PS-KPQEIVSIGEVVLELLESK------------------------------------
Q2SDV4_HAHCH          -------------GTEVVGALSAN------------------------------------
E4PKE9_MARAH          -------------APEVTRTLKE-------------------------------------
A6VYM8_MARMS          -------------GDEVLATLQNH------------------------------------
E1V6F3_HALED          -------------GNQVVDLLRQ-------------------------------------
Q0VS96_ALCBS          -----------KVGQNVFNVLKE-------------------------------------
B3PDJ9_CELJU          --QKLRLSFAAKGNGAVLEGVERPEREYESFADVLVVSNASLDSVRQAKPLGDSGDYGRV
Q8GEL5_PSEPU          ---------DPQLGSKVAEALQKAG--------------------------GDN------
D0SG96_ACIJO          ---------AEDLTKTITQAVQLPG-----------------------------------
Q1QBR5_PSYCK          ---------IDGLNNSLSEALALPN-----------------------------------
Q83CH4_COXBU          -------------EELKEKLMSAM------------------------------------
Q5ZU08_LEGPH          -------------SMLVDQVMEVL------------------------------------
A0A0B3WJC7_FRATU      --KS-----LEDAQQYLKQQVENS------------------------------------
B8L1U9_9GAMM          --TGDAAAEDKATAAAVVKALST-------------------------------------
D0KW98_HALNC          --------NQNQLADQVLSVLKK-------------------------------------
B7J4R6_ACIF2          ---------SSAVGNTILQVFRKDQV----------------------------------
SECF_ECOLI            --------GGQVLGSQVLKVINES------------------------------------
Q8D162_YERPE          --------AGQELGNKIISVINES------------------------------------
Q1LSN7_BAUCH          -----------NIERKITSVVNEV------------------------------------
Q7VQA8_BLOFL          --------SDQNIKIKILDVFSKI------------------------------------
E8Q616_BLOVB          --------FSQQIEKEILNILDHG------------------------------------
Q493H0_BLOPB          --------INQHTISKVLYALRQG------------------------------------
A0KJ23_AERHH          --------KVEQQGNEVLAAAKL-------------------------------------
Q0HWQ6_SHESR          --------SSDVQVKSVMAAAQQ-------------------------------------
C4L7L0_TOLAT          --------TQQKITDGVQKGASE-------------------------------------
Q5QVF2_IDILO          --------KAEQLGTTILESLRTE------------------------------------
Q5E3D5_ALIF1          --------KGEELGNQIISAIKEG------------------------------------
SECF_HAEIN            --------NDSTIGEHVKSMLQN-------------------------------------
D4ZB75_SHEVD          --Q---------HAMDIEQVLQPL------------------------------------
C3LVV7_VIBCM          -------------PVDIATELHHI------------------------------------
E1SV06_FERBD          ------------SDVTALSVLQQI------------------------------------
A1S8J4_SHEAM          -------------LADFNQSLLQL------------------------------------
B7VU09_VIBTL          --------------PNLVDALSSV------------------------------------
B7VQK9_VIBTL          --------------DALNQALLPI------------------------------------
Q15N35_PSEA6          --------------DWLNNFAAQS------------------------------------
Q3IL51_PSEHT          --S---------SNDWQSAVTQST------------------------------------
A0KLF0_AERHH          -------------EELAVMLGQQL------------------------------------
Q2RTI2_RHORT          --A---------MLQALEGVKTAL------------------------------------
C5ZWZ3_9HELI          --------SVN--QDIGEEVTNLLKD----------------------------------
C3XE90_9HELI          --------LKA--NEIDTTLHTLLES----------------------------------
E7A9U2_HELFC          --------QQNTKQDLGVQISQLLHP----------------------------------
A8ERU7_ARCB4          --------DLT--HDISDEMNKILVP----------------------------------
D1B3G6_SULD5          --------SVG--QDIGDHIRTLLKD----------------------------------
A6Q513_NITSB          --------NLK--KDIGDEARAALKG----------------------------------
E4U019_SULKY          --------GLS--KDIGDVTREILKG----------------------------------
A7ZE41_CAMC1          --------NLT--GDIGTEIKQILKD----------------------------------
E1YHR4_9DELT          --------ADKEFTDKLEQALKSVTG----------------------------------
A8ZW13_DESOH          ------GISGDDFEDKVKTALAGATG----------------------------------
B8F9E2_DESAL          --------KGSDIAEQIEAVLEQTLG----------------------------------
E1QIL9_DESB2          --------DMTGLGDKINQTLAQAYG----------------------------------
C7LN35_DESBD          ------EQSANEVREAVESGLESAFP----------------------------------
C4XR64_DESMR          ------DVNQEAVRTSIEAALAKNLP----------------------------------
C8X141_DESRD          ------DISSSEVRQAVQEALSAEM-----------------------------------
B8J2Q5_DESDA          ------NADATQLRTSVVDALAATFP----------------------------------
A0A0H3AA07_DESVV      ------GSSADSIRQTVSTALQQNLK----------------------------------
Q1MSC2_LAWIP          ------EFNSMTIKSDISTILHTYSP----------------------------------
Q3A3C5_PELCD          -------SELEGLADEIRLHLEKTYG----------------------------------
Q2LVH3_SYNAS          -------MDLKGLSGQIENALQTTYG----------------------------------
SECF_CALNY            ------DIPLEELSKTIRAKLAEIDP----------------------------------
D4H482_DENA2          ------ERDLNEVANTIKESMGNTFP----------------------------------
SECF_MAGMM            ------NAAQQAIVSGVLDALKPIAG----------------------------------
SECF_DESIS            ------SAAAMELISLIRETLSAQYG----------------------------------
E8T6K2_THEA1          ---------TNKTVETIRRKLKEHFK----------------------------------
SECF_AQUAE            -------------VEKLEDVLKKFG-----------------------------------
D3SMD0_THEAH          -------------RDKVLRALKTLG-----------------------------------
B4U6P7_HYDS0          -------------PSLVEKALNSIG-----------------------------------
C0QRM5_PERMH          -------------AEIYAKVKKALDEKF--------------------------------
SECF_PETMO            ------SFPTLEEKQMFINSLEESFS--D-------------------------------
C5CF37_KOSOT          ------SENEQGLKEDIIKALTSKGV--K-------------------------------
A7HMQ5_FERNB          ----QLRVYTADEKAEISKKIENLLN----------------------------------
A6LP85_THEM4          ----ELRVYSGEEKEQVSNKIVELFKEKG-------------------------------
Q9WZW5_THEMA          ------KTYEPDEKQKIQEEMEKLLS----------------------------------
B8JH53_ANAD2          GTR-SYAVITQGIQENVQAGLKAQLGDSQ-------------------------------
Q1D3B7_MYXXD          GTGYDYQVVASGMADRVFAALNAGLEKPD-------------------------------
E1X0T7_HALMS          -----DETNLNQITEKVSETLLASYASKG-------------------------------
Q6MKZ3_BDEBA          -TNEILNADLGKVRGIIAEKFVASN-----------------------------------
A9F8C8_SORC5          IKKQIEGIEGVELRAGANNPLIVSERDHKVELHLKSKGDQLMDGLREHLG----------
D0LJ87_HALO1          IGVYEQQFAVWGVERQFETALEASLQERN-------------------------------
B3T9T6_9ZZZZ          --------EGNVVNPGGRQEVEEALGELS-------------------------------
D2BGI5_DEHMV          --------------VSLETSLEETFGNLT-------------------------------
A9WGQ9_CHLAA          ----------NAEIDAVTKALTDAFGTVS-------------------------------
A9B5U8_HERA2          ----------SAERKAVETGLTSKFGADT-------------------------------
SECF_ANATU            ----------DDVRAKVVQEMNSRFNDTV-------------------------------
SECF_THET1            ----------SPEKAKLEQILKSRFGNYE-------------------------------
D1C4J4_SPHTD          ----------SEAKNQLLTALQDEFGQVT-------------------------------
B4WJX7_SYNS7          --------------DRLQSALSDTIGTID-------------------------------
SECF_ACAM1            --------------TKLTEALTAKLGQLD-------------------------------
A0A0H3K5W7_SYNP6      --------------TQLQNKLSEQFGPFD-------------------------------
B8HQ25_CYAP4          --------------ARLQNRLSQVLGKFN-------------------------------
SECF_SYNP2            --------------SRLLDALESEVGALD-------------------------------
SECF_SYNY3            --------------EAVQKALNEGIGKFD-------------------------------
D3EPH1_ATETH          --------------TELQKELNNKVGKFD-------------------------------
Q2JKR7_SYNJB          --------------LAVEATLRQEVAPF--------------------------------
Q7NDR5_GLOVI          --------------SKLQDALKADLGNF--------------------------------
SECF_PROMA            --------------KEVIESIEFVAGPLE-------------------------------
A2CA57_PROM3          --------------QAVIKAMDPVAGPFQ-------------------------------
Q46L53_PROMT          --------------ESVVAEVNKSFGPFN-------------------------------
A5GTK4_SYNR3          --------------GAFVDALEQVAGPLI-------------------------------
Q7V1E6_PROMP          --------------NDLISNVDKILGPLD-------------------------------
B5Y8Y1_COPPD          --------------EAALPTVRESLQASA-------------------------------
D4JXA7_9FIRM          --------LTADKQTALSDKLQQTFKDNS-------------------------------
E6UEG8_RUMA7          --------INEVKQNELQSALEEKFADNE-------------------------------
D4LA66_RUMC1          --------FTPEVQGQLTTSIQGKFPDNQ-------------------------------
A0A2N0UMZ5_9FIRM      --------IKTDIQKNLESDLQKKYPDNN-------------------------------
E1PK78_MAGIU          --------LKTEEQMAMTEALQKAFPSNN-------------------------------
E6U7Q5_ETHHY          --------LTNTQQASLYNALNKQFSSNS-------------------------------
A3DDV8_HUNT2          --------LTDDERNKVLDALKAEFNVKE-------------------------------
B8I6M7_RUMCH          --------LSNSELTKVEEAVVKEFKLTA-------------------------------
E0RMP8_PAEP6          --------LTDQQVNDFKISFNKQL---D-------------------------------
C6D7X9_PAESJ          --------LEQSKVQVIEDAFKAKY---G-------------------------------
C0ZAP7_BREBN          --------ISSDTLMKMEMALKAKY---G-------------------------------
SECF_ALIAD            --------LTAKQISEIQAAEHRFFP--D-------------------------------
Q5WHQ4_BACSK          --------LSKDEITAIQTYFQDKY-----------------------------------
D6XWY7_BACIE          --------LSQEETLSIQAHFMDVY-----------------------------------
B1YJQ6_EXIS2          --------FDQQQISKMKQAIEAKY-----------------------------------
B7R9G0_9THEO          --------ISDQTRIAIIKEIEKKYNLT--------------------------------
D9TNU6_THETC          --------LDDKTRTAIINALKSKYKLS--------------------------------
C6PXQ6_9CLOT          --------LNNENIAEIVKAVKAKYK----------------------------------
Q892A5_CLOTE          --------LKDEQIKPMFNEIKNKYKLK--------------------------------
A6LTN3_CLOB8          --------LDSDKLGLIVSDLESKYKLD--------------------------------
Q97GT8_CLOAB          --------MTDAIGNKIFKDMQKKYNLK--------------------------------
D9SMV1_CLOC7          --------LSEENLAKIIEEVKKDFP----------------------------------
A6TQN5_ALKMQ          --------YNNQERMEIFNQFKAEYDLP--------------------------------
E3GFZ4_9FIRM          --------LDTDQRKELFNQFKDKYSLQ--------------------------------
D9TIR8_CALOO          --------LSKETRDKLFEEIAKRYNLK--------------------------------
D9RXQ1_THEOJ          --------LTADQQKKITEAIRQKWP----------------------------------
D9QVJ2_ACEAZ          --------LRQDEITEVQSAIKDKYS----------------------------------
E4RIJ9_HALHG          --------LDSDQILAVEQAINDEFE----------------------------------
B2A264_NATTJ          --------LNEEARNEIIDSFRDSWP----------------------------------
A0A1H8CTT8_9FIRM      --------LEEQERKEVMAGLTDKLGAY--------------------------------
D1BLM5_VEIPT          --------LESSESAAVVDSLTKSIGNN--------------------------------
SECF_ACIFV            --------ISDSQRVDVMNDLSNRLGHN--------------------------------
C8W4E2_DESAS          --------LSLAESGKVVSGLKSKLGEL--------------------------------
A5D3H0_PELTS          --------LTEEESTKVVQALNEKLGGV--------------------------------
A4J545_DESRM          --------LTQEESDKAFNAISEKLGGA--------------------------------
B1I4K4_DESAP          --------ITETQNQAMIESLGKEVGTL--------------------------------
C9R7V2_AMMDK          --------LEEKQSQEVVKALEQKIGPL--------------------------------
B0TF82_HELMI          --------LEQSQRNELVGAMKTQLGDL--------------------------------
D5XEJ7_THEPJ          --------LTDKEYKQVLDAFKNDVAPYQ-------------------------------
Q2RHU7_MOOTA          --------LNEEQTNQVISTLQSKLGQL--------------------------------
D7CLE8_SYNLT          --------LTQEDRDKLVTQLEKRVGKV--------------------------------
Q0AX23_SYNWW          --------LNQEQTEQVNKAFAAKFKNV--------------------------------
SECF_SEBTE            --------ADEKEKSAILEELKAEQGNY--------------------------------
E3CUY4_9BACT          -----------ENRKQVLGALGQRFG----------------------------------
D5EDU6_AMICL          -----------ESRKEVIQTLKDKYP----------------------------------
D4M8L9_9BACT          -----------ESREQVISVLQKAFP----------------------------------
E6SLR1_THEM7          -----------ATQQKVLEALGKDVA----------------------------------
B5H469_STRC2          -----------RGQETIRAALGTVAG----------------------------------
SECF_GEMAT            -----------GISRQITAALDAKFG----------------------------------
Q67LL9_SYMTH          -----------DKDR----LYGSLLH----------------------------------
C4RGU1_MICS3          -------------ANAAKTEMARAFGIQ--------------------------------
D2S9H9_GEOOG          -------------ERAVVDAVAAAAGVT--------------------------------
D3PYP6_STANL          -------------QQEIQEAMSAALGG---------------------------------
SECF_MYCLE            -------------TSKLRNALFDAFGPKGADAKP--------------------------
B1MCI7_MYCA9          -------------SSKLHKALFDRFAPKGPDGKP--------------------------
Q5YTF3_NOCFA          -------------ADQLASALFTEFQPLGNDGQP--------------------------
D0LCM9_GORB4          -------------AEAVTRALVGEFGPG-----L--------------------------
D6Z7I7_SEGRD          -------------TAKVSDALFNAFHPKGRDGKP--------------------------
D5UNI8_TSUPD          -------------ITKARAALFEQFQPPGRDGKP--------------------------
C3PGQ3_CORA7          -------------VNQARQAIFETYQVKDDNGKP--------------------------
Q79VF7_CORGL          -------------VEKARLAIYEEYQPLNSEGQP--------------------------
D9QAR8_CORP2          -------------IGSARQALFEAYKPADASGKQ--------------------------
C4LIX4_CORK4          -------------ISEAREALFSKYHPKDASGKE--------------------------
Q4JVE2_CORJK          -------------IREARSALFNEYHPKNNVGEV--------------------------
B1VDK1_CORU7          -------------IRQARAALFEEFKPVNAQGQA--------------------------
C6WCM8_ACTMD          -------------IDGLKNTLNDDLKPEGG------------------------------
C7MR00_SACVD          -------------VAQVKQALFTELQPLGTDGQP--------------------------
C8XE15_NAKMY          -------------VVAAKAAINQAYSPPG-------------------------------
A0LUK2_ACIC1          -------------SDAVIKAITTKLGVPADE-----------------------------
D7BWW9_STRBB          -------------ALPVQEKLAKELDVKTSE-----------------------------
Q0RNU2_FRAAA          -------------TDKLTDALAKRFSVTDPDRD---------------------------
D1AEV5_THECD          -------------AAKVQQALAEEFGLPADR-----------------------------
C7QJQ2_CATAD          -------------LQKVRQAIATDAGKTKDPNA---------------------------
D7BNQ3_ARCHD          -------------TQEVRDALASAYKV-DPSK----------------------------
D6ZHF3_MOBCV          -------------ELKIQQELAKAYHV-DIKK----------------------------
A0JXA8_ARTS2          -------------TLRIKEGLTTAYGV-TDNE----------------------------
C5CCH8_MICLC          -------------TRAVAANLQEAYGV-GPDQ----------------------------
D2NT09_ROTMD          -------------TLQVKAALQEGYGV-SEND----------------------------
B0REC3_CLAMS          -------------STAVRQALATAYGV-ETSS----------------------------
Q6AFB1_LEIXX          -------------TKAVADALAKAYSV-DDGD----------------------------
A6WCH5_KINRD          -------------LDEIRSGLVERLGV-PDTA----------------------------
D1BGW3_SANKS          -------------VVAVRDALAAAYGV-SADE----------------------------
D1BSK2_XYLCX          -------------VADVTALLVEAYGIDAATD----------------------------
C7MCC3_BRAFD          -------------TAALASDLAGAYDV-SSDA----------------------------
E6SB76_INTC7          --------------DAARTTLAKTFDV-GRET----------------------------
C7NI43_KYTSD          -------------MDAARGALAEEFDV-PAQD----------------------------
Q83MZ6_TROWT          -------------SNSVRDALADTYGV-SHDA----------------------------
D4HDX0_CUTAS          -------------TTKVQEAIAKATGT-KMSS----------------------------
D7GDS8_PROFC          -------------VTQMRDALASTVNT-TPDK----------------------------
D2PVF2_KRIFD          -------------ITKVRAAIAQEAGV-QPNQ----------------------------
A1SJB0_NOCSJ          -------------NEQIKNTIADTTGT-DPTQ----------------------------
C7LYS7_ACIFD          -------------AHALENEVAARLAAAAHQPS---------------------------
Q1AWC9_RUBXD          -------------TNQVQRAVQEALGA---------------------------------
E1QZN4_OLSUV          -------------ANQHAAAAASSLGLGGES-----------------------------
D8IEE2_BRAP9          ------------ESDRAMQVLYDKYTK---------------------------------
                                                                                  

E1R5K6_SEDSS          ---------------------------------DGTAVVKQSDYVGPRFSQDLASQSVSL
E0RQA8_SPITD          ---------------------------------EGNVEERSSQYIGPRFSESIASQSFLL
SECF_BORBU            ---------------------------------DANIEVLDSYFIDSSFSSTLRIRSIFL
SECF_TREPA            ---------------------------------ADHVVRLAMDFVGSRFSHLLVRQALLL
Q73PW5_TREDE          ---------------------------------IENIAVISTDFVGSRFSSSLAQQAILL
B0SPU5_LEPBP          ---------------------------------LPKEKVLSADQVGAVVGGELTEVGITL
Q72PD4_LEPIC          ---------------------------------IDKSNILSANQVGAIVGGELSSTGTTL
SECF_DICTD            ---------------------------------IVKYEGREITTIEPTISRELREKAILA
B0VHR6_CLOAI          ---------------------------------LNKEVIEEIYEVGPKVGSELRSQAFWA
A1BCH7_CHLPD          ----------------------------------NPHEIVRIDAVGPSIASDLKWSALKA
SECF_RHOM4            ----------------------------------TQPEVVQTNIVGPRFAEDLKRGAIYS
Q9WXE9_PRERU          ---------------------------------REGGSIISSAKVGPSVAKDITRGAYIS
D5MHP4_9BACT          ---------------------------------DNPFVVEGTNEVGPAIGKDLQKAALWA
D8PI88_9BACT          ---------------------------------ANKFVVDSSMEIGPTIGKKLQEDAMIA
B6ANM4_9BACT          ---------------------------------GNPMTILSATEIGPTIGNELAGKAFLA
B5ECA5_GEOBB          ---------------------------------GNAFVVESSTDVGPSIGNKLKTDTLKA
B3E2R7_GEOLS          ---------------------------------GLQVVVESTTEIGPSIGDKLRKDTIVA
SECF_THEYD            ---------------------------------AKEPIIESVTEIGPKIGERTKRDALFA
SECF_KORVE            ---------------------------------TSGFGVRNVEIVGPQVGKQLSNQALLA
E8X5J9_GRATM          ---------------------------------DSGFQVLQVDIVGPTAGKQLQKQAVYA
Q029K3_SOLUE          ---------------------------------LAPYKVIQTQMVGPKVGVELRTKAVLA
SECF_ELUMP            ---------------------------------K--FTVVATDFVGPTVGKDLGERALWA
SECF_UNCTG            ---------------------------------DNPVKIEGIEYIGPTVGEYLSKQAVYA
D0RNY4_9PROT          ----------------------------------ETINFRRVEMVGPKISKELTKSGIYA
B6BPL7_9PROT          ----------------------------------NNFNFRRVENVGPKVSSELLKSGVIA
B4WED0_9CAUL          -----------------------------------EVQYSGVSVVGSKVSGELFTSGLLA
D5VIW1_CAUST          -----------------------------------DLKVTSRSEVGAKVSGELLMSGFKA
Q0BS57_GRABC          -----------------------------------GTKVMRVDVVGASVSRELFRDGMLA
C6XJ03_HIRBI          -----------------------------------DIEERRKEAVGPKVSGELLQDGIMA
Q0ANE7_MARMM          -----------------------------------DIQMRGTTVIGGAVSGELIVTGFTA
Q0C0W7_HYPNA          ----------------------------------TDQDILRNDSVGPKVSGELFREGLIA
E2CQN2_9RHOB          ----------------------------------DGYDFRRVEVVGPRVSGELAQAGAIA
A7HXL1_PARL1          ----------------------------------DTVEYRRVEVVGPQVSGELVQDGILA
D8JWH2_HYPDA          ----------------------------------ETYVERRVEVVGPAVSSELRMTSFIA
E3I015_RHOVT          ----------------------------------QGTKELRREQVGSTVSKELINSAIWA
B0UI93_METS4          ----------------------------------RDYAFDRVETVGPRVSGELVQSGTIG
B2II62_BEII9          ----------------------------------ERYDIRRIEVVGPRVSGELVQSGTLG
E6VHR2_RHOPX          ----------------------------------ESVEYRRVEVVGPRVSSELLAFGMLG
A7IND7_XANP2          ----------------------------------AEYSVRRVETVGPSVSGELVRQSILA
D5BQT4_PUNMI          ----------------------------------SDYDIRRTEFVGPTVGAELAEKGILA
Q2W4A8_MAGSA          ----------------------------------EGFTYRRVEIVGPKVGGELVRDGVLA
B6ISI3_RHOCS          ----------------------------------DSYEYRRVELVGPRVGGELMRQGAIA
Q2NBX9_ERYLH          ----------------------------------PQVRIDGVDSVSGKVSGEFRETALYA
Q1GSE6_SPHAL          ----------------------------------PTAKTGSVETVSGKVSEELLRTGALS
D4YYJ1_SPHJU          ----------------------------------PGVTFSRYDTVSGKVSGELIQNGVLA
SECF_RHOCB            ----------------------------------PALKITSFESVGPKVSGELVWTAVWS
SECF_KETVY            ----------------------------------PQVVFTAVETVGPKVSGELIQTAVLA
D0D195_9RHOB          ----------------------------------PDIRFVSVESVGPKVSGELIQTAFLA
SECF_RICPR            ----------------------------------YNFEYRKVDFVGPQVGRQLIEAGAMA
A5CDU1_ORITB          ----------------------------------CKVTLRKTSFIGPQVSRYLVKSSIKA
B9KH24_ANAMF          ----------------------------------GAITYKRLDYVGAQVGVAQVTRGVIA
Q2GI09_EHRCR          ----------------------------------GEVTYLKIDYVGPQVGYKQIFEGLCA
Q5GT97_WOLTR          ----------------------------------SSISYRKIDYIGPRISSTQILEGILS
C6V4R4_NEORI          -----------------------------------NFRYDKIDCVGPQISKSLIYRSGLA
C1D5X5_LARHH          ---------------------------------GHQVELRKVEFVGPQVGDELVTNGLTA
B1XW93_LEPCP          -------------------------------AGAEPLKLSRSEFVGPQVGKELAEDGAKA
B6BWI7_9PROT          ---------------------------------NNPFEIKRVESVGGQVGEELFENGALA
A5EWX6_DICNV          ---------------------------------YPDVKINGQSKIGGQYKSELIEKGITA
C0N4C3_9GAMM          ----------------------------------TEIDVRRVEFVGPQVGEELTEQGGLA
A5CVL6_VESOH          ----------------------------------DDVDIRRVEFVGPKVGEELTNDGGLA
A1WXP7_HALHL          ----------------------------------DGVDLRRVEFVGPQIGRELTEQGLLA
Q31FZ8_HYDCU          ----------------------------------EDFELRRVEFVGPQVGDELTEDGALA
D3S9V5_THISK          ----------------------------------DDPDLRRVEFVGPAVGEELREQGGLA
D3RSH8_ALLVD          ----------------------------------GQVELRRVEFVGPQVGEELREQGGLA
C7RB48_KANKD          ----------------------------------SKVTKRDQSFVGPVVGEELKEQGGLA
A4GK29_9BACT          ---------------------------------NYEFDLRKEEFIGPQIGEELRDQGGLG
A4GHV4_9BACT          --------------------------------LDQEIDLRRIEYVGPQIGSELRDDGGTA
B8KFI4_9GAMM          --------------------------------SGVGVELRRIEFVGPQVGDELREQGGLA
Q21KV9_SACD2          --------------------------------SSEEIELLRTDVVGAQVGEELANSGGMG
Q2SDV4_HAHCH          ---------------------------------GEQVTLSRSEFVGSQVGEELREQGGLG
E4PKE9_MARAH          --------------------------------GGADLELVSSEFVGSQVGEELKEDSGLG
A6VYM8_MARMS          --------------------------------GATDVSLQRSEFVGAQVGEELREQGGLG
E1V6F3_HALED          --------------------------------GGNNVDLVRAEFVGAQVGDQLRDQSGMG
Q0VS96_ALCBS          --------------------------------HNADLELLKVEFVGPQVGDELRDESGTA
B3PDJ9_CELJU          EYSQRDGKVLVIVEKSIESAYLNQLIGDMESATGADIQLRSSEFVGPQIGGELRDQGGLG
Q8GEL5_PSEPU          -----------------------------------PATLKRVEFVGPQVGEELRDQGGMG
D0SG96_ACIJO          ----------------------------------NSASVNKVDVVGGQVGNELYIRSAGA
Q1QBR5_PSYCK          ----------------------------------NDVEISNVNIIGSQVGNEIYLSSVMS
Q83CH4_COXBU          ----------------------------------PGGHIGSLDYIGPQVGKQLMTNGILA
Q5ZU08_LEGPH          ----------------------------------PGAVKQRVDFVGPQVGQELATKGALA
A0A0B3WJC7_FRATU      ----------------------------------LDAQVQSVNYIGPQVGKELASNGVLA
B8L1U9_9GAMM          --------------------------------ADNQATVLRNEFVGPQIGKDLAMNGLYA
D0KW98_HALNC          --------------------------------QDDSATMRRVEFVGPAVGKELFNSGGLA
B7J4R6_ACIF2          --------------------------------EYPDVQLRRTEYVGPEVGKELRNKGIMA
SECF_ECOLI            --------------------------------TNQNAAVKRIEFVGPSVGADLAQTGAMA
Q8D162_YERPE          --------------------------------VDKNASVKRIEFVGPSVGSDLAQAGALA
Q1LSN7_BAUCH          --------------------------------TQQNITVKRVEVVGPSVSNDLLQTGSIA
Q7VQA8_BLOFL          --------------------------------ITHKFYIQQMNWISPNSSENLIKISIIS
E8Q616_BLOVB          --------------------------------INHQFVMQQINWIGPNSSKNLIKTTIIA
Q493H0_BLOPB          --------------------------------IVQNFFVKQVNWIGPSVHSQLINTGIIA
A0KJ23_AERHH          --------------------------------IDPAAVLKRVEFVGPSVGDELATDGALA
Q0HWQ6_SHESR          --------------------------------VDAGVQQKRVEFVGPQVGKELAEQGGLA
C4L7L0_TOLAT          --------------------------------IDSSVNLSRIEYVGPSVGEELANQGFLA
Q5QVF2_IDILO          --------------------------------FDQTVEMRRIEFVGPNVGDEFIEQGGLA
Q5E3D5_ALIF1          --------------------------------TGEQVEMRRIEFVGPNVGDELTEAGGLA
SECF_HAEIN            --------------------------------VDKDIQIRSIEFVGPNVGEELAQGAVYA
D4ZB75_SHEVD          ---------------------------------NSDVEVLNSSIVGPQIGQELAEQGGLA
C3LVV7_VIBCM          ---------------------------------SDQVQIVSNSMVGSQVGQELIDQGGLA
E1SV06_FERBD          ---------------------------------DPDVQLIASSVVGAQVGQELAETGGVA
A1S8J4_SHEAM          ---------------------------------DPTMQVLDRDSVSPQVGQELFEQGGLA
B7VU09_VIBTL          ---------------------------------SDQVKVLNSSVVGPQVGQDMVDQGGLA
B7VQK9_VIBTL          ---------------------------------DSNFHIANSSVIGPQVGLEMVEQGGLA
Q15N35_PSEA6          ---------------------------------GYDISPQDSVYIGSQVGSELIDNGGLA
Q3IL51_PSEHT          ---------------------------------DINATVLSSAYIGSQVGDELFEQGCLA
A0KLF0_AERHH          ---------------------------------NLPVELLRTTIVGPQVGAELFQQGMLA
Q2RTI2_RHORT          ---------------------------------GEGATYRRTNLVGPTVGGEATIAGLLT
C5ZWZ3_9HELI          ---------------------------------TGDFQIRRVDIVGPKVGDELREKGILA
C3XE90_9HELI          ---------------------------------SGEFSIRKLDTVGPKVGDELRKSAILS
E7A9U2_HELFC          ---------------------------------LGKFEIRRLDSVGPRVGDELKEKGVLS
A8ERU7_ARCB4          ---------------------------------TGNFEIRKIDMVGSKVGAELREKGVIS
D1B3G6_SULD5          ---------------------------------TGSFDIRKIDIVGPKIGSELREKGIIS
A6Q513_NITSB          ---------------------------------TGNFEIRRVDMVGPKVGGELREKGLMA
E4U019_SULKY          ---------------------------------TGEFEIRRVDMVGPKVGDELRVKGLTA
A7ZE41_CAMC1          ---------------------------------TGNFEVRRVDIVGPKVGDELRQKGLMA
E1YHR4_9DELT          ---------------------------------QN-AEIRRVEIVGPKVGKDLQEKALLA
A8ZW13_DESOH          ---------------------------------QT-AEITRVEMVGPTVGKSLRGKALMA
B8F9E2_DESAL          ---------------------------------TG-VELGKVDMVGPQVGKDLKEQALMA
E1QIL9_DESB2          ---------------------------------QGEFEVRRVEMVGPKVGHDLREKALLA
C7LN35_DESBD          ---------------------------------GVTHEIQRLEMVGPKVGADLREKALEA
C4XR64_DESMR          ---------------------------------DSGYSLQRLEMVGPKVGADLRGKALEA
C8X141_DESRD          ---------------------------------DTGFEIRRLEMVGPKVGADLRAKALEA
B8J2Q5_DESDA          ---------------------------------GNAAEIVRLEIVGPKVGADLTNKALSA
A0A0H3AA07_DESVV      ---------------------------------DVSFTVQRLEMVGPKVGADLRSKAVEA
Q1MSC2_LAWIP          ---------------------------------SNPVTIQRLEVVGPKVGADLRNSALEA
Q3A3C5_PELCD          ---------------------------------EGTVEIRRVEMVGPQVGKDLRKKGLLA
Q2LVH3_SYNAS          ---------------------------------QKAFEIRRVESVGPKVGSDLTRKALLA
SECF_CALNY            ---------------------------------NNKFIVERVEQVGPQVGSELQYKAMMA
D4H482_DENA2          ---------------------------------DNEFIVERVEQVGPQVGADLKSKATYA
SECF_MAGMM            ---------------------------------EHGVEMRRVEYVGPQVGEELTEKGMLA
SECF_DESIS            ---------------------------------DQ-MDVLRIETVGPRVGGELREQGTYA
E8T6K2_THEA1          ---------------------------------SG-VTILKVEMIGPTVGKELREKGIMA
SECF_AQUAE            -----------------------------------KYELIRKETISGVVSEELQKKAVFA
D3SMD0_THEAH          -----------------------------------DYQLLRMESIGGVISGELRQKALWA
B4U6P7_HYDS0          -----------------------------------SFQLLQREDIGSVVSGELRKKAVWA
C0QRM5_PERMH          ---------------------------------KDKYEIRKMDYIGAVVGEELRKASVYS
SECF_PETMO            ----------------------------------SSLNIEQFNDVSGYAAREIRSYAWYA
C5CF37_KOSOT          ----------------------------------SS-NILSVNRISGFAAQEIKGYAWTA
A7HMQ5_FERNB          ------------------------------------AKVASFNEISGDAANEIKNLTWKA
A6LP85_THEM4          ----------------------------------KPAKVIGFNETSGYASQEIKNLTWKA
Q9WZW5_THEMA          ------------------------------------GKVVSFNEISGTAAEEIRRGTWTA
B8JH53_ANAD2          ------------------------------------PNVRRVEYVGPAAGRELQAQGLKA
Q1D3B7_MYXXD          ------------------------------------FEQRRVDYVGPQVGKQLRNRGIMA
E1X0T7_HALMS          ------------------------------------VEVRKVDIVGPKAGAQLRISGFQA
Q6MKZ3_BDEBA          ------------------------------------PDIRRIDTVGPQVGAELKRNGLLA
A9F8C8_SORC5          -------------------------------ADKVPEQALRVEWIGPKAGAQLRDAAIKS
D0LJ87_HALO1          ----------------------------------LDASLIQSWAVGARAGDELRDDGIKS
B3T9T6_9ZZZZ          -----------------------------------PVDVQSFDSISAVVGAETVRAAIIA
D2BGI5_DEHMV          -----------------------------------E---RGFENVDPLIAKQTTQMALIA
A9WGQ9_CHLAA          -----------------------------------R---ERLESVGPTVSAESTRSAIIA
A9B5U8_HERA2          -----------------------------------RI--ETVQTVGETVRGRSIRNAIVA
SECF_ANATU            -----------------------------------TV--LRFDSVGPTIGKEVAGRATLA
SECF_THET1            -----------------------------------E---LVFTSVGPAVGREIRNRSIVA
D1C4J4_SPHTD          -----------------------------------E---LRLESVGPTLGTEIRNRAIIA
B4WJX7_SYNS7          -----------------------------------P-ALTKNDTVGPVLGKQLLTSGLLS
SECF_ACAM1            -----------------------------------V-EKSQIDTVGPTLGKQLLASGLLA
A0A0H3K5W7_SYNP6      -----------------------------------P-QQTQIDTVGPVLGQQLLSSGLLA
B8HQ25_CYAP4          -----------------------------------P-QSTQIDIVGPTLGQQILVSGLLA
SECF_SYNP2            -----------------------------------P-GTIQIDSVGPTIGRELFVQGMLA
SECF_SYNY3            -----------------------------------P-ETIQIDTVGPTVGKALFRSGVLA
D3EPH1_ATETH          -----------------------------------P-ETIQIDTVGPTIGWELFKSGILA
Q2JKR7_SYNJB          -------------------------------------QRNLVETVGPTVGRLLLRSGIVA
Q7NDR5_GLOVI          -------------------------------------QLERIESVGPTLGQELLFNGLLS
SECF_PROMA            -----------------------------------D-GGQSVESIGPTLGAKLLQTTLIS
A2CA57_PROM3          -----------------------------------S-GGQSVDTIGPSLGGQLLRSSLIS
Q46L53_PROMT          -----------------------------------N-ENTSVEIIGPSLGRQLLKSSLIS
A5GTK4_SYNR3          -----------------------------------A-TDTQINTIGPVLGKQLLTSSVLA
Q7V1E6_PROMP          -----------------------------------Y-DSKNSRIIGPKLGKKLLTNCATS
B5Y8Y1_COPPD          -----------------------------------S-VTDE-NFVGPSVASSLIKNAVLS
D4JXA7_9FIRM          -----------------------------------LTLVNSQD-VNPTSGTEFFLKCLVA
E6UEG8_RUMA7          -----------------------------------LALFESSD-VNASNGMDFFLKCLVA
D4LA66_RUMC1          -----------------------------------IKLLESND-VSPTSGKQFFYKCLVA
A0A2N0UMZ5_9FIRM      -----------------------------------FKCLESNS-VDASMGFSFLLKCLTA
E1PK78_MAGIU          -----------------------------------ITWSEASL-VNPFIGQRTLTNGLLA
E6U7Q5_ETHHY          -----------------------------------LKKYQSND-VSPQTGRQFFLQSIGA
A3DDV8_HUNT2          -----------------------------------NGEMRVRD-VDPSIGAELLTKGLLA
B8I6M7_RUMCH          -----------------------------------KDPVVSEESVEPYIGKEIMNNGLKA
E0RMP8_PAEP6          -----------------------------------PKASFEVNTVDTEMAQELERNAIWA
C6D7X9_PAESJ          -----------------------------------DNVSSEVNVVSPDIAQELGVKAIYA
C0ZAP7_BREBN          -----------------------------------QQVSKQVSSVDPSIAQEMVQKAAIA
SECF_ALIAD            -----------------------------------AKQDIQVNSVDPFVAEQTARKAVYA
Q5WHQ4_BACSK          ------------------------------------GHSPNVSTVSPLVGQELARNAILS
D6XWY7_BACIE          ------------------------------------GNEPTVSTVTPIVGEELARNAVIS
B1YJQ6_EXIS2          ------------------------------------KKEPSISTVSAQVGQEIARNAIYA
B7R9G0_9THEO          -----------------------------------ESDLIMSQQVGPSLGAEIRSGMILA
D9TNU6_THETC          -----------------------------------DKDLVSSQNVSASIGKEMQFGTLLA
C6PXQ6_9CLOT          -----------------------------------DSSVTNQENIGASIGAETRMKAYQA
Q892A5_CLOTE          -----------------------------------DEDLLSQESIGASIGKELRQKAILS
A6LTN3_CLOB8          -----------------------------------DKVLVSQNEIGSSVGRELTQNSIYA
Q97GT8_CLOAB          -----------------------------------SKALVSQEKIGGTIGQELKTKALIA
D9SMV1_CLOC7          -----------------------------------EAKIANSDVIGATIGNELKQKASIA
A6TQN5_ALKMQ          -----------------------------------DNEPSYASQFGPSVGREIQNRAMLA
E3GFZ4_9FIRM          -----------------------------------DSDLVSVDTVTATVGSETARNAVVA
D9TIR8_CALOO          -----------------------------------KEDLISYQNVGATISSELKSQAIWA
D9RXQ1_THEOJ          -----------------------------------QAQLIRAERVDAVIGKELQRQALIA
D9QVJ2_ACEAZ          -----------------------------------SAEMLRTEMVGPAIGSELKSKAYWA
E4RIJ9_HALHG          -----------------------------------NVEMLRTDMVGPTIGQELRINALLA
B2A264_NATTJ          -----------------------------------ESEVLRTDNVGGTIGSELRSEAFWA
A0A1H8CTT8_9FIRM      -------------------------------------QVLREEKVGATMGTELIMNAIYA
D1BLM5_VEIPT          -------------------------------------TVKRIETVGAVIGSEVTEHALLN
SECF_ACIFV            -------------------------------------EVLRVENVGATVGGDLVKSAVGA
C8W4E2_DESAS          -------------------------------------TVMKNDQVGPTIGKELTRNALLA
A5D3H0_PELTS          -------------------------------------TLQRSERVGPVVGRELIMKALGA
A4J545_DESRM          -------------------------------------TVLRNELVGPVIGKELTRQAILA
B1I4K4_DESAP          -------------------------------------TVLRNEAVGPVIGKELAQRAILA
C9R7V2_AMMDK          -------------------------------------TLLRSEKVGPVIGKELTRKAFLA
B0TF82_HELMI          -------------------------------------TVERDENVGPVVGKELTRNALLA
D5XEJ7_THEPJ          -----------------------------------EGKLSRNE-VKPVIGKELTLNAIWA
Q2RHU7_MOOTA          -------------------------------------DLKRNEKVGGTIGRELTIRGVEA
D7CLE8_SYNLT          -------------------------------------DVPSEESVGPTIGKELTMKAVLS
Q0AX23_SYNWW          -------------------------------------EYLSAESVGATIGNELTRNAVLS
SECF_SEBTE            -------------------------------------ELIKADAVGAVVGNELAKNALWA
E3CUY4_9BACT          -----------------------------------KIQVLRLETVGPVVGEELRQQAFVA
D5EDU6_AMICL          -----------------------------------GMEVLRFEKVGPVVGEKLRREAFLA
D4M8L9_9BACT          -----------------------------------DMKVSGYEKVGPVVGGELRRQAVIG
E6SLR1_THEM7          -----------------------------------PVQLEQFDSISPVIGREIKEKGLLA
B5H469_STRC2          -----------------------------------EVTVERDETIGPSLGSELRRHALIA
SECF_GEMAT            ---------------------------------AGTVTIVRTEAVGPKVGAELRTGAAMA
Q67LL9_SYMTH          ---------------------------------LGAYTVIGEDAVSGTVSSELTNKALLA
C4RGU1_MICS3          ------------------------------------PDQISGNQVSEAWGSQVTSRALLG
D2S9H9_GEOOG          ------------------------------------PSQVSPEAVSPEWGQDITRQALVA
D3PYP6_STANL          -------------------------------------EEVSISNVSESWGASVSTKAYWA
SECF_MYCLE            -----------------------------------SKQAISDAAVSETWGGQITKKVVIA
B1MCI7_MYCA9          -----------------------------------SIDAISDSDVSETWGSQITNKALWA
Q5YTF3_NOCFA          -----------------------------------SRAAISTSDVSETWGDQITRKALIA
D0LCM9_GORB4          -----------------------------------TTEEISISDVSSTWGREITEKMLIA
D6Z7I7_SEGRD          -----------------------------------SKAAVNVSSVSSSWGGQITKRALIA
D5UNI8_TSUPD          -----------------------------------SANTISFSAVSSTWGGQITQRALLG
C3PGQ3_CORA7          -----------------------------------SPDAIGSSTVSESWGSSITQRMVVA
Q79VF7_CORGL          -----------------------------------SPDAIGNSTVSESWGSTITQRMVLA
D9QAR8_CORP2          -----------------------------------TPDAIGDSTVSESWGSTITKRMLIS
C4LIX4_CORK4          -----------------------------------TPDSIGDSTVSNSWGSTITHRMVLA
Q4JVE2_CORJK          -----------------------------------TQDAISDSTVSESWGSSITKKMLIA
B1VDK1_CORU7          -----------------------------------SEDAVNDSTVSESWGSSITKRMLLA
C6WCM8_ACTMD          ------------------------------------LSSVSDSAVSASWGGEITTKALLA
C7MR00_SACVD          -----------------------------------SERAISDSRVSASWGGEISRQALIA
C8XE15_NAKMY          --------------------------------------GVSDSAVSETWGSEISQRALLA
A0LUK2_ACIC1          ---------------------------------------VSTTTVGASWGKQITNKAVES
D7BWW9_STRBB          ---------------------------------------IETQLVGPSWGEEIANKAWQG
Q0RNU2_FRAAA          ---------------------------------------IAVSTVGSSWGSTITSKAIQG
D1AEV5_THECD          ---------------------------------------VSSQIVGSTWGDEITEKAWQA
C7QJQ2_CATAD          ---------------------------------------VTVTLVSGSWGHEITQKAITG
D7BNQ3_ARCHD          ---------------------------------------VTSTFVGPSWGADILSKAVRA
D6ZHF3_MOBCV          ---------------------------------------VSKTSIGPSWGASVSKQALVG
A0JXA8_ARTS2          ---------------------------------------VTSTFVGPTWGADVTKQALLG
C5CCH8_MICLC          ---------------------------------------VTSTFVGPTWGAAVSQQALIG
D2NT09_ROTMD          ---------------------------------------VTSSFVGPTWGADVTRQAFWG
B0REC3_CLAMS          ---------------------------------------VTESFIGPSWGQDITRQALWG
Q6AFB1_LEIXX          ---------------------------------------VSSTFIGPSWGADVTQQSIQG
A6WCH5_KINRD          ---------------------------------------VTSSSIGPSWGQDVTDKALTG
D1BGW3_SANKS          ---------------------------------------VTSSFIGPSWGADVSGKALTG
D1BSK2_XYLCX          ---------------------------------------ISVSTVGPTWGQGVSLRALWG
C7MCC3_BRAFD          ---------------------------------------VSTSYIGPVWSGDVTQKMLRG
E6SB76_INTC7          ---------------------------------------VSSTLIGPSWGAAVSEQALRG
C7NI43_KYTSD          ---------------------------------------VAGSLVGPSWGQEVSQKALMA
Q83MZ6_TROWT          ---------------------------------------VAASYIGPSWGQDVTRQGIQG
D4HDX0_CUTAS          ---------------------------------------VTYSKVGSQWGEQITGKAIKA
D7GDS8_PROFC          ---------------------------------------VGYSLIGPSWGGQITMKAFQA
D2PVF2_KRIFD          ---------------------------------------VSNSQIGASWGDQIANKAIWA
A1SJB0_NOCSJ          ---------------------------------------INATEIGPSWGKEIAKRSGTG
C7LYS7_ACIFD          -------------------------------------SAVAINYVGPTWGSQITDASLKA
Q1AWC9_RUBXD          --------------------------------------EVSVTSVSPSFGEQVRDQALQA
E1QZN4_OLSUV          ---------------------------------------YTVTTIGPDWGADVTRSSAMA
D8IEE2_BRAP9          ----------------------------------EKVTLIGSNIISGVVSSDNLKLAFIL
                                                                                  

E1R5K6_SEDSS          TILALVL----ILVYIWVRF----------------------------------------
E0RQA8_SPITD          VLVAIFF----MLVYIWFRF----------------------------------------
SECF_BORBU            VLGTFIL----ILIYITLRF----------------------------------------
SECF_TREPA            VLGALVL----IFLYVALRF----------------------------------------
Q73PW5_TREDE          VGGALVL----IFIYAMFRF----------------------------------------
B0SPU5_LEPBP          LLTTLGI----ILLYLSIRS----------------------------------------
Q72PD4_LEPIC          LGLTMAI----ILAYISFRF----------------------------------------
SECF_DICTD            AVLAIIV----MLVYITVRF----------------------------------------
B0VHR6_CLOAI          VMLALIA----MIIYIWFRF----------------------------------------
A1BCH7_CHLPD          LLAALLA----ILLYVGIRF----------------------------------------
SECF_RHOM4            ILGALLV----IFVYILIRF----------------------------------------
Q9WXE9_PRERU          VAIALFA----IFFYILLRFR---------------------------------------
D5MHP4_9BACT          IAISMLG----IIAYIAWRFE---------------------------------------
D8PI88_9BACT          VLISFVG----IVLYIAVRFE---------------------------------------
B6ANM4_9BACT          ILYSIFG----IIVYIAFRFE---------------------------------------
B5ECA5_GEOBB          VGLSMIG----IILYIAWRFD---------------------------------------
B3E2R7_GEOLS          VAISMLG----IICYIAWRFD---------------------------------------
SECF_THEYD            ILAATAG----ILIYIAIRFK---------------------------------------
SECF_KORVE            TLYSLGG----MLVYLWFRFE---------------------------------------
E8X5J9_GRATM          TIYSLIG----MLVYLWFRFE---------------------------------------
Q029K3_SOLUE          TLYALAG----MLVYIAFRFE---------------------------------------
SECF_ELUMP            LALSLVF----MVLYIAFRFQ---------------------------------------
SECF_UNCTG            FLFAFLV----MIVYVAFRFK---------------------------------------
D0RNY4_9PROT          VLIALIL----MLFYIWLRFE---------------------------------------
B6BPL7_9PROT          ISLSLAA----MLFYIWIRFE---------------------------------------
B4WED0_9CAUL          LGVAIGL----MFLYIWFRFE---------------------------------------
D5VIW1_CAUST          LGVALLL----TLGYIWFRFG---------------------------------------
Q0BS57_GRABC          LGVSLLM----ILGYIWVRFE---------------------------------------
C6XJ03_HIRBI          LVVALGL----MLLYIWFRFQ---------------------------------------
Q0ANE7_MARMM          IGIALFL----MLVYIWFRFE---------------------------------------
Q0C0W7_HYPNA          LGVATIM----MFLYIAFRYS---------------------------------------
E2CQN2_9RHOB          VAASLLA----ILFYIWFRFE---------------------------------------
A7HXL1_PARL1          VVISIAL----MLVYIWFRFE---------------------------------------
D8JWH2_HYPDA          VAAGILA----IVAYVWFRFE---------------------------------------
E3I015_RHOVT          LVLANLG----IFAYVWFRFE---------------------------------------
B0UI93_METS4          VVLSVVA----VLLYLWFRFE---------------------------------------
B2II62_BEII9          VVLSIIA----VLGYLWFRFE---------------------------------------
E6VHR2_RHOPX          LILAILG----ILIYLWFRFE---------------------------------------
A7IND7_XANP2          LVLGAVA----VLAYLWFRFE---------------------------------------
D5BQT4_PUNMI          VMCALMA----ILVYIWFRFE---------------------------------------
Q2W4A8_MAGSA          VVLALGA----IALYVWFRFE---------------------------------------
B6ISI3_RHOCS          TVLAIMA----IAAYVAFRFE---------------------------------------
Q2NBX9_ERYLH          LLAAMIA----ISIYIWVRFE---------------------------------------
Q1GSE6_SPHAL          LILAMIA----ISIYIWIRFE---------------------------------------
D4YYJ1_SPHJU          VMLAVIG----IAIFSWFRYE---------------------------------------
SECF_RHOCB            LLAATVV----IMFYIWVRFE---------------------------------------
SECF_KETVY            AVLAVAASLLGIMAYVWLRFE---------------------------------------
D0D195_9RHOB          VALAIGA----VLVYIWLRFE---------------------------------------
SECF_RICPR            MLFSFLA----IMVYIGVRFE---------------------------------------
A5CDU1_ORITB          LALALVG----IAIYVWIRFK---------------------------------------
B9KH24_ANAMF          VLCSLVG----MFLYLCCRFK---------------------------------------
Q2GI09_EHRCR          IIFSLLG----MFLYLWVRFQ---------------------------------------
Q5GT97_WOLTR          MFIAIVG----IFFYVWFRFN---------------------------------------
C6V4R4_NEORI          IIFSVLA----MFVYLFFRFT---------------------------------------
C1D5X5_LARHH          LAMVCLG----IILYLAARFE---------------------------------------
B1XW93_LEPCP          LAFVIVG----IMIYLALRFE---------------------------------------
B6BWI7_9PROT          ILFVCLG----IILYLSLRFE---------------------------------------
A5EWX6_DICNV          LVLSCVG----LVIYLAVRFE---------------------------------------
C0N4C3_9GAMM          MLYALFG----ILIYVSLRFE---------------------------------------
A5CVL6_VESOH          MLYALIG----ILIYVLFRFE---------------------------------------
A1WXP7_HALHL          LLYALGG----VLVYVAFRFE---------------------------------------
Q31FZ8_HYDCU          VIYALIG----VLIYVALRFE---------------------------------------
D3S9V5_THISK          MIYALAG----ILIYVAVRFE---------------------------------------
D3RSH8_ALLVD          VLFSLIG----ILIYVALRFE---------------------------------------
C7RB48_KANKD          MIVALIC----IMIYVALRFE---------------------------------------
A4GK29_9BACT          LLLALLI----MAVYIMFRFQ---------------------------------------
A4GHV4_9BACT          MLIALAF----MMLYIAFRFQ---------------------------------------
B8KFI4_9GAMM          MLLALGL----VMLYIAFRFQ---------------------------------------
Q21KV9_SACD2          MLLALAV----VMAYVAVRFQ---------------------------------------
Q2SDV4_HAHCH          LLLALGV----IMLYIAFRFQ---------------------------------------
E4PKE9_MARAH          LLIALAV----VLIYVGMRFQ---------------------------------------
A6VYM8_MARMS          MLLALAI----VMIYVAVRFQ---------------------------------------
E1V6F3_HALED          MLVALGV----VVLYVAFRFQ---------------------------------------
Q0VS96_ALCBS          MLLALGL----MMLYVWFRFS---------------------------------------
B3PDJ9_CELJU          LLAAFAL----VFLYVAVQFQ---------------------------------------
Q8GEL5_PSEPU          MLLALGG----ILIYLAFRFQ---------------------------------------
D0SG96_ACIJO          VALALLL----MLVYVTIRFE---------------------------------------
Q1QBR5_PSYCK          IVLALAC----MLGYVALRFQ---------------------------------------
Q83CH4_COXBU          VIVALIA----TMIYIALRFE---------------------------------------
Q5ZU08_LEGPH          IIVSLLA----TMIYIAMRFE---------------------------------------
A0A0B3WJC7_FRATU      IIVAMVC----ILIYISARFE---------------------------------------
B8L1U9_9GAMM          TIFMLAG----FLIYIAVRFE---------------------------------------
D0KW98_HALNC          MIVVLSG----LLIFVSLRYQ---------------------------------------
B7J4R6_ACIF2          LIIVTLG----ILIYVGFRFE---------------------------------------
SECF_ECOLI            LMAALLS----ILVYVGFRFE---------------------------------------
Q8D162_YERPE          LLVALLS----ILVYVGFRFE---------------------------------------
Q1LSN7_BAUCH          LLLAIIC----IFIYVIFRFE---------------------------------------
Q7VQA8_BLOFL          TLVALIC----IFLYILVRFE---------------------------------------
E8Q616_BLOVB          FFMTFLC----IFLYITYRFE---------------------------------------
Q493H0_BLOPB          LLVALIC----ILVYITFRFE---------------------------------------
A0KJ23_AERHH          MLASILC----ILIYVAVRFE---------------------------------------
Q0HWQ6_SHESR          VLVALIC----IMIYVSFRFE---------------------------------------
C4L7L0_TOLAT          ILAALGC----ILVYVALRFE---------------------------------------
Q5QVF2_IDILO          MLTALIC----ILLYIAMRFE---------------------------------------
Q5E3D5_ALIF1          ILVSLLC----ILAYVSMRFQ---------------------------------------
SECF_HAEIN            TLATLAM----VLIYVGSRFE---------------------------------------
D4ZB75_SHEVD          LLVAMLC----IMAYLSYRFE---------------------------------------
C3LVV7_VIBCM          LLICLLS----ILAYLSFRFE---------------------------------------
E1SV06_FERBD          VLFSMLA----ILFYLWYRFE---------------------------------------
A1S8J4_SHEAM          LLIAMLC----ILGYLSLRFE---------------------------------------
B7VU09_VIBTL          VLVCFLM----IMLYLSVRFE---------------------------------------
B7VQK9_VIBTL          ILACFVL----TLLYLSYRFE---------------------------------------
Q15N35_PSEA6          LIVAAIA----MMIYLTWRFE---------------------------------------
Q3IL51_PSEHT          LLAAMVA----VMLYLAIRFE---------------------------------------
A0KLF0_AERHH          VLVASLA----ISAYLAVRFE---------------------------------------
Q2RTI2_RHORT          VALALVL----IAAYVWLRFD---------------------------------------
C5ZWZ3_9HELI          LTLAIIS----IMAYVAYRYE---------------------------------------
C3XE90_9HELI          LVLATIA----MMAYVSFRYE---------------------------------------
E7A9U2_HELFC          LVLAIIA----MMLYVSFRYE---------------------------------------
A8ERU7_ARCB4          LILALAA----ILIYIGWRFE---------------------------------------
D1B3G6_SULD5          AILAVIG----ILIYVAVRFE---------------------------------------
A6Q513_NITSB          TVIAIIG----ILIYVSIRFE---------------------------------------
E4U019_SULKY          FLLTLGA----IMAMVTFRYE---------------------------------------
A7ZE41_CAMC1          LGISLIG----VLLYITFRFE---------------------------------------
E1YHR4_9DELT          IFYSLLF----LAIYISGRFEFKWLSSAILAVVLMGVVYFCSVF--KINMALLIAFALFI
A8ZW13_DESOH          LFFSLLF----INIYISGRFEMKWVVAGVVAGGLILAVWLFSML--GISIPYLILVALVV
B8F9E2_DESAL          MFYALLF----ITVYISGRFELKWIPPLVMALAIIGVAYFMDKF--DLGIPAQIAVALVI
E1QIL9_DESB2          ILYSILM----IAVYISGRFEGKWALAGLMAAVLVGVTLLVEAISGGAGAVTLIVIAMAV
C7LN35_DESBD          IFYAVLL----IATYISGRFEQKWMVAGLMAAGLASVVYVLDLL--NAPTSLSVIVATIA
C4XR64_DESMR          IFYSVLL----IAIYISGRFEHRWMAAGLMAAGLAGGIYVLKLV--GASTVWLIVAAMAI
C8X141_DESRD          LFYAILI----ISIYISGRFEHRWLASALMAGGLAGGLYVLQIA--GFPLSALVVAALVI
B8J2Q5_DESDA          LYYAILL----IAVYISGRFEQRWMAGVIMAGALWGGIYLAGLT--GLSMGWLVMLALSI
A0A0H3AA07_DESVV      LYYAVLL----IAVYISGRFEQRWMASAVMAATLWGGMYLLSAI--GLGREWLVFVSLLV
Q1MSC2_LAWIP          IFYAILL----ITIYISGRFEHRWIIAAGITGVLAAAMYCMNLF--DFSMVTKVVIALIL
Q3A3C5_PELCD          IVFAMVG----VLIYITIRFE---------------------------------------
Q2LVH3_SYNAS          IIFSWIG----ILVYVGFRFE---------------------------------------
SECF_CALNY            LLYANIG----VLIYVAIRFE---------------------------------------
D4H482_DENA2          VLYSLIG----VLIYVAFRFQ---------------------------------------
SECF_MAGMM            MLYAMVA----ILIYISFRFE---------------------------------------
SECF_DESIS            ILYALLA----IVAYIWWRYE---------------------------------------
E8T6K2_THEA1          IIYALIG----ILIYVAWRFE---------------------------------------
SECF_AQUAE            ILTALGG----ILLYLGVRFQ---------------------------------------
D3SMD0_THEAH          ILTAIGG----ILLYLAYRFE---------------------------------------
B4U6P7_HYDS0          VITALVG----ILIYLSFRYE---------------------------------------
C0QRM5_PERMH          IVAVLVA----ILIYVSYRFE---------------------------------------
SECF_PETMO            VIISLIV----LLAYITIRFQ---------------------------------------
C5CF37_KOSOT          VIVAVAL----ILLYITIRFR---------------------------------------
A7HMQ5_FERNB          IVFTLLG----ILVYVALRFK---------------------------------------
A6LP85_THEM4          VVFTLLA----ILLYITLRFQ---------------------------------------
Q9WZW5_THEMA          ILVALVV----LLIYITIRFR---------------------------------------
B8JH53_ANAD2          ILYAIGL----IVVYIGLRFD---------------------------------------
Q1D3B7_MYXXD          LLYSMVA----ILIYVAFRFD---------------------------------------
E1X0T7_HALMS          MLWALIA----IMIYIGLRFD---------------------------------------
Q6MKZ3_BDEBA          VFYCLLV----ILIYVALRFD---------------------------------------
A9F8C8_SORC5          VAITIFF----IMAYIAFRFD---------------------------------------
D0LJ87_HALO1          LFYAIAL----IMLYLAFRFD---------------------------------------
B3T9T6_9ZZZZ          VAFAAVV----ILFYITWAFRRVPSP----------------------------------
D2BGI5_DEHMV          VGAALVG----ILLYVTWAFRRMPKP----------------------------------
A9WGQ9_CHLAA          VLGASLI----ILLYLTWAFRKAPHP----------------------------------
A9B5U8_HERA2          VFIASLA----IMGYLWAAFRGTPNP----------------------------------
SECF_ANATU            VSIAALA----VIIYITWAFRGVHNA----------------------------------
SECF_THET1            IALASLG----ILGYIAFAFRKVSHP----------------------------------
D1C4J4_SPHTD          VALASIG----ILLYIAFAFRNTQNP----------------------------------
B4WJX7_SYNS7          LLVAFAL----IAAYLSLRFK---------------------------------------
SECF_ACAM1            LIVSFAA----IIVYVSVRFQ---------------------------------------
A0A0H3K5W7_SYNP6      LLVSFAG----ILVYLNFRFQ---------------------------------------
B8HQ25_CYAP4          LLISFVG----ITLYLTVRFQ---------------------------------------
SECF_SYNP2            LLVSFFG----IIVYLSIRFQ---------------------------------------
SECF_SYNY3            LVISLLG----IIIYLTIRFQ---------------------------------------
D3EPH1_ATETH          LLVSFLG----IVFYLSVRFK---------------------------------------
Q2JKR7_SYNJB          VLISFGL----IVLYLALRFQ---------------------------------------
Q7NDR5_GLOVI          LALALAA----ILVYLAFRFQ---------------------------------------
SECF_PROMA            LLVAFSC----VAIYISIRFD---------------------------------------
A2CA57_PROM3          LLVAFTG----IAIYISLRYD---------------------------------------
Q46L53_PROMT          LFFAFLG----IALYINFRYD---------------------------------------
A5GTK4_SYNR3          LTVSFAA----VALYISARYA---------------------------------------
Q7V1E6_PROMP          LLVSLFA----ISLYISIRFD---------------------------------------
B5Y8Y1_COPPD          LTVALLA----LLVYISVRFR---------------------------------------
D4JXA7_9FIRM          VLFSFIL----LVIYIAFRFK---------------------------------------
E6UEG8_RUMA7          VIFAAIV----TIIYIGFRFR---------------------------------------
D4LA66_RUMC1          ALAASVI----LIIYIALRFK---------------------------------------
A0A2N0UMZ5_9FIRM      VAIAAVL----MVLYVTIRFK---------------------------------------
E1PK78_MAGIU          VLVSSIL----IVLYVWIRFR---------------------------------------
E6U7Q5_ETHHY          VLLAALL----IVLYVWIRFR---------------------------------------
A3DDV8_HUNT2          VALSLIL----LILYIGIRFN---------------------------------------
B8I6M7_RUMCH          IVIAFIL----IILYVWYRFK---------------------------------------
E0RMP8_PAEP6          ILLACVA----IAVYISIRFE---------------------------------------
C6D7X9_PAESJ          VIIASVA----IMLYVMIRFE---------------------------------------
C0ZAP7_BREBN          VAIAAVG----IAIYIAIRFQ---------------------------------------
SECF_ALIAD            VLAAAAC----IVVYIAIRFE---------------------------------------
Q5WHQ4_BACSK          VLIASLG----IVIYIGFRFH---------------------------------------
D6XWY7_BACIE          VLIASVG----IIIYVTFRFE---------------------------------------
B1YJQ6_EXIS2          VLLASLG----IVIYVSFRFQ---------------------------------------
B7R9G0_9THEO          LVVASLV----MLTYLGIRFN---------------------------------------
D9TNU6_THETC          SAVAALL----MLIYIGFRFN---------------------------------------
C6PXQ6_9CLOT          IALSVVA----MLIYVAFRFE---------------------------------------
Q892A5_CLOTE          LVIANIA----MLIYVGFRFE---------------------------------------
A6LTN3_CLOB8          LLAAFAV----MLVYIAIRFE---------------------------------------
Q97GT8_CLOAB          LAIALVI----ILLYIAWRFE---------------------------------------
D9SMV1_CLOC7          VVIAVAA----MLIYIAFRFE---------------------------------------
A6TQN5_ALKMQ          VVISALG----MLAYITYRFE---------------------------------------
E3GFZ4_9FIRM          SAIAVLL----MLIYITFRFE---------------------------------------
D9TIR8_CALOO          VVIASIL----MLIYIAIRFE---------------------------------------
D9RXQ1_THEOJ          LIIANIG----VLIYVAFRFE---------------------------------------
D9QVJ2_ACEAZ          LLIAAIA----IVLYISYRFE---------------------------------------
E4RIJ9_HALHG          MLVASIA----IVAYISFRFE---------------------------------------
B2A264_NATTJ          LLIASLG----MIAFISYRFE---------------------------------------
A0A1H8CTT8_9FIRM      TIISWLL----IIAYVSYRFE---------------------------------------
D1BLM5_VEIPT          LVIAFAA----LALYISYRFE---------------------------------------
SECF_ACIFV            VVLSWVL----MIIYITIRFE---------------------------------------
C8W4E2_DESAS          LLVAFML----MLGYISWRFE---------------------------------------
A5D3H0_PELTS          LAVASVL----MVIYIAWRFE---------------------------------------
A4J545_DESRM          LAIASVL----MILYITWRFE---------------------------------------
B1I4K4_DESAP          LLAAAVA----IVVYISWRFE---------------------------------------
C9R7V2_AMMDK          SGLSLVI----LLIYLAIRFD---------------------------------------
B0TF82_HELMI          LLLAIIG----MVAYISFRFE---------------------------------------
D5XEJ7_THEPJ          LAIASVL----MVIYITFRFE---------------------------------------
Q2RHU7_MOOTA          MVIAWIL----MIIYITIRFE---------------------------------------
D7CLE8_SYNLT          ILIASVL----MLVYISFRFE---------------------------------------
Q0AX23_SYNWW          VLIAMLL----MLVYISFRFE---------------------------------------
SECF_SEBTE            LALGSIL----ILIYITIRFE---------------------------------------
E3CUY4_9BACT          LILALGG----ILAYMAFRFQ---------------------------------------
D5EDU6_AMICL          VSLALLG----ILAYITVRFK---------------------------------------
D4M8L9_9BACT          VSIALVA----ILIYITVRFR---------------------------------------
E6SLR1_THEM7          LGLATVG----MIVYMTVRFE---------------------------------------
B5H469_STRC2          LGVAVAA----QLLYLTARFR---------------------------------------
SECF_GEMAT            MLIASIF----TLIYLAIRFD---------------------------------------
Q67LL9_SYMTH          VGIAAVL----QVIYISIRFQ---------------------------------------
C4RGU1_MICS3          LVIFIAL----VTVYLVLRF----------------------------------------
D2S9H9_GEOOG          LAVFLVA----VVLFLAVRF----------------------------------------
D3PYP6_STANL          LGVSLAL----IMGYLWWRY----------------------------------------
SECF_MYCLE            LVVFLVL----VGLYITVRY----------------------------------------
B1MCI7_MYCA9          LGVFLVL----AGIYIAVRY----------------------------------------
Q5YTF3_NOCFA          LLVFLVI----VSVYIAVRF----------------------------------------
D0LCM9_GORB4          LVVFLVI----VFVYIAVRF----------------------------------------
D6Z7I7_SEGRD          LGVFLVA----IGVYIAVRF----------------------------------------
D5UNI8_TSUPD          LIVFLVL----VTIYIAVRFR---------------------------------------
C3PGQ3_CORA7          MAVFLVL----ATIYVAVRL----------------------------------------
Q79VF7_CORGL          LIAFLVI----AAIYIAFRL----------------------------------------
D9QAR8_CORP2          MFVFLVA----VFIYIAVRL----------------------------------------
C4LIX4_CORK4          LIVFLAL----IFLYITVRF----------------------------------------
Q4JVE2_CORJK          LGVFLLT----VFLYIAFRM----------------------------------------
B1VDK1_CORU7          LGVFVLA----VFAYIGLRM----------------------------------------
C6WCM8_ACTMD          LLIFFVA----VMLFLALYF----------------------------------------
C7MR00_SACVD          LAVFLVL----VAVFLILYF----------------------------------------
C8XE15_NAKMY          VLVFLVA----VAAFLWIRY----------------------------------------
A0LUK2_ACIC1          LIVFLVA----VVLYLTLFF----------------------------------------
D7BWW9_STRBB          LAIFMVL----VVIYLAIAF----------------------------------------
Q0RNU2_FRAAA          LVVFLVL----VMIYLSVRF----------------------------------------
D1AEV5_THECD          VLIFLLL----ILGYLSVAF----------------------------------------
C7QJQ2_CATAD          LVVFVAL----VMLYLAVFY----------------------------------------
D7BNQ3_ARCHD          MIIFMVL----ISLVLTIYFR---------------------------------------
D6ZHF3_MOBCV          LLVFMGM----IAVLLMAYFR---------------------------------------
A0JXA8_ARTS2          LVIFVVI----AAVLMALYFR---------------------------------------
C5CCH8_MICLC          LVIFVVL----VALFMAVYFR---------------------------------------
D2NT09_ROTMD          LVAFVVL----ALIGMAFYFR---------------------------------------
B0REC3_CLAMS          LVVFLAL----AAVVMSVYFR---------------------------------------
Q6AFB1_LEIXX          LVVFLLL----AFIAMALYFR---------------------------------------
A6WCH5_KINRD          LVVFLVI----VSIVMTLYFR---------------------------------------
D1BGW3_SANKS          LVVFLVL----VTLVMSVYFR---------------------------------------
D1BSK2_XYLCX          VVVFVLA----AAAFMAVYFR---------------------------------------
C7MCC3_BRAFD          VIVFLAL----VAGMMALYFR---------------------------------------
E6SB76_INTC7          LIVFLVL----VTLVMALYFR---------------------------------------
C7NI43_KYTSD          LGVFLVL----VSGVLALYFR---------------------------------------
Q83MZ6_TROWT          LVIFLLL----VFVVMALYFR---------------------------------------
D4HDX0_CUTAS          LVVFLVL----VMLQIWAYFR---------------------------------------
D7GDS8_PROFC          LIVFLVL----VALMIWAFFR---------------------------------------
D2PVF2_KRIFD          LVVFLFL----VFLVIWAYFR---------------------------------------
A1SJB0_NOCSJ          LVVFLIL----VVIFIWAYFR---------------------------------------
C7LYS7_ACIFD          LVAFFVG----ITLYISLRF----------------------------------------
Q1AWC9_RUBXD          VAASLLL----IVFFITVRY----------------------------------------
E1QZN4_OLSUV          FGVAILL----IIAYVSVRY----------------------------------------
D8IEE2_BRAP9          VIVSWII----IMIYITIRFN---------------------------------------
                                                                                  

E1R5K6_SEDSS          --------RFGFAISS----ITALVHDVLIMLGFIGVF-------RLEVSTTTIAAVLTI
E0RQA8_SPITD          --------QLAYAVGA----ITALFHDVFVLLGVIGAF-------QLEVSTATIAAILTI
SECF_BORBU            --------KLSYAIAS----ILSIFHDIFFIVAFLGVF-------RIEINSYIIVAILTI
SECF_TREPA            --------RWFFALGA----IVALVHDACIMVSFMVWF-------GLEFNSASIAAILTI
Q73PW5_TREDE          --------QWNFSLAA----IIALLHDTLIMIMFISWT-------QMEFNSTTIAAILTI
B0SPU5_LEPBP          --------QFKFALAS----AIALVHDILMTLALIGFL-------QIKPSVPIIAALLTL
Q72PD4_LEPIC          --------QFKFALGA----ILALTHDLILTVAFIGFF-------QIKPSVPIIAALLTL
SECF_DICTD            --------RFDFAISA----IINEAFVLLATISIFAIS-------QWEVSPSFIAAILTL
B0VHR6_CLOAI          --------EFTFGLMG----ILALFHDVFLIVGFFALT-------GKEITMQIIAALLTI
A1BCH7_CHLPD          --------EIKFATAG----VVAIFHDIFVVLGLFSLLGGVFDFMPLELDQSIIAAFLTI
SECF_RHOM4            --------EWRFSLGA----VVALFHDVLITLGLFSLLHGWLPF-SLEIDQTIIAAFLTI
Q9WXE9_PRERU          --------NWAFSVGA----VVALALDALLVIGIYSLCWGIVPM-SLEIDQVFIGAILTV
D5MHP4_9BACT          ---------FKFGVAA----AIATLHDVLAVLGLFMIL-------NREITLLIITALLTL
D8PI88_9BACT          ---------LRFGVAA----ALATFHDVLAVLGVFYLL-------DKEITLLVITALLTL
B6ANM4_9BACT          ---------FRFGVAA----AISTFHNVMAVLGILYLL-------GVEINLLVVTALLTL
B5ECA5_GEOBB          ---------FKFGVGA----IAATLHDVLAMVALFYLM-------NKEINLLFITAVLTI
B3E2R7_GEOLS          ---------FKFGVGA----IVATLHDILAMFAAYYLF-------GKEFNLLFITAVLTI
SECF_THEYD            ---------FHFSIGA----TVATFHDVMAVLGIFYIL-------DKEINLIFISALLTI
SECF_KORVE            ---------LIYGIGA----VVACFHDTIITVGAFSLL-------NRDISLTVVAAILTL
E8X5J9_GRATM          ---------LIYGVAA----VVAVFHDTLITVGAFSLT-------NQEITLTVIAAILTL
Q029K3_SOLUE          ---------WIYGLGA----VIAVFHDTLITIGLFSIF-------HEEISMTVIAALLTL
SECF_ELUMP            --------NIIWGTAG----VIALIHDAFFMVAAFAFL-------QKEFDLVIVAALLTA
SECF_UNCTG            --------SSLWGIVS----VVGIIHDIVISLGFVILA-------NKEINITIVAALLTV
D0RNY4_9PROT          ---------WQFSLGS----ILALLHDVILTLGAFSII-------GFEFNLSIIAAILTI
B6BPL7_9PROT          ---------WQFSLGA----ILALFHDVIVTLGVFSLF-------SLEINLSIIAAVLTI
B4WED0_9CAUL          ---------PQFGFGA----VIGLLHDVVLTFGLIVLF-------RLEFSLNMVAAILTV
D5VIW1_CAUST          ---------LSYGTGA----VVAVIHDIVLTLGLLSVV-------GIEFSMTEIAALLTV
Q0BS57_GRABC          ---------WEFAVGA----VVTLVLDVTKAVGFLALT-------RIEFNFVIIAAILTI
C6XJ03_HIRBI          ---------WQFSIGA----VLALIHDVILTIGMFAVT-------QFEFNLSTIAALLTI
Q0ANE7_MARMM          ---------WQYSVGA----IVALTHDVIATIGMFSLT-------QMTFDLATVAAILTI
Q0C0W7_HYPNA          ---------WSYAVGG----IAALIHDAIGTIGLFSLL-------QIQFDLTTIAALLTI
E2CQN2_9RHOB          ---------WQFAVGA----ILTTANDVIITVGLFVVL-------QLDFSLSSIAAVLTI
A7HXL1_PARL1          ---------WQFSLGS----VIALVHDVMATLGLFCIL-------QLEFNLTSIAAILTI
D8JWH2_HYPDA          ---------WQFALGA----VLALSHDVIVTVGIFALF-------QFEFDLSTVAALLTI
E3I015_RHOVT          ---------WQFALGA----IIALVHDVMITIGLWSLF-------GLDFDLTIVAALLTI
B0UI93_METS4          ---------RELALGA----IVGTLHDIVLTVGVFVIS-------RIEFNMTSIAAILTI
B2II62_BEII9          ---------WQFAVGA----IIATMHDLLLTVGFFSVT-------QLEFNTTSIAAILTI
E6VHR2_RHOPX          ---------WQFALGA----MIANVHDIVLTIGFMSIS-------QVDFDLTSIAALLTI
A7IND7_XANP2          ---------WQFAVGA----IVTTMHDIFVTLMIYSAF-------GIDFDLTSIAAILTI
D5BQT4_PUNMI          ---------WQFSIAA----IVALAHDVLSTIGLFSLT-------SFEFNLATVAAILTI
Q2W4A8_MAGSA          ---------WQFGVGA----LVSTFHDVITTFGLFSIT-------GLEFNLTTVAAILTI
B6ISI3_RHOCS          ---------WQFGVSA----LIATFHDVFVTLGLFIVL-------QLEFDLTAVAALLTL
Q2NBX9_ERYLH          ---------WQFGVGA----MFALVHDVSLTLGMFALF-------QLEFSLQIIAAILAI
Q1GSE6_SPHAL          ---------WQFGVGA----LFALFHDVTLTFGFFALT-------QMQFDLNIVAALLTI
D4YYJ1_SPHJU          ---------WQFGVST----FVAIMHDVLMTLGFFAVT-------QLEFDLNIVAAVLTI
SECF_RHOCB            ---------WQFALGA----VVALVHDVLLTVGLFAVL-------QLKFDLTTVAALLTI
SECF_KETVY            ---------WQFGFGA----VVGLFTDAMITVGLFSVF-------QVRFDLTIVAAVLTI
D0D195_9RHOB          ---------WQFAAGA----VLALVHDVLLTIGVFSEV-------GIRFDLSIIAALLTI
SECF_RICPR            ---------WYFGFGI----LIALVHDVILALGFMSMT-------KLDFNLSTIAAVLTI
A5CDU1_ORITB          ---------WQFGVGI----LVAIMHDAILSMGFMSIS-------GLEFDLSSVAALLTV
B9KH24_ANAMF          ---------LQFAVGG----VLALVHDVAITMGMVSAT-------GIEFGLPATAGVLMI
Q2GI09_EHRCR          ---------WRFALGG----VLALIHDVVLTLGLVSLC-------NIEFNLSSTAAILTV
Q5GT97_WOLTR          ---------WQCGFGG----TIALIHDVILTVGFVSLT-------GIKFNISSVAALLTV
C6V4R4_NEORI          ---------PAFALSG----VLTTLHDIILLVCLYSAY-------ELEFNTSSVAAVLAI
C1D5X5_LARHH          ---------WRFAVSA----IIANLHDVVIILGCFALF-------QWEFSLTVLAAILAV
B1XW93_LEPCP          ---------WKFAVAA----IIANLHDVIIILGFFAYF-------QWEFSLSVLAAVLAV
B6BWI7_9PROT          ---------WRFALAA----VVANMHDVIIILGFFAFF-------QWEFNLTVLAAVLAV
A5EWX6_DICNV          ---------MKFAIGA----VLSQLHDVIATAAMFSLA-------GWTMDLTVLAALLAV
C0N4C3_9GAMM          ---------YRFAIGS----VVALIHDVVLTLGFFSLT-------RIEFDLTVLAAILAI
A5CVL6_VESOH          ---------YRFSLGS----IAALIHDVIIILGVFSLF-------QIEFDLTVLAAILAV
A1WXP7_HALHL          ---------YRFALGA----VAALVHDIVLILGFFSLT-------RLTFDLTVLAALLAT
Q31FZ8_HYDCU          ---------FRFSIGS----VAALVHDVVITLGVFSWT-------QAQFDLTVLAAILAV
D3S9V5_THISK          ---------WRFSIGA----VFALIYDVVITLGIFSLL-------QLEFDLGVLAAVLAV
D3RSH8_ALLVD          ---------WRFAVGA----VVALIHDVLFTVGVFSLL-------QIPFDLTVLAAVLAV
C7RB48_KANKD          ---------WKFSVGS----VAALAHDVIIVVGFFSIT-------SVEFDLTVLAALLAV
A4GK29_9BACT          ---------YKFAVGA----IFALVHDVLIVVGMFSLF-------SIDFDLTVLAAVLAV
A4GHV4_9BACT          ---------SMFAGAA----VIALIHDVIVVIGIFSLI-------QIEFDLTVLAALLAV
B8KFI4_9GAMM          ---------FKFAVGA----VVALIHDVIVTLGFFSIS-------GLEFDLTVLAALLAV
Q21KV9_SACD2          ---------FKFSVGA----VAALIHDVIIVLGVFSFF-------QLTFDLTVLAAVLAV
Q2SDV4_HAHCH          ---------FKFSVGA----VMALVHDVIITVGMFSLF-------QWDFDLNVLAAVLAV
E4PKE9_MARAH          ---------FKFGIAS----VVPLAHDVIIVLGVFALF-------QWTFDLTVLAALLAV
A6VYM8_MARMS          ---------FKFSVAS----VAALIHDVIITLGFFSIF-------EVEFDLTVLAALLAV
E1V6F3_HALED          ---------YKFALGA----LLALGHDVLIVLGIFALF-------GFEFDLTVLAAVLAV
Q0VS96_ALCBS          ---------NKFGVAT----VLALFHDVIIVLGLFALI-------QWPFDLTVLAAVLAL
B3PDJ9_CELJU          ---------WKFSVGA----IIGLIHNVIITVGCFALF-------QWDFDLNVLAAVLAL
Q8GEL5_PSEPU          ---------WKFAVGA----IISLIHDVVVTLGILSFF-------QITFDLTVLAAVLAI
D0SG96_ACIJO          ---------FKLAMGA----VLSLFHDVVVTIGIFAMM-------QWPFDLTVLAAILAL
Q1QBR5_PSYCK          ---------FKLALGA----VLSLFHDAIVTIGVFALF-------GFPFDLTVLAAILAL
Q83CH4_COXBU          ---------MRFALSA----AIALIHDPVLILGIFSFF-------HIEFNLIVLAAVLTV
Q5ZU08_LEGPH          ---------YKLAVSS----AVALIHDPVLILGVFALF-------GIEFDLKALAGLLAV
A0A0B3WJC7_FRATU      ---------MKFGISA----CIALLHDPIVILGIFSAF-------QLEFDLTVLAAVLAV
B8L1U9_9GAMM          ---------WKFAVTA----SIVAMFDLIVTVAYVSLL-------GREFDLTVLAGLLSV
D0KW98_HALNC          ---------LKMATGA----VLTLSHDLIMVFGFISVT-------GIEFNLTVLAAYLAL
B7J4R6_ACIF2          ---------WRFAVGG----VLAMLHDPILVVGFFAIS-------HEEFSLTVIAALLVI
SECF_ECOLI            ---------WRLAAGV----VIALAHDVIITLGILSLF-------HIEIDLTIVASLMSV
Q8D162_YERPE          ---------WRLALGA----VISLAHDVVITMGILSLF-------HIEIDLTIIASLMSV
Q1LSN7_BAUCH          ---------WRLATGT----VLALIHDVVITLGLLSVF-------KIEIESTIIASLISV
Q7VQA8_BLOFL          ---------LRLSVSV----IISLVHDIIIILGILSIF-------TVEINSTIIAALISV
E8Q616_BLOVB          ---------LTLSIAT----FISLIYDIIITLGFLSVF-------YIEINSTTITALISS
Q493H0_BLOPB          ---------WRLATGV----VISLIYDMIVILGILSLF-------AIKIDSTIIAALMSA
A0KJ23_AERHH          ---------WRLAMGG----ILSLVHDVVITLGVFAYF-------QYEFDLTVLAALMTL
Q0HWQ6_SHESR          ---------WRLAFGS----VAALAHDVIVTLGVFSVL-------QLEFDLTVLAGVLTV
C4L7L0_TOLAT          ---------WRMATGA----VLSLAHDILITLAVFSWT-------QMEFDLNVLAAVLTV
Q5QVF2_IDILO          ---------WRLAVGA----VAALAHDVILTLGLFSIL-------QLEFDLTVLAALLAV
Q5E3D5_ALIF1          ---------WRLAAGA----VLALAHDIIITLGIFSFL-------QIEVDLTIIAALLTV
SECF_HAEIN            ---------WRLGFGS----IASLAHDVIITLGVFSAL-------QIEIDLTFVAAILSV
D4ZB75_SHEVD          ---------WRLACGS----LLALFHDVIFVLAFFSLT-------QTEFNLTVLAAVLAI
C3LVV7_VIBCM          ---------WRLASGA----LLALLHDVILVLGFFAIT-------QMEFNLTVFAAVLAV
E1SV06_FERBD          ---------WRLASGA----LLALLHDVIMVLGLFAVT-------QMEFNLTVLAAVLAV
A1S8J4_SHEAM          ---------WRLAAGA----LVALVHDVVLVLGVFALT-------GMEFNLTVLAAVLAV
B7VU09_VIBTL          ---------WRLALGA----LAAIIYDVTLILGLFAFT-------QFEFNLTVLAAVLAI
B7VQK9_VIBTL          ---------WRLALGS----IAALIYDIVIVLGLFAVT-------QIEFNLTVLAALLAV
Q15N35_PSEA6          ---------WRLACGS----LMALVHDVLVVLGLFAWL-------GLPFDLTVLAAVLAI
Q3IL51_PSEHT          ---------WRLALGS----VVALTHDLILVLGLFSLL-------QLEFNLTILASLLAI
A0KLF0_AERHH          ---------WRQAIGI----LVSVLHDGLVALGLLALF-------NIEFDLNVIAGLMAV
Q2RTI2_RHORT          ---------WHYALGV----VLALSHDVVAVLGLYALF-------QIPFDLTSIAALLTV
C5ZWZ3_9HELI          ---------WRFALAS----ILALIHDVVIAAGAVVLF-------DVDLSLEVIAALLTL
C3XE90_9HELI          ---------WRFALAS----IIALVHDIVITAASVIIF-------KIDLNLEVIAALLTL
E7A9U2_HELFC          ---------WRFALAG----VLALAHDTLVTAVSVIVF-------NIDLNLEVIAALLTL
A8ERU7_ARCB4          ---------WRFAIAS----ILGLIHDIIITLGLLSLF-------KVDINLDMIAAILTL
D1B3G6_SULD5          ---------WKFAVAS----IITLVHDITITLGAIILF-------NIEISLDVLAAVLTL
A6Q513_NITSB          ---------WRFALAS----VLALVHDVSIAMGAISLF-------NVPVNLDILAAILTI
E4U019_SULKY          ---------WRFALAA----IIAIVHDIVITFGFVSYF-------EIDFNIESVAALLMI
A7ZE41_CAMC1          ---------WRFALAA----IATEIHDIVITVGAISLF-------DIDVNLDTLAAVLTV
E1YHR4_9DELT          TFVFFWFLDLKYAMAA----IVALVHDVIITVGMFSIL-------GKEFNLPIVAAVLAI
A8ZW13_DESOH          SLVLFWVLELKYAMGA----IVALIHDVTITVGIFSIT-------GKEFSLPIIAALLTI
B8F9E2_DESAL          AVAGFWVLKLQYAMGA----IVALIHDVIITVGVFSLV-------GKEFNLPIIAALLTI
E1QIL9_DESB2          TMAACWYLKLRYALGA----IVALLHDVIITVGVFSLL-------DKEFTLATVAAILTI
C7LN35_DESBD          ALVLCVVLRLKYALGA----IVALIHDVMIPLGLFSLL-------NKDVDLTIIAALLTI
C4XR64_DESMR          TLFLCFVMRLKYALGA----VVADLHDVFITVGIFSLL-------NIEFDLTIVAALLTI
C8X141_DESRD          AVGMCWYLKLNFALGA----VIALIHDVLVTVGVFSLL-------NKEFDLSIVAALLTI
B8J2Q5_DESDA          TVLVCFVLRLNFALGA----VVGLIHDVAITVGLLSLL-------DVEIDLNVMAALMTL
A0A0H3AA07_DESVV      TVALCWKLKLNFALGA----IIALLHDVLISIGLLSLL-------GKEFDLNIIAALLTL
Q1MSC2_LAWIP          TILLCWKLKLNFALGA----IVGLLHDVLITVGLLTLM-------GKEFDLNVIAALLTL
Q3A3C5_PELCD          ---------FKFAVGA----IIALLHDVLITLGAFSLF-------NKEIDLPIIAAFLAI
Q2LVH3_SYNAS          ---------LRYAFGG----IIALVHDVLVTVGTLSLL-------NKEFDLIIVAALLTI
SECF_CALNY            ---------LIFAIGA----ILALVHDVIITLGFLSLT-------SKEFNLTVVAALLAL
D4H482_DENA2          ---------LIFAVGA----VLAISHDVVITLGIFSIA-------GKEITLTIIAALLTI
SECF_MAGMM            ---------LRFALGA----VLALVHDVVLTMGFFSVL-------QKEFTLVVVAALLTV
SECF_DESIS            ---------LNFGVAA----VIALVHDVVITLGIFSLA-------GVTFSLPVLAAILTV
E8T6K2_THEA1          ---------FIFAVGA----VLALIHDALATTGVFMAV-------GREFSLPVIAALLTV
SECF_AQUAE            ---------PVWGFGA----ILALAHDVITVLGAYSIT-------QREVNLEVVSAILVV
D3SMD0_THEAH          ---------PVWALGA----VLALAHDVFLVVGAYSLT-------GREVNLDVVAALLVV
B4U6P7_HYDS0          ---------FLFALGG----ILALAHDVFIVVGAYSWT-------YKEVSLDVLASILVV
C0QRM5_PERMH          ---------PVFSLGA----VIPLFHDAIITLGIFALF-------GIEVNLAVIAAILTV
SECF_PETMO            ---------FSYGVGA----ILALAHDVIITLGFYSLF-------GIEMNLTAIAAFLTL
C5CF37_KOSOT          ---------FSFGIGA----IIALVHDILITLGFYSIF-------GIEINAPVVAALLTL
A7HMQ5_FERNB          ---------FSFGVGA----ILALIHDVIITMGFYSIF-------GIEMNIAAIAALLTL
A6LP85_THEM4          ---------FVFGVGA----VVALIHDVVITLGFFSFF-------NYELNVAAIAAVLTL
Q9WZW5_THEMA          ---------FIFGVAA----VVALIHDVLITMGFFSLF-------GYEINVAAVAAFLTL
B8JH53_ANAD2          ---------FRFSPGV----VIAMLHDAIMTMGYFTIS-------GREFNLTSIAVILTV
Q1D3B7_MYXXD          ---------FKFGPGA----LLSMVHDVIMVAGYYLVS-------RREFNLTAIAALLTV
E1X0T7_HALMS          ---------FKYSPGA----IVALFHDVTIILGVFAFF-------NVEFTLQTVAALLAV
Q6MKZ3_BDEBA          ---------YKFAPGA----VLCLFHDAVITLAVFVLV-------GKEVNVSILAAIMTL
A9F8C8_SORC5          ---------IRFAPGG----IVALVHDVGIALGAMVIT-------QREITLSTVAALLTI
D0LJ87_HALO1          ---------VRYAPGA----VVALLHDALLVTGVFAVT-------WTEVSLTSVAALLTV
B3T9T6_9ZZZZ          ---------FRYGTAA----VVALVHDVVIVLGVFSILGRTV---NMEVNAMFIIGVLTV
D2BGI5_DEHMV          ---------FHYGTCA----VIALFHDALVVLGIFALLAGIF---GWEINLMFVIGIMAV
A9WGQ9_CHLAA          ---------FRYGVCA----LIAMLHDVLVVLGIAAILGATI---GLEVDALFLTALLTT
A9B5U8_HERA2          ---------IRYGVCA----IIAMLHDVLVVIGMASILGWLI---GLEVDALFMTAVLTV
SECF_ANATU            ---------FRYGVCA----IIAMIHDVLVVISLVSIGGVLF---GWQVDALFLTALLSV
SECF_THET1            ---------FRYGICA----IIAMLHDVLVVVGIFAILGKHF---GVEIDALFVTALLTV
D1C4J4_SPHTD          ---------FLYGTAA----IIAMLHDVAILLGLVSILGWLR---GVEVDALFITAVLTV
B4WJX7_SYNS7          ---------FDYAILA----IVALLHDILITLGLFSILSLVT---GYEADSLFIVALLTI
SECF_ACAM1            ---------FDYALFA----IVALFHDVLVTMGFFSILGLTR---GVEVNSLFIVGLLTI
A0A0H3K5W7_SYNP6      ---------RDYALLA----ILALFHDVFITAGVFAWLGILA---GYEADSLFIVALLTI
B8HQ25_CYAP4          ---------LDYAFFA----IVALFHDVLITVGFFSILGLVA---GVEVDSLFIVALLTI
SECF_SYNP2            ---------FDYALFA----IAALFHDVLVTAGVFALLGLVL---GVEVDSLFLVALLTI
SECF_SYNY3            ---------LDYAVFA----IIALLYDALITMGAFAIFGLVG---GVEVDSLFLVALLTI
D3EPH1_ATETH          ---------IDYAFFA----ILALVHDVLITVGCFSFLGLFA---SIEVNSLFLVSLLTI
Q2JKR7_SYNJB          ---------WDYAVFA----IVALLHDVVLTIGLFALLGLTV---GMEADSLFVVALLTI
Q7NDR5_GLOVI          ---------LDYAICA----AVAMFHNVIATMGVFAILGLLL---GIEVDTLFVVAILTI
SECF_PROMA            ---------RMFSLYA----LLALFHDVLIVCGVFSWLGIIN---EVEVNSLFAVALLTI
A2CA57_PROM3          ---------RRYALLA----LVALAHDVIIVCGIFAWLGLLI---TLEVDSLFAVALLTI
Q46L53_PROMT          ---------RRYSFLA----LLALLHDILIVCGVFAWLGYFF---NVEVDSLFAVSLLTI
A5GTK4_SYNR3          ---------RLYAALA----LLALAHDVLITSGLFAWLGLFA---GVEVNSLFAVALLTL
Q7V1E6_PROMP          ---------KKYALFA----LLALFHDLFIVFGIFSWLGVLL---SIEVNSLFAVSLLTI
B5Y8Y1_COPPD          ---------FKYGLAA----VLALLHDVLVTISIFAIF-------FIPINSPFVAVLLIL
D4JXA7_9FIRM          ---------KIGGLSAGVFALVALVHDCFMVYAVFVFCR-------FPIDANFMAVVLTV
E6UEG8_RUMA7          ---------KIGGISAGIFSVVALLHDLCMVYGCFVICR-------FDINANFMAVLLTI
D4LA66_RUMC1          ---------RISGWSAGMCAILALVHDLIAAYGTFVIAG-------FEINSNFMAVLLTI
A0A2N0UMZ5_9FIRM      ---------KIGGLSAGVMALVALFHDVAMIYFMYVIFQ-------MPIDASFIAVVLMI
E1PK78_MAGIU          ---------TISGASAGIFALIALIHDVLIAFFAFVVFR-------FSLNETVIAVVLSI
E6U7Q5_ETHHY          ---------HIGGLPAGLTALIALLHDLVIAFVAFSIFR-------IPISDSFVAVALTI
A3DDV8_HUNT2          ---------IMSGLLAGFTAVVAVLHDVLMMVAVYAVFN-------IPVNESFIAAVLTI
B8I6M7_RUMCH          ---------AMSGLSAGVFAIVGVFHDLLIMLAVYVVFQ-------IPLNESFIAAMLTV
E0RMP8_PAEP6          ---------WRFAIAA----IVSLLHDAFLVISIFSIFR-------LEVDLTFITAILTI
C6D7X9_PAESJ          ---------WRMALAA----NIAILYDAFVVITMFSIFR-------LQVDLPFIAAVLTT
C0ZAP7_BREBN          ---------WLFGIAC----VVGLAHDVFIPIALFSILG-------LEVDITFIAALLTI
SECF_ALIAD            ---------FRFAISG----IIALLHDAFIVLAAFALLR-------REVDLTFVAALLTI
Q5WHQ4_BACSK          ---------FLYGVSA----VIGLLHDAFIIIALFSLFQ-------VEINVPFIAAVLTV
D6XWY7_BACIE          ---------LLYGISA----IVALFHDALLILVIFSILQ-------MEVNIPFIAAVLTI
B1YJQ6_EXIS2          ---------PLYGIAT----VLALLHDALMIIAFFSLFQ-------IEVNLYFIAAILTI
B7R9G0_9THEO          ---------FEMSLAA----VIGLLHNVFILISVYAVFR-------ITVDSPFIAALLTV
D9TNU6_THETC          ---------FEMGAAA----VLALIHDILIMISAYALLR-------IVVDTPFVAAILTV
C6PXQ6_9CLOT          ---------FTFGLAA----ILSLVHDVLIMFAFYAVFR-------IPIDSMFVAAMLTV
Q892A5_CLOTE          ---------FKFGLSA----ILALVHDILITISIYAIFQ-------IPINSSFIAAVLTI
A6LTN3_CLOB8          ---------FKFGVAA----IAATIHDILVTISVYSIFY-------IPVNTPFIAAILTI
Q97GT8_CLOAB          ---------FKFGVAA----MISLVHDVLVTLAVYGIFA-------IPLNSPFIAGMLTI
D9SMV1_CLOC7          ---------ILFGISS----IVALLHDILIVITFYSIFQ-------IQVDSPFIAAMLTV
A6TQN5_ALKMQ          ---------LTFGLAA----ITALVHDVLIVLAVYSILR-------IPVNSPFVAAILTI
E3GFZ4_9FIRM          ---------FYFGLSA----IIALLYDITIVIGVYALFQ-------IQVNAPFIAAILTI
D9TIR8_CALOO          ---------FRFGTTA----VAALIHDLLIVLTVYTLFK-------IPLNSTFIAAILTV
D9RXQ1_THEOJ          ---------FKSGVAA----ILALVHDVLVMISFYAIFY-------IPVDTTFIAAILTV
D9QVJ2_ACEAZ          ---------FKFAIAA----LMALAHDVLIVIGSFSLVG-------EEVGSPFIAALLTV
E4RIJ9_HALHG          ---------FRFAAVS----IITLMHDVLITIGIFAMLG-------REVNTPFVAALLTI
B2A264_NATTJ          ---------YRFALAA----IAAIIHDAFIVLAVFSIFQ-------IEINEPFIAAILTI
A0A1H8CTT8_9FIRM      ---------FKFGISA----VLGLAHNVIIVLGAFALTQ-------RQIDSSFVAALLTI
D1BLM5_VEIPT          ---------YKVAISA----LVAIFHDLIMVLGVFSYFQ-------LEIDASFLAAILTV
SECF_ACIFV            ---------LRFALAA----IVALIIDVMVTLTWFSVLH-------LEIDSSFVAALLTV
C8W4E2_DESAS          ---------FKQGVAA----LLALIHDVFVVTGIFSLFQ-------LEVDSYFVAAILTI
A5D3H0_PELTS          ---------FKQGVAA----IISLLHDVLVVVGIFSIFQ-------IEIDSAFIAAILTI
A4J545_DESRM          ---------FLQGISA----IGALLHDVLVMVGMASLLQ-------IEIDSTFVAAVLTI
B1I4K4_DESAP          ---------FKQGLAA----IVALLHDALITIGIFSLFW-------IQVDSAFVAAVLTI
C9R7V2_AMMDK          ---------FKQGVAA----IIGLVHDVLVVLGIFSIFQ-------LEVDSSFVAAVLTT
B0TF82_HELMI          ---------FKFAVAA----IIALLHDILVVTGLFSIFQ-------IEVDSSFVAAILTV
D5XEJ7_THEPJ          ---------FKFGIAA----IIALLHDVFVTMGIFSIFW-------WEVDSAFVAAILTI
Q2RHU7_MOOTA          ---------FLSGLAA----ILALVHDVLVTIGFFALFR-------WEVDSTFIAAILTI
D7CLE8_SYNLT          ---------FSFGVGA----IVALLYDVVLVLGVFSLFR-------LQVDGAFVAAILTI
Q0AX23_SYNWW          ---------WTFGVAA----VVALFHNVLIVLGIFSIFQ-------WELDGAFIAAILTI
SECF_SEBTE            ---------WIYALSS----VLALLHDVLVTIGFISFFQ-------FEVDTPFIAAILTI
E3CUY4_9BACT          ---------FRFGMAA----IFSLLHDVILMLGVYSLT-------GKEVGVSFIAAILTV
D5EDU6_AMICL          ---------FRFAVVS----VIALMHDTIITLGIFSLL-------GREISLPFIAAILTI
D4M8L9_9BACT          ---------FRFAVVS----VVPLVHDVLIALGFFSLT-------QMEVSSSFIAAILTI
E6SLR1_THEM7          ---------FWFAVAA----ILAMLHDVFMVVGLFALL-------QWQVDASFIAALLTV
B5H469_STRC2          ---------WTFAVAA----VAAMAQDVLLVVGLFAWL-------GKPVDSVFLAALLTV
SECF_GEMAT            ---------WRFGLAA----VLSTTHDILITLAFIKIF-------HIEVSLTVVAAILTL
Q67LL9_SYMTH          ---------FRMGVAA----VVALLHDVLLTMGVLALF-------QVEISSNFVAAILTV
C4RGU1_MICS3          --------EWRMAVAA----VSSLFMNLILTAGIYSLV-------GFEVTPSTIIGFLTI
D2S9H9_GEOOG          --------QPKMAIGA----IAALVHDIVVTAGVYALV-------GFEVTPSTVIGFLTI
D3PYP6_STANL          --------ERKMAIAA----ILALIHDLILTAGIYAIV-------GFEITPSTVIGMLTI
SECF_MYCLE            --------ERYMAISA----LTTMCFDLTVTAGVYSLV-------GFEVTPATVIGLLTI
B1MCI7_MYCA9          --------ERYMSLAA----LAALVFDLLVTAGVYSLV-------GFEVTPATVIGLLTI
Q5YTF3_NOCFA          --------ERDMAIAA----MAALVFDVGVTAGIYSLV-------GLEVTPATVIGILTI
D0LCM9_GORB4          --------DREMSIAA----LTSLFFDIVCTAGVYSLV-------GWEVTPATVIGLLTI
D6Z7I7_SEGRD          --------EVDMAVAA----IATLFFDLVVTAGVYSLV-------GFEVVPATVIGLLTI
D5UNI8_TSUPD          --------ELEMALAA----LASLFFDVIVTAGVYAWS-------GFEVSPATVIGLLTI
C3PGQ3_CORA7          --------QRDMAFAA----ILALIFDGVFIAGIYALF-------GFEVSPAVIIGLLTV
Q79VF7_CORGL          --------EREMAIAA----MAALVVDGIVIAGIYAVI-------GLEVSPATVIGLLTV
D9QAR8_CORP2          --------EREMAVAA----ITALLIDFVAIAGIYALL-------GFEVSPATIIGLLTV
C4LIX4_CORK4          --------ERDMAIAA----ISALAVDAIVVSGLYSII-------GFEVSPASVIGLLTV
Q4JVE2_CORJK          --------ERDMAAAA----IICLLIDLTVVSGIYALV-------GFEVSPATVIGLLTI
B1VDK1_CORU7          --------ERDMAISA----IIGVLIDLTVVSGIYALL-------GLDVSPATVIGLLTI
C6WCM8_ACTMD          --------ELAMAVGA----LVAVVHDVVITAGVYSLV-------GFEVSPATIIGLLTI
C7MR00_SACVD          --------EKWMALAA----LVALLHDVVVTAGVYSLV-------GFQVTPATAIGLLTI
C8XE15_NAKMY          --------EKRMAAGA----VVSVLHDLIITAGIYSLV-------GFEVTPATVIGLLTI
A0LUK2_ACIC1          --------EWKMAISA----IIALLHDLIITVGIYALV-------GFDVTPATVIGLLTI
D7BWW9_STRBB          --------EWRMALAA----LIALIHDLTITVGVYALV-------GFEVTPGTVIGLLTI
Q0RNU2_FRAAA          --------EWKMAVAA----MAALIHDLVVTMGVYSLV-------GFEVTPSTVIAVLTI
D1AEV5_THECD          --------EWRMALAA----VVALVHDLVITAGVYAWS-------GFEVTPATLLGFLTI
C7QJQ2_CATAD          --------EWKMALSG----IIALVHDLVITAGIYALI-------GFEVSPATVIGFLTI
D7BNQ3_ARCHD          --------SWAIAVGA----NGALIHDFIVTLGVYWWA-------GFEITPATVIGLLTI
D6ZHF3_MOBCV          --------TWTMSFSA----LFALLHDFLITLGVFAYT-------HIEITPATIIGLLTI
A0JXA8_ARTS2          --------TWKMSLSA----LVGMLVTMFITAGVYALS-------DFEVTPSAIIGFLTV
C5CCH8_MICLC          --------TWKMSLAA----VLGMLYVVALTAGIYGAT-------GFEITPSAIIGFLTI
D2NT09_ROTMD          --------TWKMSLAS----IAGLFFTVVVTVGLYAAF-------GFEITPSAIIGFLTI
B0REC3_CLAMS          --------TWKMSVAA----IIALLHDLVLTAGIYGIT-------GFEVTPAAVIGFLTI
Q6AFB1_LEIXX          --------TWKMSASA----IVSLFHDLIITAGIYALV-------GFEVSPATMIGFLTI
A6WCH5_KINRD          --------AWTMAVAS----LVALFHDLIITAGVYALV-------GFEVTPASVIGFLTI
D1BGW3_SANKS          --------AWRMAAAA----LVALFHDLIITAGVYALI-------GWEVTPATVIGFLTI
D1BSK2_XYLCX          --------AWRMSVAA----IVSMLFDLLLSAGVYALI-------GWEVTPSTIIGFLTI
C7MCC3_BRAFD          --------NLKASLAA----MSALIHDMLVTVGVYLVV-------GFEITPGTVIGFLTV
E6SB76_INTC7          --------TWKMALAG----LTALLHDLLITVGIYSLF-------GFEITPSSMIGFLTI
C7NI43_KYTSD          --------TWKMALAA----LVALLHDLIFTVGAFALA-------GFEVSPASVIGFLTI
Q83MZ6_TROWT          --------TWRMSLSA----IIALFHDLIITAGIYGLL-------GLEITPAAVIGLLTI
D4HDX0_CUTAS          --------HWKMSIAA----LVALLHDLIVTIGIYALV-------GFTVSPSTVIGVLTI
D7GDS8_PROFC          --------EWRMAISA----LVGLIHDLIVTVGLYALI-------GFTVTPSTLIGVLTI
D2PVF2_KRIFD          --------EPKASMAA----IIALVHDVLITIGVYALV-------GFDVTPATVIGVLTI
A1SJB0_NOCSJ          --------EWKMSVGA----IVALAHDVVITVGVYALS-------GFEVTPATVTGLLTI
C7LYS7_ACIFD          --------EWKMALAA----LIAVIHDLVVTVGIYALS-------GFQITPSTVIAVLTV
Q1AWC9_RUBXD          --------EFAFALAA----MAALVHDILMTVGFYAIV-------GREVNLVTVVAVLTV
E1QZN4_OLSUV          --------EFKMSITA----VIALLHDLLITLGVYAWT-------QTAITPNVVAALLTI
D8IEE2_BRAP9          ---------YRYAFPA----IITLIHNVVIVFGILLFL-------NKEFSVLVLSSMLTL
                                  .                                            :  

E1R5K6_SEDSS          VGYSLNDTIVVFDRIRENMGLMK-DR----P--MDVIIDTSITQSLSRTLMTSLTTL---
E0RQA8_SPITD          VGYSINDTIVVFDRIRENTQLLK-ER----P--FREIVDGSITQTLSRTLITSLTTL---
SECF_BORBU            IGYSLNDTIIIFDRIRDNVKRLT-DN----T--FLNVLNISISQTLSRTVLTSVTTF---
SECF_TREPA            IGYSINDTVVVFDRVRQTILLDP-IA----S--VTTVLDRSQTDMLTRTVVTTVTTL---
Q73PW5_TREDE          IGYSINDTIVIFDRIREKIHLEP-KL----E--CKEILDKALTEVFTRTIITTLTTM---
B0SPU5_LEPBP          LGYSINDKIVVFDRIRENAHGKD-NL----A--LSNIINVSISQTLGRTINTSFTTM---
Q72PD4_LEPIC          LGYSINDTIVVFDRIRENSAGNL-NQ----T--FGQTINSAINQTLGRTFNTSFATL---
SECF_DICTD            LGYAINDNIIVFDRIRENSKKYP-KE----D--FTIIANRSINQTLARTLYTVITTL---
B0VHR6_CLOAI          VGYSINDTIVIFDRIREDMKKNR-KD----P--IQVVFNRSINDTLSRTVITGGTTF---
A1BCH7_CHLPD          AGYSITDTVVVYDRIRERIRGQK-PA----D--YERIFNESMNQTLSRTIITSGTLL---
SECF_RHOM4            VGYSLNDTVVVFDRIREYMNIFK-TK----P--FEEVVNLSINTTLSRTIITSGTTL---
Q9WXE9_PRERU          VGYSINDKVVVFDRIRENLGLYG-KR----D--RQQLFNDSLNQTLARTINTSVTTL---
D5MHP4_9BACT          AGYSLTDTVVVFDRIRENLRDRR-KE----S--LGEIINQSINEVLSRTTVTSLTVL---
D8PI88_9BACT          AGYSLTDTVVVFDRIRENLRTRR-RE----D--EETIINQAINQVLSRTIVTSLTVV---
B6ANM4_9BACT          AGYSLTDTVVVFDRIREQLRRAS-RQ----S--MEELINQGINQVLSRTVVVSSTVV---
B5ECA5_GEOBB          AGYSLTDTVVVFDRIRENLHKYV-DD----T--KEGLFNRSINEVLPRTVITSLTTF---
B3E2R7_GEOLS          AGYSLTDTVVVFDRIRENLHKDL-KG----S--LHKIFNTSINEVLSRSIITSLTTF---
SECF_THEYD            AGYSLTDTVVVFDRIRENLGKVA-KG----TMTLEALMNKSINEVLSRTIVTSLTTL---
SECF_KORVE            IGYSMNDTIVVYDRIRENIKLLR-RE----S--LADIVNKSINQTLSRTILTSGLTF---
E8X5J9_GRATM          IGYSMNDTVVVFDRIRENLALSR-RE----P--LADVVNRSINQTLSRTVLSSGLTF---
Q029K3_SOLUE          VGYSMNDTIVIFDRIRENLKIMR-RE----P--LESLMNKSVNQTLSRTIMTSGLTF---
SECF_ELUMP            VGYSINDNIVIFDRMRENIKENP-KE----S--FYNIVNRSLNETLSRTVITGSTVL---
SECF_UNCTG            VGYSINDTIVLFDRIKENLKLLV-KE----D--FVAVINKSINEVLVRTIVTSLTVF---
D0RNY4_9PROT          VGYSMNDTVVIYDRIRENLKKD---D----KSDLLDLINISVNETLPRTLKTSITTL---
B6BPL7_9PROT          VGYSMNDTVVIFDRVRENLRKY---S----DIKIFELTNISINETLSRTIITSATTL---
B4WED0_9CAUL          IGYSMNDTVVVFDRLRENLRKY---K----TMPLREVIDLSLNETLSRTIITGVTAV---
D5VIW1_CAUST          IGYSMNEKVITFDRLKENLRKY---K----TTPLRDIIDLSENERLSRTIITGTTAL---
Q0BS57_GRABC          IGYSTNDKVVVYDRVRENLRKY---R----TMPLRELIDLSINETLNRTLGTSMTVF---
C6XJ03_HIRBI          VGYSMNDTVVVYDRVREEMRRY---K----KMSDTDVIDMSINRTLSRTLLTSGTTL---
Q0ANE7_MARMM          VGYSMNDTVVVYDRIRENLRKY---K----RKPLQEVLDLSINDTLSRTILTSVTTL---
Q0C0W7_HYPNA          IGYSVNDSVVVFDRIREIRRKY---K----QMPATEVIDIATNQTLSRTFLTGGTTL---
E2CQN2_9RHOB          IGYSLNDTVVVYDRIRENLRKY---K----KMDLPDLLDLSINQTLSRTVLTSVTTL---
A7HXL1_PARL1          VGYSMNDTVIVFDRVRENLRKY---K----KMDLGALIDLSINQTLSRTVMTSGTTL---
D8JWH2_HYPDA          LGYSVNDTVVVSDRIRENLRKF---K----KMELNQLLNLSINETLSRTILTGMTAL---
E3I015_RHOVT          LGYSINDTVVIYDRIRENLRRY---K----KMPLPQLLDLSVNETMSRTIMTVATVL---
B0UI93_METS4          VGYSLNETVVVFDRTRELMRRY---K----TMPTEELLNRSINSTMSRTVMTATSTA---
B2II62_BEII9          VGYSLNETVVVLDRIREMMKKY---R----KIPTDQLIDLSVNAVLPRTIMTATTVF---
E6VHR2_RHOPX          LGYSLNDTVVIYDRIREMLRRY---K----KMPMPQLLNESINSTLSRSIITHVTVT---
A7IND7_XANP2          MGYSLNDTVVVYDRIREMLRRY---K----KLPLPELLDIAVNATFSRTIIVSTTTF---
D5BQT4_PUNMI          AGYSINDTVVVFDRVRENLRRY---K----SYEQRDILNRSLNETLSRTVMTSVTTL---
Q2W4A8_MAGSA          AGYSVNDTVVEYDRVRENLRKF---K----TMSLYDLLNLAVNETLARTILTVSTVF---
B6ISI3_RHOCS          AGYSINDTVVVFDRMREQMRKH---K----SADLKTIINMSVNQTLGRTILTSGTTL---
Q2NBX9_ERYLH          IGYSLNDTIVVYDRIRENLKKF---R----KMPIPELLDLSVNETLARTVMTSLTLL---
Q1GSE6_SPHAL          IGYSLNDTIVVFDRIRENLKKY---R----KMEIIPLLDLSVNETLARTVMTSFTML---
D4YYJ1_SPHJU          VGYSINDKMVIDDRIRENMRKY---R----KMDMKSLIDLSVNETLPRTVMTSVTVL---
SECF_RHOCB            TGYSINDTVVVFDRLRENLIKY---K----TMPLRDVMNLSVNETLSRTVMTGMTTL---
SECF_KETVY            VGFSINDKVVVFDRVREILRRD---S----TTPLPELMVVALNETLSRTVMTTVTTI---
D0D195_9RHOB          VGYSLNDTVVVFDRVRENLIKY---K----KRPLKEVLNISINETLSRTIMTSLTTL---
SECF_RICPR            IGYSVNDSVVIYDRIRENLRKY---H----KKNITEIINLSINETLSRTILTVITTL---
A5CDU1_ORITB          IGYSVNDSVIIYDRIRENMNKNN-IS----SKPIEDIINISIRATLSRTILTVFTTL---
B9KH24_ANAMF          IGYSVNDSVVIYDRIRELARGES-VH----GKDVGGIINAGINSTLSRTLLTSGTTL---
Q2GI09_EHRCR          IGYSVNDSVVIYDRIRELLKKK---L----QKKLSDVINISINATLSRTILTSGTTM---
Q5GT97_WOLTR          IGYSINNSVVIYDRIREYQKSG---K----NRQMSDIVDASINVTLFRTVLTSGTTL---
C6V4R4_NEORI          VGYSINDSVVIFDKLRENIGIK----------NIAKRINVSVNTTLSRTVLTSVTTM---
C1D5X5_LARHH          LGYSVNESVVVFDRIRENFRKPA-MR----GHTTAEIINNAITATMSRTFITHGSTE---
B1XW93_LEPCP          LGYSVNESVVIFDRIREAFRR---YR----KMTTVEVIDHAITSTMSRTIITHGSTQ---
B6BWI7_9PROT          LGYSVNESVVVFDRVRENFKK---MR----RSSVIDVMNNAITRTMSRTIMTHLSTQ---
A5EWX6_DICNV          LGYSVNDTVVVYDRIRENFLK---TP----HKTAKEVIDASINQTMARTIVTGLTTA---
C0N4C3_9GAMM          IGYSLNDTIVVFDRIRETFLR---MR----KGSSEEIVNRALNDTLSRTMMTSLTTL---
A5CVL6_VESOH          IGYSLNDTIVVFDRIRENFLL---TH----HVESSRIINDALNQTLSRTITTSLTTL---
A1WXP7_HALHL          IGYSLNDTIVISDRIRENFLK---VR----KGTTEYVMNLAINQTLSRTLVTSLTTL---
Q31FZ8_HYDCU          IGYSLNDTIVVFDRVRENFRT---VR----DGSPETVTNLAVNQMLARTLMTSLTTL---
D3S9V5_THISK          IGYSLNDTIVVYDRIRENFRI---LR----KKGTEEVMNIAVNKTLARTIITSTTTL---
D3RSH8_ALLVD          IGYSLNDTIVIFDRVRENFRR---MR----KGTVIGIINNSINETLSRTIVTSGTTL---
C7RB48_KANKD          IGYSLNDTIVVFDRIRENFLL---MR----KATPEEVINNSINLTLSRTVMTSLTTM---
A4GK29_9BACT          IGYSLNDTIVVSDRIRENFRK---KR----RSETIALIDRSLTQMLGRTLITSLTTL---
A4GHV4_9BACT          IGYSLNDTIVVSDRIRENLRS---ME----SDSTHEIINTSLNQTLGRTLITSLTTL---
B8KFI4_9GAMM          IGYSLNDTIVVSDRIRENFRK---LR----RADPLEIVNISLSETLGRTLVTSLTTL---
Q21KV9_SACD2          IGYSLNDTIVVADRIRENFRL---IR----KGDSEEVINISLTQTLGRTMITSLTTL---
Q2SDV4_HAHCH          IGYSLNDTIVVSDRVRENFRR---LR----EETPIEIINISLTQTLSRTIVTGLTTL---
E4PKE9_MARAH          IGYSLNDTIVVADRIRENFRK---MR----VGEPWDIINESIHQTIARTINTSGTTL---
A6VYM8_MARMS          VGYSLNDTIVVCDRIRENFRI---MR----DTTPYDLVNDSINQTLGRTLITSLTTL---
E1V6F3_HALED          IGYSLNDTIVVYDRIRENIRK---SR----IDDMPAIFNEAINQTLSRTLATSGTTL---
Q0VS96_ALCBS          IGYSLNDSIVVADRIREDFRS---TR----ETDPVAIINGAVNQTFTRTINTSVTTL---
B3PDJ9_CELJU          IGYSINDTIVVFDRIRENFRI---LR----KTSSHEVINISITQTLGRTIMTSASVY---
Q8GEL5_PSEPU          IGYSLNDTIVVFDRVRENFRV---MR----KASLIENINVSTTQTLLRTIATSVSTL---
D0SG96_ACIJO          IGFSLNDNIVVSDRIRENFRK---IR----GASPLEIVNIALTETLRRTIHTSMTLL---
Q1QBR5_PSYCK          IGYSLNDTIVVYDRIRENFRR---VR----GISPRQTIDLSLTETLRRTIMTISTVL---
Q83CH4_COXBU          IGYSLNDTIVVYDRIRENFRK---VR----RGTPTEIVDLSINQTLSRTIMTSGLTL---
Q5ZU08_LEGPH          IGYSLNDTIVVFDRVRENFVK---IR----RTSPIDIMNISINQTLSRTIMTSVLTL---
A0A0B3WJC7_FRATU      IGYSLNDTVVIYDRVRENFRK---MR----NASVVEVVNRSINDTLSRTILTSGLTM---
B8L1U9_9GAMM          MGFAINDIIVVFDRVRENFRS---LR----VDS-MEVLNRSINQTLSRTVITAVMFF---
D0KW98_HALNC          AGYSINDMIVVFDRMRENFRK---IR----KGSEIEIMNASVNQTMSRTVITATTTF---
B7J4R6_ACIF2          MGYSLNDTVVVFDRMREDLRA---SR----SGDVAQIFNVAINETLSRTVITSFITF---
SECF_ECOLI            IGYSLNDSIVVSDRIRENFRK---IR----RGTPYEIFNVSLTQTLHRTLITSGTTL---
Q8D162_YERPE          IGYSLNDSIVVSDRIRENFRK---IR----RGTPYEIMNVSLTQTLSRTIMTSATTL---
Q1LSN7_BAUCH          IGYSLNDSIVVSDRIRENFRV---IS----SSNTYDLFNISITQVLNRTIITSVITM---
Q7VQA8_BLOFL          IGYSLNDKIVIFDRFRENFNN---ML----QLSSFEIINISLSQVLNRTIITSVTTM---
E8Q616_BLOVB          MGYSLNDKIVIFDRIRENFSC---MS----KLSCYAVFNRSLTQVLNRTIITSVTTI---
Q493H0_BLOPB          IGYSINDKIVIFDRIRENFYY---TP----VSKSIDIFNISLSQVLSRTIITSVTTI---
A0KJ23_AERHH          VGYSLNDTIVVFDRLRENFRK---VR----KGDTEYILDLSMTETLSRTIITSGLTF---
Q0HWQ6_SHESR          VGYSLNDTIVVFDRIRENFLK---MR----KSEPEEVVNVSITQTMSRTIITTGTTL---
C4L7L0_TOLAT          VGYSLNDTIVVFDRVRENARR---IR----NETMRNIIDISMTETLSRTLITSGTTL---
Q5QVF2_IDILO          IGYSINDTVVVCDRIRETFRK---FA----KLTPVQTVNRALTDTLSRTLITSITTI---
Q5E3D5_ALIF1          VGYSLNDTIVVFDRIRENFLK---MR----KGDSNDIINDAITQTLSRTLITSATTL---
SECF_HAEIN            VGYSINDSIVVFDRVRENFRK---IR----RLDTIDIIDISLTQTLSRTIITSVTTL---
D4ZB75_SHEVD          LGYSLNDSIIIADRIREGLRTES-G------LPIAEINDRAVKATFSRTLVTSGTTL---
C3LVV7_VIBCM          LGYSLNDSIIISDRIRELLLAKQ-Q------TPTADINDQAIIATFSRTMVTSGTTL---
E1SV06_FERBD          VGYSLNDSIVLSDRIRELLLAKP-D------WLLAKINDTAVKQTFARTMVTSGTTL---
A1S8J4_SHEAM          LGYSLNDSIIIADRIRELLLARP-K------SRLTEVNDAAIVQTFSRTMVTSGTTL---
B7VU09_VIBTL          LGYSLNDSIIIADRVREMLRGNP-N------GDTDNLLNESVKATFSRTMVTSGTTL---
B7VQK9_VIBTL          MGYSLNDSIIISDRIREVFRAKP-D------GETDALLDQSIVSTLSRTLVTSGTTL---
Q15N35_PSEA6          IGYSLNDSIVIGDKLREVMRAKT-N------MSMSDIVDTAVKSTLTRSLITSGTTL---
Q3IL51_PSEHT          IGYSLNDSIIVGDRVRELLRVKL-NA----SISVSSIINSAIKSTLTRTLITSGTTL---
A0KLF0_AERHH          IGYSLNDSIVISDRLRDLLSSRT-Q------MGIHDCSDVAIKATFSRTMITSGTTL---
Q2RTI2_RHORT          ACYSINDTVVIFDRVREELALTP-D------APLATVVNKSINRTLARTIVLSGSTL---
C5ZWZ3_9HELI          IGYSINDTIIIFDRIRETIGMR---A----SNNLKEVVNEALSATLSRTMLTSLTVF---
C3XE90_9HELI          LGYSINDTIIIFDRIREKMLEG---K----KMNANEVINEAVSSTLTRTTLTSLTMF---
E7A9U2_HELFC          LGYSINDTIIIFDRIREGMLAR---K----QQDLNPLINQAISNTLSRTLLTSLTVF---
A8ERU7_ARCB4          VGYTINDTIIVNDRIREQVQIT---K----EKDLDKIINESVSRTLSRTVLTSLSTL---
D1B3G6_SULD5          IGYSLNDTIIIFDRIREELEET---K----NMNFSEIINICVSKTLSRTTITSLLVF---
A6Q513_NITSB          LGYSLNDTIIVFDRIREGIVESV--K----LKDLNAVINESITKTLSRTTLTSLTTF---
E4U019_SULKY          LGYSIHDTIIVYDRIREHIQES---K----NSDFVMIVNEAVSRTQSRTTLTSLTVF---
A7ZE41_CAMC1          LGYSLNDTIIIFDRIREGIKES---K----RTDIEGVINESVSATLSRTILTSATTM---
E1YHR4_9DELT          IGYSLNDTIIIFDRIRENLPKHR--K----IS-LAAVINKSVNETLSRTILTSGLTL---
A8ZW13_DESOH          IGYSLNDTIIVFDRIRENLKKLS--R----KS-LPDIINTSINETLSRTLLTSGTTL---
B8F9E2_DESAL          VGYSLNDTIIVFDRIRENKTRHS--R----RA-LDFIINRSINETFSRTLLTSLTTL---
E1QIL9_DESB2          IGYSLNDTIIVFDRIRENLTKSG--G----GGDLAQTINASVNQTLSRTILTSGTTL---
C7LN35_DESBD          VGYSLNDTIIIYDRIRENIRAK---V----SPSLDVVINKSVNQTMSRTLITAGTTF---
C4XR64_DESMR          LGYSLNDTIIVYDRIREKLRTTD--K----SVPFEQVINQSINETLSRTILTAGTTL---
C8X141_DESRD          IGYSLNDTIIVFDRIRENLRGKAA-K----HRSLKETINISINQTLSRTILTSGTTL---
B8J2Q5_DESDA          VGFSLNDTIIIYDRLRENLRATPE-------LDMAHLINKSVNQTLSRTILTSGTTF---
A0A0H3AA07_DESVV      IGYSLNDTIIVYDRIRETLRTNPD-------DPFDVIINRSINQTLSRTILTGGTTL---
Q1MSC2_LAWIP          VGYSLNDTIIVYDRIRENLQEQKQKN----YLPLSNIINLSINQTLGRTIMTSFTTF---
Q3A3C5_PELCD          IGYSLNDTIIVYDRIRENCAKST-------KEEFPTRVNASINETLSRTILTSGTTL---
Q2LVH3_SYNAS          IGYSINDTIVIFDRIRENTRKNM-------KMPLMDVINLSVNQTLSRTLLTSFTVI---
SECF_CALNY            IGYSLNDTIVVFDRIRERIKATA-NE----KINIKDIMNKSINETLSRTIITSLLTF---
D4H482_DENA2          VGYSLNDTIVVFDRIRENMQED--KT----DMDLKKLINKSLNETLSRTVLTSLTTL---
SECF_MAGMM            VGYSLNDTIVVYDRIREEMKRM---K----RQPLATIINEAVNRTLSRTLITSLTTV---
SECF_DESIS            IGYSLNDTIVVFDRIRENLYIPEGKE----KPSIISIINTSITETLSRTILTSGTTL---
E8T6K2_THEA1          IGYSINDTIVVYDRIRENMKVYLR-S----KP-FEEIVNDSINQTLSRTIITSLTTL---
SECF_AQUAE            AGYSVADTVVIFDRIRENLRKKK-------GFTLEEIMDLSINQTLSRTIMTSLTTL---
D3SMD0_THEAH          AGYSISDTVVVFDRIRENMRIRK-------GTDLKTVINISINQTLSRTVMTSLTTF---
B4U6P7_HYDS0          AGYSITDTVVVFDRIRENLKLRK-------GMDLSEIINLSVNQNIVRTIMTSSTVF---
C0QRM5_PERMH          LGYSLNDTIIIFDRIRENIKIRG-------KKNLQLLVNQSINENLARTIITSGTTL---
SECF_PETMO            AGYSLNDTIVVYDRIRENRSKNR-------GMDIESITNKSINEVIVRSLNTSLTTF---
C5CF37_KOSOT          LGYSLNDTIVVYDRVRENLRKLR-------GKSIEEIVNRSINEVIVRSLNTSLTTF---
A7HMQ5_FERNB          VGYSVNDTIIVFDRIREFGKKFR-------GKDIATIVNDSINSVLVRTINTSLTTF---
A6LP85_THEM4          IGYSLNDTIVVYDRIRENLKRTR-------GKSIENIVNDSINQVIKRTINTSLTTF---
Q9WZW5_THEMA          LGYSLNDTIVLSDRIRENMRRYR-------GRNMVNIVNMSINQVLARTINTSLTTF---
B8JH53_ANAD2          VGYSVNDTVVIYDRIRENQAKLR-------GRSLSDIVNLSINEVLGRTFLTSFATA---
Q1D3B7_MYXXD          VGYSVNDTIVIYDRIREDMAKYK-------GKPFAEVINIAINDTLGRTILTSGTTA---
E1X0T7_HALMS          IGYSVNDTVIVYDRVREHEEKNS-------ALDLASHINNAVNETLSRTIMTSLTTL---
Q6MKZ3_BDEBA          IGFSLNDTIVVFDRIREVDTGNH-------DKGFKFVINKSINEMLVRTLITSGTTF---
A9F8C8_SORC5          VGYSITDTVVVYDRIRENLGKHR-------DMSFAAVINFSLSEMLGRTILVSLTTL---
D0LJ87_HALO1          IGYSVNDTVIIFDRIRENAERLK-------DKRLERVVNISLNETLSRTLLTSLTLF---
B3T9T6_9ZZZZ          IGYSVNDTIVVFDRVRENV-LRYQGA------TIVEMVNLSIRETVGRSFNTSITLL---
D2BGI5_DEHMV          IGYSINNTVVVFDRIRENQ-LKGIHP------SFEVIVNQSIMETIVRSINSSFTVI---
A9WGQ9_CHLAA          LSFSVHDTIVVFDRIRENLINRHPAE------TFDDIVNHSLVQTLPRSINAQLTTF---
A9B5U8_HERA2          ISFSVHDTIVVFDRVRENV--RRSSD------DYERVVNRSIVQTLTRSINTQFTSF---
SECF_ANATU            IGFSVQDKVVVFDRIRENS-QIYRKL------DFEKLANHSIVQTLQRSINTQLMTVE--
SECF_THET1            IGFSVHDTIVVFDRIRENQ-LRRYGE------SFEQIVNISLLQTLVRSVNTSMTVI---
D1C4J4_SPHTD          IGFSVHDTIVVFDRIRENL-AHKVGE------TFEETVNYSVVQTLVRSLNTSITTI---
B4WJX7_SYNS7          VGFSVNDTVVIYDRIRETLQRTPE-R------SINQIVEEAVNSTLGRSINTTLTTV---
SECF_ACAM1            IGFSVNDTVVIYDRVRENLKYGAK-R------SISETVDIAVNQTLGRSINTSLTTG---
A0A0H3K5W7_SYNP6      TGFSVNDTVVIYDRIRETNSLFPE-D------DIDEIVDLSVNQTLGRSINTTLTTL---
B8HQ25_CYAP4          VGFSVNDTVVIYDRVRENLKLYPE-R------SISETVDAAVNQTLTRSLNTTLTVL---
SECF_SYNP2            IGFSVNDTVVIYDRVRENLKADEG-D------NIDQVVDHSVQQTLGRSINTTLTTL---
SECF_SYNY3            IGFSVNDTVVIYDRVRETLERHSD-W------DINHVVDDAVNQTLTRSINTSLTTS---
D3EPH1_ATETH          IGFSVNDTVVIYDRIRENIDRFSEEL------PLSEIVNKSVNQTLARSINTTATTL---
Q2JKR7_SYNJB          IGFSVNDTVVIYDRIRENLRLVSRKV------SLAEVVNLSLNQTFARSLNTTLTTM---
Q7NDR5_GLOVI          VGFSVQDTVVVFDRVRENLKFLSRKK------PFPDIVNDSVNQTWVRSVNNNIAAL---
SECF_PROMA            AGYSVNDTVVVFDRIREINK-QESRM------NFKQKVDFAVSATLTRTLYTSGTTL---
A2CA57_PROM3          AGYSVNDTVVVFDRIRERSR-EDDSL------PLTEQVDRAVSATLTRTLYTSGTTL---
Q46L53_PROMT          AGYSVNNTVVVFDRIREKSL-IENQL------SYKYQIDKAVGATLTRTIYTSLTTL---
A5GTK4_SYNR3          AGYSVNDTVVVFDRIREQQR-LLPDL------SVEDQVDRAVDGTLTRSIYTSLSTE---
Q7V1E6_PROMP          AGYSVNDTVVIFDRIRENLK-KDSD-------NYNKIIQISVNESFRRTFFTSITTL---
B5Y8Y1_COPPD          VGYSLQDSIVVLDRVRENRK-LNSKA------STAEVVESAIHSVFRRSLNTSITTL---
D4JXA7_9FIRM          LGNSINNTIVVYDRIRENRNLYGNSL--SLKELVNMSITQSITRSVNTTVTTAFAVL---
E6UEG8_RUMA7          LGYSINATIIIYDRIRENQNLKGSKL--ELEELVNLSVTQTLGRSIHTTVTTVMAMS---
D4LA66_RUMC1          LGYSVNNTMVIYDRIRENQKLMDKKT--SIRELVNTSISQTMSRSIRTSVTTISTML---
A0A2N0UMZ5_9FIRM      LGYSLNDTIVIYDRVREEKKLVGSKT--DVGKIFNLSCTKCIKRTIMTSVTTLSAIL---
E1PK78_MAGIU          LGWSVNDTIVIFDRIRENERLYGGKM--TLPDLVDMSINQSFTRTLNTSICSFVAIL---
E6U7Q5_ETHHY          LGYSINDTIVVYDRIRENRGLFGRSM--KFKDIVNRSINQSFTRSINTTLVTFLAIA---
A3DDV8_HUNT2          LGYSVNDTIVIYDRIRENSRIS-RKD--SIRTIVNNSITQSMSRTINTSVTTLISVI---
B8I6M7_RUMCH          VGYSMNDTVIIYDRIRENNRLL-RKI--PLPELVNSSIIQTLNRSINTVVTSLIAIT---
E0RMP8_PAEP6          VGFSINDTVVIFDRIRENLRFAKK----KSRDDLEQVVDHSIAQTMTRSLATVFTVF---
C6D7X9_PAESJ          IGYSINDKIVIFDRIRENLRFSKT----KNADQIGDLVNQSLWQTMARNIYTVLAVL---
C0ZAP7_BREBN          LGYSINDKIVIFDRIRENLRTMKS----KTIPELEHLVNVSLWQTMRRSVYTVATVF---
SECF_ALIAD            VGYSINDTIVIFDRIRENLKIDKP----ETVDELRAVVNKSLWQVMNRSIRTVLTVL---
Q5WHQ4_BACSK          VGYSINDTIVTFDRMRENINKEKE---IKSFEHLAQIVNKSLLQVLTRSINTVLTVL---
D6XWY7_BACIE          VGYSINDTIVTFDRIRENMSYEKK---LKGFEDVARVVNKSLVQTLARSINTVLTVL---
B1YJQ6_EXIS2          IGYSVNDTIVTFDRVRENLAHAEKGGRQVTFSELSHIVNESIQQTIIRSINTVVTVI---
B7R9G0_9THEO          FSYSLHDTIVIFDRIRDNLKVMRRA-------DYAEVANVSVNQTLVRSINVVLTVL---
D9TNU6_THETC          FGYSINDTIVIFDRIRDNIKLMRKS-------SYKEIANVSVNETMTRSINTVMTVL---
C6PXQ6_9CLOT          IGYSINDTIVVFDRIRENHKYMRGS-------SVVELSNASITQTLARSINTVLTVL---
Q892A5_CLOTE          VGYSINDTIVVFDRIRENSKRNRKA-------NEVEIANISIAQTMTRSINTSLTTL---
A6LTN3_CLOB8          VGYSMCDTIVIFDRIRENTKIMRRA-------KSIEVADVSLTETIARSLYTSSATV---
Q97GT8_CLOAB          VGYSMSDTIVVFDRIRENSRKHRRM-------STSEIADFSINETLTRSIYTVLTVL---
D9SMV1_CLOC7          LGYSMNDTIVVFDRIRENLKNAKKSD------TYADIADTSIKQTIHRSILTVTTTL---
A6TQN5_ALKMQ          LGYSINDTIVVFDRVRENVKHMKKS-------NFAQVANDSISQTVVRSINTSVTTL---
E3GFZ4_9FIRM          LGYSINDTIVVFDRIRENETRIGMR-------DINELVNVSVSQTLKRSINTVVTTL---
D9TIR8_CALOO          LGYSINDTIVVFDRIRENRRIAGKM-------ELKDLVNLSMNQTIGRSIATAMSVI---
D9RXQ1_THEOJ          VGYSINDTIVIFDRIRENLKIMGKA-------SFNEIANTSIVQTLARSINTSITTL---
D9QVJ2_ACEAZ          VGYSINDTIVIFDRIRETVKYRDKE-------SFADLNNKAVLDTLPRSINTSMTTL---
E4RIJ9_HALHG          VGYSINDTIVIFDRIRENMKLMHKV-------PFIEQANTAVVDTLPRSINTSITTL---
B2A264_NATTJ          IGYSVNDTIVVFDRIRETLKFEKKL-------TLFETIQISIKRTLKRSLCTSITTL---
A0A1H8CTT8_9FIRM      IGYSINDTIVIFDRIRENLKLHFRKNG-----DIVELVNTSIYQTMTRSIYTVSTVL---
D1BLM5_VEIPT          VGYSMNESVVIFDRVRENTHTHKRSD------TFADLANASITQSIHRSFYTLATVM---
SECF_ACIFV            VGYSVNGTIVVFDRIRENLHTHRRNE------SMGDLVDASIWQTMTRSVYTTLTTL---
C8W4E2_DESAS          IGYSINDTIVIFDRIRENMLSRKKGQ------SLEELVNSSLWQTMARSINTVMTVI---
A5D3H0_PELTS          IGYSINDTIVIFDRIRENLLNKKKGD------ALEDIINASLWQTIARSINTVLTVE---
A4J545_DESRM          IGYSINDTIVIFDRIRENMRKSRK-E------DLADLVNKSLWQTMARSINTVLTVV---
B1I4K4_DESAP          LGYSINATIVIFDRIRENAKAAKKTE------PLEDVVNRSLWDTMARSINTSVTVM---
C9R7V2_AMMDK          LGYSLHDTVIVFDRIRENIKIRKLSE------PLADVINLSIWQTLTRSINTVMTVL---
B0TF82_HELMI          FGYSINDTIVIFDRIRENLRKKKKDE------NLDALVNRSVKETLTRSINTVLTVI---
D5XEJ7_THEPJ          IGYSINDTIVIFDRIRENLHRKKKDE------NFEELVNKSIMQTMARSINTVLTVI---
Q2RHU7_MOOTA          IGYSINDTIVIFDRIRENLRLRKK-E------TIEEVVNRSINQTLTRSINTVLTVI---
D7CLE8_SYNLT          LGYSINDTIVVFDRIRENLGFKKK-G------DLAETINKSIMQTLNRSINTVLAVV---
Q0AX23_SYNWW          VGYSINDTIVIFDRIRENLRLKTR-D------DLTTLLNKSIMQTMNRSVNTVLTVL---
SECF_SEBTE            LGYSMNDTIVIFDRIRENDHKYGGKK------PFADVIDESVNKVFIRSVYTSLTTL---
E3CUY4_9BACT          VGYSLNDSIVVLDRVRENWKELRGKG-------IVDLVDESVNQTLSRTINTSLTTL---
D5EDU6_AMICL          VGYSLNDTIVVFDRVRENWKYLRQEG-------LLEVLDMSINQTLSRTINTSLTTF---
D4M8L9_9BACT          VGYSLNNTIIILDRIRENWRDLGRDG-------IEKLVNDSVNQTLARTINTTLTTL---
E6SLR1_THEM7          FGYSINDTVVVFDRIRENLRLRRKEP-------LDELVDRSIRQVLRRSILTGTTTL---
B5H469_STRC2          VGYSVNDTVVVLDRLRELRRSAPRGT-------WPELADRAVAQTLPRTVNTGMGAL---
SECF_GEMAT            VGYSANDTIIIFDRVRENLKKPHKGE------TLSHILDRSINETLPRSIMTHTTTF---
Q67LL9_SYMTH          LGYSMNDTVVVLDRLRENLHSRQKGE------SLEEMATRSIQEVITRSIYTGVSVQ---
C4RGU1_MICS3          LGFALYDVVVVFDKVQENTRGITANNN----QTYGEAANLAINQSLMRSLNTSVVALLPV
D2S9H9_GEOOG          LGFSLYDTVVVFDKVDENVKDLDRSAR----MTWGEAANLAVNQTLMRSINTSVIALLPV
D3PYP6_STANL          LGYSLYDTVVVFDKVHENTRGVLSQQR----YTYGESANLAINQTLMRSINTTLIGLLPV
SECF_MYCLE            LGFSLYDTVIVFDKVEENTHGFQHTTR----RTFAEQANLAINQTFMRSINTSLISVLPV
B1MCI7_MYCA9          LGFSLYDTVIVFDKVEENTHGFQHTSR----RTYAEHANLAVNQTFMRSINTSLISAIPV
Q5YTF3_NOCFA          LGFSLYDSVVVFDKVEENTRGILHLNR----RTYAEQANLAVNQTLMRSINTALIGILPI
D0LCM9_GORB4          LGFSLYDTVVVFDKVSENTRSVLQTSR----RTYGEQANLAINQTLMRSINTTVISVLPI
D6Z7I7_SEGRD          LGFSLYDTVVVFDKVSENVRGVTKTTR----RTYAELANLAMNQTMMRSINTTVIGVLPV
D5UNI8_TSUPD          LGFSLYDTVVVFDKVEENVRGVLHTNR----RTYAEQANLAVNQTLMRSINTTVISALPI
C3PGQ3_CORA7          LTFSLYDSVIVFDKVDENTTGLEGQRK----KTYAELTNLAVNQTVMRSISTSVISALPI
Q79VF7_CORGL          LTFSIYDTVVVFDKVRENTEGFEGSRR----RTYAEQANLAVNQTFMRSISTTIISALPI
D9QAR8_CORP2          LAFSLYDTVIVFDRVRENTAGYLGNRS----RTYAEHANLAVNQTVMRSISTTVISALPI
C4LIX4_CORK4          LSYSLYDTVVVFDKVHENTAGLTKTTT----STYAEQANLAVNQTMMRSISTSLFSILPI
Q4JVE2_CORJK          LAYSLYDTVVVFDKVHENTAGLFGSTR----ATYAEETNLAINQTIMRSINTSIFSLVPI
B1VDK1_CORU7          LAYSLYDTVVVFDKVQENTAGLFDSNR----ATYGEQVNLAINQTVMRSINTSIFSLVPI
C6WCM8_ACTMD          LGFSLYDTVVVFDKVRENTRGILGLTR----RTYGEATNLAVNQTLMRSINTSLIALLPV
C7MR00_SACVD          LGYSLYDTVVVFDKVKENTRGILNLTR----RTYAEAANLAVNQTLMRSINTSVIALLPV
C8XE15_NAKMY          LGFSLYDTVVVYDKVQENTKGLTSLNR----RTYPEAANLAINQTLMRSINTSLIALLPV
A0LUK2_ACIC1          LGYSLYDTVVVFDKVRENTRGIAGGSR----MTYSQAANLAVNQTLVRSINTSVIALLPV
D7BWW9_STRBB          LGYSLYDTVVVFDGLKEASKDLTKQTR----FTYSEIANRSLNSTLVRSINTTVVALLPV
Q0RNU2_FRAAA          LGFSLYDTVVVFDRVRENTAGMATSHR----RTYAEATNDALNETLVRSLNTSLIALIPV
D1AEV5_THECD          LGYSLYDAVVVFDMIKEVTRDLGAPGKL---KTYTQAADEALSRTLVRSLNTSLVAILPV
C7QJQ2_CATAD          LGYSLYDTVVVFDKVRENTKGLGTTKTD---LSYTQSANLAVNQTLIRSLNTSLIALIPV
D7BNQ3_ARCHD          MGYSLYDTVVVFDKVRENTEHITNQHT----YTYEETANQAMNQTLIRSLNTSITGLLPV
D6ZHF3_MOBCV          LGYSLYDTVVVFDKIRENTRDMFNQSR----SKYNELANLSINQTMVRSINTSITGILPV
A0JXA8_ARTS2          LSYSLYDTVVVFDKIRENTADIDASTR----RTFAEEVNLAVNQTLVRSINTMMVAILPV
C5CCH8_MICLC          LSYALYDTVVVFDKIRENTIGAGEDPE----RSFVENVNLAVNQTLVRSITTSVVGILPV
D2NT09_ROTMD          LSYSLYDSVVVFDKIRENTDGVLERRD----TTFAEQINLAVNQTLVRSINTAIVGVLPV
B0REC3_CLAMS          LGYSLYDTVVVFDKIRENTAEDGQESR----RTFAQSVNLAVNQTLVRSINTSIVAILPV
Q6AFB1_LEIXX          LGYSLYDTVVVFDKIRENTKEEMDLTR----RTFAESVNLAVNQTLVRSINTAVVAVLPV
A6WCH5_KINRD          LGYSLYDTVVVFDKVRENTEAAFAKKD----RTFRDAANLAINQTVVRSVNTTVVALLPV
D1BGW3_SANKS          LGYSIYDTVVVFDKVRENTADITKQTR----STYAERANLAVNQTLVRSINTSVVALLPV
D1BSK2_XYLCX          LGFSLYDKMVVFDKVRENAEGVLDQRR----TTYGERANLAVNQTLVRSINTSVVALLPV
C7MCC3_BRAFD          MGYSLYDTIVVFDKVRENTAGLRRQTR----TTFADEVERAANQTLVRSINTSVVALLPV
E6SB76_INTC7          LGYSLYDTVVVFDKVRENTAEAFRTKR----MTYNQAANLAVNQTLVRSINTTVVALLPI
C7NI43_KYTSD          LGYSLYDTVVVFDKVRENVDDARKHKT----KTYSQAANMAINQTLVRSINTSVVALLPV
Q83MZ6_TROWT          LGYSLYDTVVVFDRVRENRA--LDPTC----SDYKGIVNRAVNQTFVRSINTSLIAVLPV
D4HDX0_CUTAS          LGYSLYDTVVVFDKVRENVQDIDKRDY-----TFAEGANRAVNQVLVRSINTTIVGVLPV
D7GDS8_PROFC          LGYSLYDNVVVFDKVRENTVDITKQDR-----TFSEAANAAVNQVLVRSINTTVIGVLPV
D2PVF2_KRIFD          LGYSLYDTVVVFDKVRENTRGITGSNR----QTYSDAANLAVNQTVVRSINTTLIALMPV
A1SJB0_NOCSJ          LGFSLYDTVVVFDKVRENTKNLR-ESR----TTYAKAANLAVNQTLVRSINTSVVALIPV
C7LYS7_ACIFD          LGYSLYDTIVIFDRIKENVATHVDQAGE---MTYSEVVDRSVNQMLARSINTSVVAVIPI
Q1AWC9_RUBXD          LGYSLYDTVIIFDRIRENSPSVGYNRR-----RFDEVINTSIRQVIRRSIYTSVSTLIPI
E1QZN4_OLSUV          MGYSLYDTVVEFNRMNENAKQLKDGVH----RTYYQICNFSINEVFVRTINTTITSLVPV
D8IEE2_BRAP9          IGYTINDIIVVFDRIRENADVKR---------PFKEIVNISLNNVVGRTVITSVSTL---
                         :    ::  :   :                                           

E1R5K6_SEDSS          --LAVLALYFFG-TGAIKDFALNLIVGIV-VGTYSSIFIASPVLLGITRASDKRKAKKLG
E0RQA8_SPITD          --LAVLAIYIFT-TGDIKLFAFNLIVGIL-VGTYSSIFIASPVMMWIRNARHREEEEMKE
SECF_BORBU            --VAVFSIYVFT-EGSIKDFSLVFMVGVI-VGTYSSVFIASPILLNLYKKIK--------
SECF_TREPA            --LAALMLYVFT-EGGSRDFSLALMVGMV-SGVYSTIYIAGGCIALISRGKSGGQLLGL-
Q73PW5_TREDE          --VAVVALYLFT-TDSMKDFALALIVGLI-SGTYSSIYVASYFIALTSKGKKAGEMITRG
B0SPU5_LEPBP          --ISVVAIIVGG-AAELYDFAFILLFGVI-VGTYSSIYIAAPISEIYDRLRKKRFA----
Q72PD4_LEPIC          --ISIVAIIIGG-ATELFDFAYVLTFGIV-IGTYSSIFIAAPLVDIYDQVIRKARD----
SECF_DICTD            --LAITPLLIWG-GVVLRPFILAIYLGII-IGTYSTIYIASAILCEWRELQK--------
B0VHR6_CLOAI          --LTSACLFLWG-GSVIHDFALAICLGIL-FGTYSSIFVASNLVIDLNLITHKERKTMQH
A1BCH7_CHLPD          --ISVLVLFVFA-GPAIRGFAFAVFMGVF-IGTYSSIFVAAPIVYDWLKLTKSSVKLRGG
SECF_RHOM4            --LVVVILFIFG-GEVLRGFSFALIVGIV-IGTYSSIFVASPVVIELRARAAARRRLATA
Q9WXE9_PRERU          --IVLLAIFILG-GDSIRSFSLAMILGVV-FGTLSSLFIAAPTAFLWMGRTIKEDDVEVA
D5MHP4_9BACT          --LVLLALFLLG-GEVLHDFSLALIAGVC-VGTYSSWFVASPIVYEWRIREHA-RVKTPV
D8PI88_9BACT          --IVLIPLVLAG-AEVLHDFSLALLGGVM-FGTYSSVFVASPLLLLWPGSAGG-LMKRR-
B6ANM4_9BACT          --LVLVALFFFG-GPVIHDFSLALLLGVV-IGTFASIFVASPLLLVIPKGKKS-TLVTSR
B5ECA5_GEOBB          --LAAISLFLFG-GEVIHDFALALVAGIV-IATYSSIFIASPIVAVLEARRGGWELADGD
B3E2R7_GEOLS          --LAAIALFVWG-GEVIHDFSFALLVGII-VGVYSSVFVASPVVLLLEQR----AMNKQD
SECF_THEYD            --MAAVALFFFG-GEVLHDFALAMILGIL-VGTYSSIFVASPVVLLLGKN----SLIKR-
SECF_KORVE            --LTVLSLYVFG-GEVLRGFSLALVIGIL-IGTYSSIAVAAPMLVAYQEWRGHRGTAALP
E8X5J9_GRATM          --LTVLSIYLFG-GEVLHGFSFALVVGIL-IGTYSSIAVAAPMLVAWQDWRAKQGKASAT
Q029K3_SOLUE          --LTVIALFIWG-GPVLHGFSFALVCGII-VGTYSSVFIASPIVLFWHNYTDSRRKTAPA
SECF_ELUMP            --IVLVIIYFFG-GEVLKNFSLIMLIGVI-VGTYSTLFIATPIVYDWAKDSDNFAKTVGN
SECF_UNCTG            --IVACSLFFFG-GEVMHTFAYIMIIGTV-LGVFSTIFVCAPLICEWRIKTNKRLKIAIK
D0RNY4_9PROT          --LALIAIYFFG-GEILRGFSFALIWGVI-VGTYSSIFIAAPLILIFNVKRDWNEV----
B6BPL7_9PROT          --LALLAIYFFG-GEILKGFSLAMILGVI-FGTYSSIYIANTVLVRLRVSQKTVLR----
B4WED0_9CAUL          --MVLAALAIFG-GEALFGFSIALMFGII-IGTYSSIYVGAPIILLWGVKRGALAD----
D5VIW1_CAUST          --LALGGTMVFG-GPVLFPLVFTMVFGII-IGTYSSIYIALPLILVWGVKRND--D----
Q0BS57_GRABC          --LASLPLALFG-GESLSGFAWTMLFGIV-VGTSSSIFIAAPILLLLGEHRLRRDT----
C6XJ03_HIRBI          --LALFSIFLLG-GEVLRGFSFAMIWGVF-IGTYSSIFIASAILLHTGLRRGSIGG----
Q0ANE7_MARMM          --VALISLYLIG-GTALKGFAFAMIWGVM-IGTFSSIFVAAPILLFTNVQR---------
Q0C0W7_HYPNA          --IAILAIAIFG-GPVLQGMSVAMIWGII-IGTYSSIYFAAAIVLMLGVDINR-------
E2CQN2_9RHOB          --LALISLYVFG-GEVIQSFTLAMIFGIL-IGTYSSIFLAAPFLIILKLRTGGTSG----
A7HXL1_PARL1          --LALLALFIFG-GEVLRDFTFAMIFGIF-IGTYSSIFIAAPVLLTVGVTRDASTG----
D8JWH2_HYPDA          --AVLISLYVFG-GEVIRNFNLAMLLGVV-IGTYSSIFIAAPLLGYLGVKRDWSDL----
E3I015_RHOVT          --MALIPLYIFG-GEVIRGFTFAMIFGTL-IGTYSSVYIAAPFLILIGVKRDWSGV----
B0UI93_METS4          --LSLVALVLFG-GEAIKGFSVVMLIGVV-ICTYSAIFISSPFLIYIGLQAGGG------
B2II62_BEII9          --LALLSLVIFG-GQVIRSFSLAMIWGIV-VATYSSVFICSPMLIYLGLRNEGG------
E6VHR2_RHOPX          --LALLALLVFG-GNAIHSFTAVMMFGVVLVGTYTSIFIAAPILIYLGVGSHRLDDPDEK
A7IND7_XANP2          --FATLALYFFG-GEVLRGFSLAMTVGVV-IGTYSTIFVAAPILIHLGLRSSTVAGPAK-
D5BQT4_PUNMI          --LALTAIVIFG-GAVLRDFALAMIWGVI-IGTYSSVFIAVGMLSRFDLK--RVDDD---
Q2W4A8_MAGSA          --VTVLALLFVG-GEVLRGFSIAMLWGLI-IGTFSSIYVAMPMLIYFNLRTGKAAEE---
B6ISI3_RHOCS          --LAILPLLLFG-GSALHNFTLALFWGIL-VGTFSSIYVAASILLYLPAIRRGGESV---
Q2NBX9_ERYLH          --IALLPLLLFG-PASLFGLVAAITLGIF-VGTYSSVYMAAPILIWLGVDSDSFVPQ---
Q1GSE6_SPHAL          --IALAVLLWVG-PDVIFGFTAAMLLGIF-VGTYSSVYMSAPILVWLKVGPHSFVPRTT-
D4YYJ1_SPHJU          --LALGALLLLG-GHVLRGFTAAMMLGII-VGTYSSVYVSSSLLISLGLSPATAEKKASK
SECF_RHOCB            --LALVPMLIWG-GDVIRGFVFAMVWGVF-TGTYSSVYVAKNIVLFIGLDRNKEKKD---
SECF_KETVY            --LALVALYIWG-GDVIRGFAFAMLFGSV-IAVYSTIFVSAQVVLWLGVKRDWEKKTDTG
D0D195_9RHOB          --LALFALFALG-GDVIRGFVFAMIWGVF-VGTYSSIFVASALLLWLGVKRDWSKPDAEA
SECF_RICPR            --LANLALILFG-GKAIHSFSVLVFFGII-AGTYSSIFISAPILTMFANRKFNKKVITQG
A5CDU1_ORITB          --LANLALILFG-GAAIKSFSILVFIGII-VGTYSSIFVSAPILMLF-NIQHQKKL----
B9KH24_ANAMF          --LAAVPLILLC-EGAVHDLGVIVFFGVI-VGTYSSIFISTVPFVSGAQKVLKRKNEENP
Q2GI09_EHRCR          --LASVPLMLLC-QGTVRELSIIVFFGIA-VGTYSSIFIATTSLSNDINKT---------
Q5GT97_WOLTR          --LATIPLTLIC-TDTVRDFSLIIFFGIL-IGTCSAIFISAPILTCKVLISRIAV-----
C6V4R4_NEORI          --LAIAPVAFLS-SGDIRVFSLIILAGIA-IGTYSSIFIAAPLALLGKNVHEVTHENS--
C1D5X5_LARHH          --TMVLAMLLFG-GPALHGFAMALTIGIV-FGIYSSVLVASPIALALGVKREHMIK----
B1XW93_LEPCP          --MMVLSMLLFG-GPTLHYFALALTIGIL-FGIYSSVFVAAAIAMWLGVKREDLVS----
B6BWI7_9PROT          --TVVISMLIFG-GEILHNFSLALTIGIL-FGIYSSIMVGCPMALWLGTNHSNLAG----
A5EWX6_DICNV          --LAVISLLFFG-GSTLFGFSAAMLVGIV-FGSYSSIFVASAIALKLGVSPRDLMP----
C0N4C3_9GAMM          --LVVLALFSFG-GEVIHAFSIALLLGII-IGTYSSIYIASNTILAMGVSKEDLLP----
A5CVL6_VESOH          --LVLLALFFLG-GEIIHNFSLALLIGVV-IGTYSSIYVASLMILELGITKENLFS----
A1WXP7_HALHL          --LVVGSLLFLG-GEIIHGFAMALLVGVL-VGTYSSIFVASASSLAMGVSKQDLMP----
Q31FZ8_HYDCU          --LVLVALFVLG-GEIIHNFALALIVGVV-VGTYSSTFVASSIALALGVSKEDLMQ----
D3S9V5_THISK          --LVLFALAFLG-GAALQNFSIALIIGVI-VGTYSSIFIAATAALLLGVDRQVLLP----
D3RSH8_ALLVD          --LVLVALYFLG-GETINGFALALIIGIL-VGTYSTIYVATAIVVWLGLSRDDLLP----
C7RB48_KANKD          --LVLLALFFFG-GQTIHSFAEALIVGIL-VGTYSSVFIASPTTLALGITKEDLMP----
A4GK29_9BACT          --LVLFALLIFG-GDAIQNFSIALIIGVI-AGTYSSIYIVCNTLISMNITADDLAI----
A4GHV4_9BACT          --LVLFSLYFLG-GELIKNFALALIFGVI-VGTYSSIYIAANALIMMGLNKDHLRV----
B8KFI4_9GAMM          --LVLLALALYG-GEMIFGFAVALLVGVV-IGTYSSIYVASNVLLSMGVSKEDLMI----
Q21KV9_SACD2          --LVLLALFFVG-GEMIHNFALALIVGVV-IGTYSSIYVSANILMAMHIDREDLIP----
Q2SDV4_HAHCH          --LVLVALFLFG-GPALKGFSTALIIGII-VGTYSSIYVASNLLLIMNISKEDLMI----
E4PKE9_MARAH          --VVLLALYFLG-GEAINNFALALIIGVV-VGTYSSIYVSANLLMVMGVSRDDLIV----
A6VYM8_MARMS          --FVLVVLFFSG-GEAIHNFAMALLVGIV-IGTYSSIFVAANLLLAMGVKREDLIP----
E1V6F3_HALED          --LVVLALMILG-GDMIHYFAVALFIGIA-VGTFSSIYVSAALLLPLKLQRADLMP----
Q0VS96_ALCBS          --LVLVALYFFG-GEVMRAFSEALLVGVL-VGTYSSIYVVSNILFMMKVSKEDFMI----
B3PDJ9_CELJU          --LVLFSLYFIA-GEVLQGFALALIIGIV-AGTYSSVYIASNIAAALGVTKEDLMP----
Q8GEL5_PSEPU          --LAIAALLFFG-GDNLFGFSLALFIGVM-AGTYSSIYIANVVLIWLNLNSEDLIP----
D0SG96_ACIJO          --LVVISMMILG-GDGLKWFSVAMFVGVF-VGTYSSIYIGTAFALWRGLNRQDFIV----
Q1QBR5_PSYCK          --LVVLAMLFLG-GDGLFWFSAALFIGLL-AGTYSSTYIASSIPLAMGLSRDDFIV----
Q83CH4_COXBU          --IVVLALFIFG-GSTLRPFALALIIGIV-IGTYSSIYVAGSLAVTFGLSRRHLIR----
Q5ZU08_LEGPH          --FVVVALFVYG-GEAIYGFSLALIIGIV-IGTYSSIYVAGALAVAMGLDNKDFLP----
A0A0B3WJC7_FRATU      --LVVVVLYLFG-GSSVHNFSLALILGIV-VGTYSSIYVAGVVAVALGLNRESLLP----
B8L1U9_9GAMM          --LSALALYMYG-GSSMEGLAETHMIGAV-IVVLSSILVAVPM-LTIGFLRVSKQD---L
D0KW98_HALNC          --LSVLALYVFG-GEALRGFSETLLVGIV-LGTFSSIYVASSLSLDLGLKRKDLLK---L
B7J4R6_ACIF2          --MVALSLFLFG-GPVIHGFATALVIGVV-VGTYSSIFVASPIALWLGLKREHVLKRQFI
SECF_ECOLI            --MVILMLYLFG-GPVLEGFSLTMLIGVS-IGTASSIYVASALALKLGMKREHMLQQKVE
Q8D162_YERPE          --MVVLMLFIFG-GAMLQGFSLTMLIGVT-IGTVSSIYVASALALKLGMKREHMLQPKVE
Q1LSN7_BAUCH          --TVVLILIIFG-GSMLRSFSITLFIGVL-IGTISSIYVASALALKLGIKREHIIAS---
Q7VQA8_BLOFL          --MVLLVLLVLG-GSILYEFSITLLLGVI-VGTISSIYITSFLVFKLKIYHRYLI-----
E8Q616_BLOVB          --MVLLILLIFG-GAMLYEFSITLLFGVI-IGTISSIYVASFLAFRLKDINISS------
Q493H0_BLOPB          --MVLLILLIWG-GDILHGFAVTLLLGTI-IGTVSSIYIASALAFKFGTARNHFIKINKK
A0KJ23_AERHH          --VVVLALLLKG-GPLIHGFSVAMVIGVA-FGTYSSIYVASSFAMFFGVKREHMLPTQVE
Q0HWQ6_SHESR          --VTVVALFLKG-GTMIHGFATALLLGIF-VGTYSSIYVASYLAIKLGICREHMMPVEVE
C4L7L0_TOLAT          --ITVIALFWKG-GPMIHGFSTALLIGIG-FGTYSSIYVASAWAMYLKMSREDLMPKTVE
Q5QVF2_IDILO          --LVLLTLFFLG-GPLIHGFATALLFGVV-IGTYSSIYIASSVALKFGVSRDDLMPPEVE
Q5E3D5_ALIF1          --FVVIALFTQG-GAMIHGFALALLLGIT-IGTYSSIYVASALALKLGITREHLMPTPID
SECF_HAEIN            --VVVMALFFFG-GPSIHNFSLALLVGIG-FGTYSSIFVAIAIAYDVGLRREHMIPPKVD
D4ZB75_SHEVD          --MTVIALWVMG-GGPLESFSIAMFIGIL-TGTWSSISVGTCLPEVFKLNSEHYRLVPVS
C3LVV7_VIBCM          --MTISALWLMG-GAPLQGFAIAMFIGII-SGTWSSISIGTVLPEWLGLESKHYLPVELD
E1SV06_FERBD          --TTVAAVWIFA-GASLHGFAIALFVGII-SGTWSSIAIGTVLPEMAGLTPEHYRPEPIP
A1S8J4_SHEAM          --ITVGALWLLG-GAPLEGFAVAMFVGIV-TGTFSSVSVGTVLPELLGLSPAHYRKTPES
B7VU09_VIBTL          --ITVSALWLLG-GAALQGFAIALVVGIV-SGTWSSISVGITLPKLLGLQPCHYQVKPVV
B7VQK9_VIBTL          --VTVSALWLLG-GSALEGFAIALCVGIL-SGTWSSISIGTLLPTRVGLKPTHYKPEETE
Q15N35_PSEA6          --ATIGAIWIFG-GQPLQGFAIGLFAGVV-FGTLSSIAVSATIPQLIGLNPEFYQHRA--
Q3IL51_PSEHT          --ATVASVWLLA-GTPLQGFAIALFSGIV-VGTFSSVCIAATLPELMGLSAKNYEVKIDS
A0KLF0_AERHH          --FTVGALLLFG-GDALYGFSFTLFAGIL-VGTISSITVASTVQELLGLSPQAYQKKEEE
Q2RTI2_RHORT          --VTMACLALLG-GPQLRGFALALIWGTV-VGTLSSIYVAVPALMAFRGRSKTADDGREG
C5ZWZ3_9HELI          --FVVLTLYLFG-GEIIKGFSLPMLIGSI-VGSYSSIFVASKLVMILGFDLEKYHKKLVD
C3XE90_9HELI          --FVVLTLYLFG-GQIIVGFSLPLLVGVV-FGTYSSMFVAPKLAILLNFSVEAYYAKEVQ
E7A9U2_HELFC          --FVLVVLYLFG-SKILIGFSLPMLVGTI-VGTYSSIFLAPKLAVLLGFDLSRYHDNELK
A8ERU7_ARCB4          --FVVTTMLIFG-GEIIYSFSFTLFVGII-IGTYSSIYFVSSFLKFFGFSVDDYRDKEAE
D1B3G6_SULD5          --FVVLTLYIFG-GEIIHGFSFTMLLGVI-IGTYSSIFISAPFLTLIGFSVEKYKAKIAL
A6Q513_NITSB          --FVVLTLYLFG-GEIIKGFSFTLLVGIV-VGTYSSIFIASPMLTILGFDLQKYRAKLAE
E4U019_SULKY          --FVVLTLFLFG-GDIMLGFSFPMLVGVI-IGTYSSIFVAAQLVVWTGFSVGRYREKMAE
A7ZE41_CAMC1          --MTVVVLFLFG-GDMIHGFSFILIVGIV-IGTISSIYISSPFLIWFKFSIEHFRAREAE
E1YHR4_9DELT          --LVVIALFILG-GGIIHDFTFALIVGII-VGTYSSIYVASPILIAWQGKTKKK------
A8ZW13_DESOH          --IVVAALFVFG-GTIIHDFAFAMLVGIG-VGTYSSIFVASPILLLWKKK----------
B8F9E2_DESAL          --VVVVCLYLFG-GSIIADFAFALLIGVL-IGTYSSIFVASPILLAWQKASGEAA-----
E1QIL9_DESB2          --MVLVCLWALG-GGVIEDFALALLVGIG-VGTYSSVFVASPVLLLLPEGKPRLPFGGEA
C7LN35_DESBD          --VAVFSLYIFG-GGVIHDFALTMLVGVV-AGTYSSVFVGAPILAFFKPRIDLEE-----
C4XR64_DESMR          --ITVTCLFFLG-GPVIHDFALAMIIGIL-AGTFSSVFVASPILLDLGSGLSKPEEPSAP
C8X141_DESRD          --LVVISLFLFG-GGVIHNFAFALLVGVI-VGTYSSIFVASPLLLGFQIDPPEEKD----
B8J2Q5_DESDA          --LSTLALYLLG-GGVIHDFALTMLIGVV-VGTASSIYVSSAMLLALGDTDFYVSLVQKK
A0A0H3AA07_DESVV      --MVIVSLFFLG-GGVIHDFALTMFFGVF-IGTLSSIFVASPVLLAFGKP----VMAAVD
Q1MSC2_LAWIP          --VTAFSLFILG-GTVIHDFALTMIIGII-IGTFSSIFVASPILLIFGDTQQY-IQHTTT
Q3A3C5_PELCD          --LVILALFLFG-GGVIHNFAFAMLVGVV-VGTYSSIFVASPVLLFWDDYKNRKQAAVKA
Q2LVH3_SYNAS          --LVLLALFFFG-GPVIHDFAFTLLVGCI-AGVYSTVFIASPIVLAFEKIRPSRIKRN--
SECF_CALNY            --FTVLSLMIFG-GEVINPFAFTLVIGII-VGTYSSIGIASGLVYLIKSLRKR-------
D4H482_DENA2          --LAVGSLYLFG-GEVINGFAFALLMGIV-VGTYSSIGIASAFVYVLTKKKREAKAA---
SECF_MAGMM            --LVLIALFVLG-GAVIHDFALTLLFGVG-IGTYSSIFVASPLVLLMDPGSRRKVAAETA
SECF_DESIS            --IVVAVLYFFG-GEVINGFAFTLLVGII-VGTYSSIFVASLLLVYWRPRYIEPHLKKLQ
E8T6K2_THEA1          --FVVLCLYLFG-GGVINDFAFVLLVGIT-VGTYSSIFIASAIVVDWYK-----YMKKVK
SECF_AQUAE            --VTALTLFILG-GYALSNIMFAFVVGVV-VGTYSSVFVASAFVLDMQKLFKRGE-----
D3SMD0_THEAH          --VVSLTMFLLG-GPVLSNIMFSFVVGIV-VGTLSSIFVASALVLDIKERLVRPK-----
B4U6P7_HYDS0          --LSSLGLYLFG-GSVLSDISFAFLIGVV-VGTLSSIFVASALVLDIKILLRKIK-----
C0QRM5_PERMH          --FSVLALYLFG-GESLKGFALALLIGIV-FGTYSSIYVASPIIVDLERFLRKKTSGSKA
SECF_PETMO            --LVVFMMFLLG-GRSIASFAFGLTVGVI-IGTYSSLYIASPIVIGMVKRRKKTQKA---
C5CF37_KOSOT          --TAVLMLFIFS-GEVLRPFAFGIMVGVV-VGTYSSLHIAAPVVITWLGRSKVKIK----
A7HMQ5_FERNB          --FTVLMLLLFS-TGGIKSFAFGMTIGVV-VGTYSSIFIASPVVIKWVKSV---------
A6LP85_THEM4          --IVIFVLLLFS-GNSIKPFAFGMTIGTI-IGTYSSLYIASPVVIKWIKK----------
Q9WZW5_THEMA          --FVVFVLLLFA-GNAVKPFAFGMTVGTI-VGTYSSLYVASPIIVKWTKQ----------
B8JH53_ANAD2          --LSLIGLLVYG-VGTIFDFSMAMLFGIV-SGTYSTWFIAAPMTIWLEERAEKKRAKAKG
Q1D3B7_MYXXD          --LSLIGLLIFG-VGEIFDFAMAMLVGIV-VGVYSTIYIASPLTIWLDERAAAKDARLRA
E1X0T7_HALMS          --FVSVVMYFFG-GLAIRDFFLAISLGVL-IGTYSSIFVAAPVTLFFDRVKG---SQEKN
Q6MKZ3_BDEBA          --VSALCLYIFA-DGTVEDIAFSICVGIF-FGTYSSIYVAAPFVLLMDKLQFKKAKAA--
A9F8C8_SORC5          --LSLVMFLFYG-TGVIKDFAFTLVVGIA-VGTYSSIYVAAPLTEWIDRRFFGANGSKRR
D0LJ87_HALO1          --VVTVMMNVFG-TGEVANFAFAMNIGVI-VGVYSSIFVASPTLIYLDKKFYGGSGKSSK
B3T9T6_9ZZZZ          --VVVVALLIFG-GPTIQPLLLVLLVGVV-VGTYSSIFVASLMLVSWETGELGRALRRLT
D2BGI5_DEHMV          --ITVVALMLFL-GASIQNLSIVMLIGLI-AGTYDSLFVAPSLLVTWENGDWGKLLKPFK
A9WGQ9_CHLAA          --FTLTALLLFG-GDTIRNFVLILLIGLV-SGTYSSIFNAAQLLVVWEHREWRNWFKRGR
A9B5U8_HERA2          --FTLTALLLFG-GESIRSFVLILLLGLI-SGTYSSIFNAAQLLVVWENREWRNWFGRGK
SECF_ANATU            --YMLLAIALFG-GITLREFAIILLVGLF-MGTYSSIFIAAPSLVIWESGEWRNWFKRGA
SECF_THET1            --FTLLALYFFG-GTTIKHFVLALLIGIV-SGTYSSIFNASLLLVSWENKDFLRIFRRTE
D1C4J4_SPHTD          --LPLAALYLFG-GETTKTFVLVLLVGII-AGTYSSIFNASQIVVAWENGEIQRFFARLR
B4WJX7_SYNS7          --LTLLSIVIFG-GDTLKFFALALITGFL-AGAYSSIFVASTLLAWWRSR--------SE
SECF_ACAM1            --LPLIGIYIFG-GETLKDFALTLIVGFA-AGAYSSIFIASTLLAWWRQR--------QE
A0A0H3K5W7_SYNP6      --LPLISIYIFG-GATLQNFALALIVGFV-LGAYSSIFIASTLLGWWRKR--------TP
B8HQ25_CYAP4          --LTLLSIYLFG-GETLKYFALALIIGFT-MGAYSSIFIASTLLAWWRERNAEPLQLLSE
SECF_SYNP2            --LPLVAIFLFG-GSTLKFFALALIIGFI-CGSYSSIFVASTLLAWWRNR----------
SECF_SYNY3            --LPLVAIFLFG-GDSLKFFALALIIGFA-SGVYSSIFMATTLWAWWRKW---------R
D3EPH1_ATETH          --LPLISLFLFG-GETIKYFALALILGFS-VGSYSSIFIASTLLAWWREP---------K
Q2JKR7_SYNJB          --LPLVAIAIFG-GATLKGFAIALLIGFT-LGVYSSIFIASPLLVWWRQQ--------RY
Q7NDR5_GLOVI          --LVLLPLSIFG-GESIRYFALALIIGFV-VGTYSSIFIAAALLVWWRER---------Q
SECF_PROMA            --LPLIALIFFG-GTTLYWFAIALALGVV-VGSWSSIALVPSLLTLRKEN----------
A2CA57_PROM3          --LPLLALILFG-GATLYWFAVALALGVV-VGSWSSIALAPSLLSLWQGSGPPKAPLSAP
Q46L53_PROMT          --LPLICILIWG-GSTLYWFAFALLIGVI-IGSWSSIALAPSLLSITSTKKLD-------
A5GTK4_SYNR3          --IPILALILFG-GASLQWFAVALFVGIA-VGAWSSVAVVPPLLPLMGGRLPQRAATSGV
Q7V1E6_PROMP          --IPLLTLIIFG-SYSLFWFSVSLTLGIL-IGSYSSILLAPSFLIKD-------------
B5Y8Y1_COPPD          --IAALCLMIFA-YRFLPDFTTGLTVGLI-TGTYSSIFIAASLLVDWGE-----------
D4JXA7_9FIRM          --AICVVCAICG-VTSIMTFAIPMMAGLI-CGTYSSLCISGPLWVLWQEKHGKNYTNAGN
E6UEG8_RUMA7          --VVCIVCTLYG-VSSIISFAFPLIIGML-AGVYSSNCIAPTLWVLWRRHAEKSPKNKSK
D4LA66_RUMC1          --IISIVAVIMQ-VDSILSFSIPLTVGLI-SGTYSSICIAPVVWVWWTEKRGK--KTVAD
A0A2N0UMZ5_9FIRM      --VVYAVACAFN-ITSVQGFALPMIIGII-SGCYSSICIAGPLWVMWQ-RHKKAKKLAAK
E1PK78_MAGIU          --MAFVFAKVYN-LSSIVEFALPMMVGVI-IGSYSSICLATPLWTMFKTRGGRTGYEH--
E6U7Q5_ETHHY          --TVCVFSIIFH-LDSIRGFALPMMVGVV-TGCYSTICIAGPLWVSWVEHQEKKDQRRAG
A3DDV8_HUNT2          --TVYAFAAYNG-IGSMKEFTFPLIIGLI-CGTYSSIFIASPLWELLKEKQ-AKRKASQA
B8I6M7_RUMCH          --TVYIFAKING-INSMEQFSFPLIIGIA-AGCYSSIFISSPLYVMWKESQKKKKITGKT
E0RMP8_PAEP6          --IASLCLFIFG-GESIRMFSLAMVIGLL-FGAYSSIFIASPLWVALKGKQKS----PTA
C6D7X9_PAESJ          --IIATCLFIFG-SESIKLFALAKMIGLA-SGAYSSICIAAPLWMVMKSKQK-----PST
C0ZAP7_BREBN          --FTALALAVLG-SESIQNFSLALLFGLV-SGTYSSIFIAAQVWVNLK----------ER
SECF_ALIAD            --IAAVILYFFG-GISIRNFTFALIIGLV-SGAYSSIFIASPIWVAWRSRSMK----KAT
Q5WHQ4_BACSK          --FAAVALLIFG-GEAIRSFSLALVIGLI-AGTYSSMFLCAQIWLVWEWKR-----QKKL
D6XWY7_BACIE          --FAAGALFIFG-GEGLRTFSLALVVGLL-AGTYSSLFIAAQVFLELKTRQIKKRHEKRI
B1YJQ6_EXIS2          --MTAAALYIFG-SEAIRGFSLALLVGLI-MGMYSSIFIAAQLWLVMKGRT--------L
B7R9G0_9THEO          --IMLLLMYFLG-PKALKDFALPLLIGIT-WGAYSSIFISTPLWVLIKNREKRK------
D9TNU6_THETC          --IMLVLMYFFG-PASIKSFALPLLVGIT-SGAYSSIFIASPLWIIFKDREGKNRVG---
C6PXQ6_9CLOT          --IMLVAIYVF--VPGIRNFSKPLLVGIT-SGCYSSIFIATPFWVILKKHMGKNRN----
Q892A5_CLOTE          --FTIAAVYIF--VPSVREFALPLLIGVI-CGAYSSIFIASPLWTIFRKKGKALR-----
A6LTN3_CLOB8          --VTIIAMNFL--VPSVQAFTIPLIVGII-SGAYSSICIASPIWVYLKDRVRSQKK----
Q97GT8_CLOAB          --IAVSSVHVF--VPSVRDFTKPLLVGIV-SGCYSSIFIASPLWVIFKERANKKKL----
D9SMV1_CLOC7          --ITISAITIG--VPEVRNFGLPLIVGIA-AGCYSSIFIASPTWVLLKKKFSK-------
A6TQN5_ALKMQ          --VTIVALYVLG-VSQIREFALPLIAGVI-SGTYSSIFIASPVWVMLKERQKGKRS----
E3GFZ4_9FIRM          --LAILALYIFG-VEAIRSFALPLIVGIV-SGCYSSIFVASPLWVQFQKRFPNSKSNKKN
D9TIR8_CALOO          --IVLVVLYIMG-VQSIKEFTFPLLIGVI-SGTYSSIFIATALWFDWELSTRKK------
D9RXQ1_THEOJ          --LSIIALYFLG-GETIKDFTLALIVGIM-SGVYSTIFIASPLWSMFRGQHRTARA----
D9QVJ2_ACEAZ          --VSILAILIFG-GATIKPFMLALLIGIL-SGTYSSIFIAS---PVLVEIDAWKKR----
E4RIJ9_HALHG          --VAILAIYFFG-GASLQTFMLALFIGMF-SGTYSSVFIAS---PLLV---TWQNR----
B2A264_NATTJ          --LVLISLFIFA-GVTIRPLIIALLIGVI-SGTYSSIFVAANVWSILTEKLAPGLS----
A0A1H8CTT8_9FIRM      --FATFALYFFG-GDTTKDFAFALLIGFF-CGAYTSIFIASPLWVTFRRYSDKKRLAKRM
D1BLM5_VEIPT          --FACVSLYLFG-GDTTKNFALCMIIGFA-SGAYSSICVATSLWVMWKSR-NKNDVRNQ-
SECF_ACIFV            --FAVVAIFLFG-GETIHNFSFAMLVGFC-SGFYTSTFLAGSMWLFFRKKLKR-------
C8W4E2_DESAS          --FVLLALFFLG-GSTIKIFVLALLIGVF-SGCYSSIFNASQIWVDL-KLME--GNKKKA
A5D3H0_PELTS          --FVLVALLLLG-GTTIRSMVLALLVGVT-SGAYSSIFNASPLWFDF-KRLERRGRPRTA
A4J545_DESRM          --FVLVALLLFG-GSTIHNFVSLLLIGVI-SGAYSSIFNASPVWFDL-RRIQK-ERKASA
B1I4K4_DESAP          --FMLLALFFLG-GATLKAFVLALMIGVV-SGTWSSIFIAGPVWLDLRKRLPRSKRPAGA
C9R7V2_AMMDK          --FVLVALYFLG-GSTLRNFVLALIIGVI-SGAYSSVCDASPIWYDL-KRWEEKRRAKAL
B0TF82_HELMI          --FVLVALLFWG-GNTTKVFTLAMLLGVI-AGAYSSIFNASPVWYDL-KQWERAQRRAKA
D5XEJ7_THEPJ          --IVLVALLIFG-GSTIRYFTLAMLIGVI-SGAYSSIFNASPLWVEF-KYWEQ-RRRKLA
Q2RHU7_MOOTA          --FALLALILLG-GETTRTFALAMLIGTI-SGCYSSIFTASPLWIDF-RHLSRERHRQAA
D7CLE8_SYNLT          --FVLLALLVFG-GETIKVFSLALLIGVI-SGCYSSIFVASPIYYDL-KMSGSR------
Q0AX23_SYNWW          --FPLVTLYLFG-GSTIKIFVLTMLIGFV-VGAYSSIFIASPLYYDIKQKA---------
SECF_SEBTE            --LALAALLIFG-GSTLRTFNITLLVGIV-YGTYSSIWLASPLVYLLRRFKKPPKQEKNG
E3CUY4_9BACT          --LPVLAMYFLG-GEVISNFAFAFLVGIT-VGTYSSIYIASAVVAE---WYLRSPKY---
D5EDU6_AMICL          --FPVLALFIWG-GAVIANFSFALLLGIL-VGTYSSVCIASSLLAE---WYLRYPESKK-
D4M8L9_9BACT          --FPVIALCVWG-GPVLQAFSYAMLVGII-AGTYSSMLVATGALIE---WYKARPESR--
E6SLR1_THEM7          --LALAAVFAFG-GETIRAFSGAMFFGIF-FGTYSSIFVASPL------WYVLRQRAAR-
B5H469_STRC2          --FVLVSLAVLG-GDSLADFSVALLAGVV-LGTASTVFTAMPLVVEGQLRYPDRPRPQRE
SECF_GEMAT            --SATLALLLLA-GEVIRPFAWVMAFGVV-MATFSSIYVAGPL-LLWIEGRWPRLDDAAT
Q67LL9_SYMTH          --LMLLAMIFLG-GSTVLDLASTLFVGIL-AGTYSSITVAAALWFVWEQSREGGHPGPAG
C4RGU1_MICS3          GGLLFIGAGLLG-AGTLKDLGLVLFVGMA-VAFLTSILLATPLLVLLKNYDLRIQAHNKR
D2S9H9_GEOOG          AGLLFVGAGLLG-VGTLKDLALVLFVGLA-AGAYSSIFLATPIVADLKEREPGVQALRRR
D3PYP6_STANL          GGLLFVGAGLLG-VGTLKDLALVLFVGMA-TGAYSSLFLATPLVVDFKLREKDYKTHTRK
SECF_MYCLE            LALMVVAVWLLG-VGTLKDLALVQLVGII-VGTYSSIFFATPLLVTLRERTELVRTHTRR
B1MCI7_MYCA9          LSLIVVAIWLLG-VGTLKDLALVQLVGIL-VGTYSSIFFATPLLVALRERTDLVASHTKK
Q5YTF3_NOCFA          VGLIVIAVWMLG-VGTLKDLALVQLVGLL-VGTYSSIFFATPLLVSLKERWGPVAAHTRK
D0LCM9_GORB4          IALMVIAVWLLG-VGTLKDLGLIQLVGVV-VGAYSSIFLAAPLLVTLKERRPDIARHTKR
D6Z7I7_SEGRD          LGLIVVAVLLLG-VGTLKDLALVQLVGLI-SGAYSSIFVATPLLVTLKERRQEFKKHNAK
D5UNI8_TSUPD          VALMVVAAWILG-VGTLMDLGLVQLVGVV-VGTYSSVFFASPLLVTLKERKPEYKAHTQK
C3PGQ3_CORA7          IALFIVAVWLMG-IGTLRDLALVQFIGVI-EGVFSSIFLATTLLVTLSNQRKSVKKHNEV
Q79VF7_CORGL          IALMVVAVWMMG-VGTLKDLALIQLIGVI-EGTFSSVFLATPLLVSLKNRLSKTKAHTAS
D9QAR8_CORP2          LALIVIAVWLLG-VGTLKDLALVQLIGVI-EGTFSSVFLATPILVSLKNRSKETKAHNAE
C4LIX4_CORK4          GALMVVAVWLLG-VGTLKDLSLVQLLGVI-EGTFSSIFLATPILVSLKSRQKKYSEHTKR
Q4JVE2_CORJK          ASLLVVAVGIMG-VGTLKDLALVQFIGVI-AGTFSSIFFAAPLLVTFKMRQQKYKQHEAR
B1VDK1_CORU7          AALLVIAVWLMG-VGTLKDLALVQFIGVI-CGTFNSIFFAAPMLVSLKMRQKKYREHDDR
C6WCM8_ACTMD          MGLLVVGVWLLG-VGTLKDLALVQLAGMA-IGALSSIFIAPAIAVDLKMRDPRYKAQAAR
C7MR00_SACVD          LGMLVIGYLLLG-SGTLQDLALVLITGMV-AGTFSSVCLATPLLVSFKMRDPKYQKQAEK
C8XE15_NAKMY          AGLLVAGVVILG-SGTLKDLSLVMLIGML-IGAYSSVFVAVPFAVDLKLRDPAIKAHTAR
A0LUK2_ACIC1          ASLLFVGAGLLG-AGSLKDLALALFVGLA-TGTYSSIFVATPILTLLKEREPQFRALAKR
D7BWW9_STRBB          GALLFIGGGALG-AGMLNDISLALFVGLA-AGAYSSIFIATPLVADLKERDPQMKALAKR
Q0RNU2_FRAAA          ASLLFVGAGLLG-AGTLKDLALAQFVGIA-SGTYSSLFFATPLLVDLKRGEPAVQALDAR
D1AEV5_THECD          ASILFVGTFLLG-AGALKDLSLSLFVGIV-VGTYSSLCVATPLLVQLKEREPRYRQLRQR
C7QJQ2_CATAD          AALLFAGTVVSGGAGVLQDLALALLVGIA-VGTYSSIFIATPLLADLKEREPEMRALKRK
D7BNQ3_ARCHD          AAILFIGVYVLG-ADTLRDLALVMFVGML-LSTLSSLIIAAPLAVVLAMRNPKIREHTQD
D6ZHF3_MOBCV          SAILFLGAALLG-TSTLLDISMPLFIGMI-VGTFSSIFIATPMLTLIRGRSQAIKDHNAK
A0JXA8_ARTS2          GAILFIGAGLLG-AGTLRDLSLALFVGIL-IGTAATIFIAAPLYAWLRQGEPQLVKQAER
C5CCH8_MICLC          GSILFIGAGLLG-AGTLRDIALALFVGII-VGTLSTLFLQAPLYALLRRNDPDVRDHDAR
D2NT09_ROTMD          GAILFIGAFILG-AGTLQDLSLSLFVGIL-VGMFGTLFVSAPLYASLRLGEAQIREHTAK
B0REC3_CLAMS          GSILFIGAVVLG-AGTLRDIALSLFIGII-VGTYSTIFIAAPLYAHLREGEPKVKRGDAL
Q6AFB1_LEIXX          ASILFIGAYALG-AATLRDISLALLIGIV-VGTYSTVFLGAPMYSQFREHEPAIRKHDQR
A6WCH5_KINRD          AAILFIGDLLLG-AGTLRDISLALFVGML-VGAYSSIFVATPLLAALRSREAKVQELDRA
D1BGW3_SANKS          ASILFIGAFILG-AGTLRDIALALFVGMA-VGTYSSIFLATPLEVTLRMREPAIVEHTKT
D1BSK2_XYLCX          AGILFVGALLLG-AGTLRDLSLSLFVGIA-VGAASSLFLATPLDVALREREPKIKAHTAA
C7MCC3_BRAFD          GSILAIGAFLLG-AGTLKDISLALFIGII-AGTYSSIFLAPGFLVDLRRRESEIAAHTDR
E6SB76_INTC7          AAILFVGFTMLG-PGTLLDLSLALFIGIG-VGAYSSIFIATPMLVQLRQKEPAVVDLERY
C7NI43_KYTSD          GAILVVGFAKLG-PGTLLDLSLALFIGIA-VGTFSSIFIATPLLVQLREGEAEIKAHDAE
Q83MZ6_TROWT          ASILFIGSLILG-ASTLSDISVALFIGML-AGAYSTIVIASPTYALLCKKLPSGKEK---
D4HDX0_CUTAS          AALLFAGAFVLG-SGPLEDLGLALFVGMI-VGAYSSIFIATPVFTQLREHEPAMKEHTAR
D7GDS8_PROFC          IALLIAGVGFLGGDGPLADLGLALLIGMV-AGAYSSIFIATPLLTQLREREPDMKKHVAA
D2PVF2_KRIFD          GSILVVGTVVLG-TGPLKDLSLALFVGIA-IGAYSSVFIAPALLAAFKEREPGMQALRRR
A1SJB0_NOCSJ          GVILYVSAVQLG-ASTLKDLALALFVGMA-AGAYSSIFIATPLVVQLKAGETDVVQAEKR
C7LYS7_ACIFD          LSVLVVGAYLLG-ATTLRNFGLALVVGLT-SGAYSSIAIASPILAFLKEREPRYRQLKRR
Q1AWC9_RUBXD          TALLVFGRSTLT------DFAFALLVGIV-AGTYSSIFIASPILSLYKAWRAGKLGSAAR
E1QZN4_OLSUV          VAMLLLGGATLK------DFAFAMLVGEL-LGTWSSFAVASPLLAIWKTREKRWARLEAK
D8IEE2_BRAP9          --LAALAIMIWG-GFILYDFAFTFFCGVV-IGTYASNFIASGLLILFMKGKKA-------
                                         :      *        :                        

E1R5K6_SEDSS          SHAPASGTKGGAALSVESSTAGEESSELVSGPVEIPKADRKLKGKRQQKRKK--------
E0RQA8_SPITD          QRQQVLSVKEETGPPAEETGGGEPEEKGEGGGVQIVQGRRRLPRSKRKKKR---------
SECF_BORBU            ------------------------------------------------------------
SECF_TREPA            ------------------------------------------------------------
Q73PW5_TREDE          KKAPGELSGAVI------------------------------------------------
B0SPU5_LEPBP          ------------------------------------------------------------
Q72PD4_LEPIC          ------------------------------------------------------------
SECF_DICTD            ------------------------------------------------------------
B0VHR6_CLOAI          LTKKKL------------------------------------------------------
A1BCH7_CHLPD          SAS---------------------------------------------------------
SECF_RHOM4            R-----------------------------------------------------------
Q9WXE9_PRERU          ENK---------------------------------------------------------
D5MHP4_9BACT          KAKAKG------------------------------------------------------
D8PI88_9BACT          ------------------------------------------------------------
B6ANM4_9BACT          PTPADGVRNTNPRNG---------------------------------------------
B5ECA5_GEOBB          GLSGTSEEEL--------------------------------------------------
B3E2R7_GEOLS          AVTGQPVKA---------------------------------------------------
SECF_THEYD            ------------------------------------------------------------
SECF_KORVE            GPAPRKNDRVKVKA----------------------------------------------
E8X5J9_GRATM          LPAGR------VRA----------------------------------------------
Q029K3_SOLUE          ASTARPETVRKSPARAIK------------------------------------------
SECF_ELUMP            QDVALAAEIKTAKKHNKKKHR---------------------------------------
SECF_UNCTG            QDGVRSK-----------------------------------------------------
D0RNY4_9PROT          ----------------------------IDKTP---------------------------
B6BPL7_9PROT          ----------------------------EDSEK---------------------------
B4WED0_9CAUL          --------------------------DAKPIKLGMASRP---------------------
D5VIW1_CAUST          --------------------------DATPVKFGAASRP---------------------
Q0BS57_GRABC          --------------------------VAPPGAPSGAPSGAQKTAKG--------------
C6XJ03_HIRBI          --------------------------GENENAPHGAQV----------------------
Q0ANE7_MARMM          ---------------------------ESNDS----------------------------
Q0C0W7_HYPNA          --------------------------KPVEDTPGFEAMP---------------------
E2CQN2_9RHOB          -------------------------DEEGEASSGDTAAAQGT------------------
A7HXL1_PARL1          -------------------------GLGRAAKDKAPEKA---------------------
D8JWH2_HYPDA          -------------------------AAKAVATSKTKAKA---------------------
E3I015_RHOVT          -------------------------EKAGAKPGVPASKAAKPAPSRPENRPAVEASEADA
B0UI93_METS4          -------------------------IRATGRDPAALPQAAE-------------------
B2II62_BEII9          -------------------------ETAKADTQSPSGKAAKASV----------------
E6VHR2_RHOPX          PAKPEPAPVAAAAPAADEIPARFVDTDAKAAAPVATAKPAKSGKPKKR------------
A7IND7_XANP2          -SEPEAVLGVDEAAKLSEAEAEVVDEPVPPAPAKGGSKGAKGGKRPPARPAKA-------
D5BQT4_PUNMI          -------------------------ENGIEVPEYER------------------------
Q2W4A8_MAGSA          -------------------------AEAEEAPTGGPAAP---------------------
B6ISI3_RHOCS          -------------------------KQGQTAGAA--------------------------
Q2NBX9_ERYLH          --------------------------ESEADVQDRKARGQA-------------------
Q1GSE6_SPHAL          -----------------------AVTEGAERVSNRNDDGAVV------------------
D4YYJ1_SPHJU          -----------------------ANIAAQAERMGPRDDGARP------------------
SECF_RHOCB            -------------------------PSDKFFSNGAQDGAP--------------------
SECF_KETVY            -------------------------PSGTQFTTSAE------------------------
D0D195_9RHOB          E------------------------ANGKSKSKGPSAGASV-------------------
SECF_RICPR            KG----------------------------------------------------------
A5CDU1_ORITB          ------------------------------------------------------------
B9KH24_ANAMF          T-----------------------------------------------------------
Q2GI09_EHRCR          ------------------------------------------------------------
Q5GT97_WOLTR          ------------------------------------------------------------
C6V4R4_NEORI          ------------------------------------------------------------
C1D5X5_LARHH          PVK-----------------PKQEAVV---------------------------------
B1XW93_LEPCP          TPRKDHDP----------NDPNTGAVV---------------------------------
B6BWI7_9PROT          STPQ--------------KKEEMETAP---------------------------------
A5EWX6_DICNV          KEK-----------------APLDDLP---------------------------------
C0N4C3_9GAMM          PVKDDDE----------------NANPDGSQV----------------------------
A5CVL6_VESOH          SDKS-------------------KSRP---------------------------------
A1WXP7_HALHL          PEKEGQD---QED--------HESVIPPGERP----------------------------
Q31FZ8_HYDCU          PVKEGADATAQEEELNRIFLEQEAAREAKEAAKNNKH-----------------------
D3S9V5_THISK          VKKEGAE---------------EDQTP---------------------------------
D3RSH8_ALLVD          VKKEGAE---------------LDPLP---------------------------------
C7RB48_KANKD          PEIEKEG--------------EEFDAP---------------------------------
A4GK29_9BACT          KKSE-----------------RFDDGMP--------------------------------
A4GHV4_9BACT          EEPE-----------------NADENLLP-------------------------------
B8KFI4_9GAMM          PIKEGA---------------EQDDLMP--------------------------------
Q21KV9_SACD2          VVKEGE---------------ELDELP---------------------------------
Q2SDV4_HAHCH          PVKEGEG-------------AELDERP---------------------------------
E4PKE9_MARAH          PAKEGAEN------------AEEEEQPPEWLNRM--------------------------
A6VYM8_MARMS          APK-----------------AELEDELP--------------------------------
E1V6F3_HALED          AKKEDA---------------EAEEELP--------------------------------
Q0VS96_ALCBS          PEPE-----------------EVDEMP---------------------------------
B3PDJ9_CELJU          RPKEE----------------TEADATP--------------------------------
Q8GEL5_PSEPU          PAKTE----------------GVDERP---------------------------------
D0SG96_ACIJO          QVKPEFE--------------EENEIP---------------------------------
Q1QBR5_PSYCK          KVKPEFE--------------EEIVTFNDPKMFEQD------------------------
Q83CH4_COXBU          SPKK-----------------IEDDLP---------------------------------
Q5ZU08_LEGPH          SHRR-----------------EVDDRP---------------------------------
A0A0B3WJC7_FRATU      KQVS-----------------KED-IPIL-------------------------------
B8L1U9_9GAMM          LPKAK----------------DVEALARRP------------------------------
D0KW98_HALNC          TDKEK----------------LVDTAP---------------------------------
B7J4R6_ACIF2          SAKDR----------------NDGAAL---------------------------------
SECF_ECOLI            KEGADQPSILP-------------------------------------------------
Q8D162_YERPE          KEGADQPSILP-------------------------------------------------
Q1LSN7_BAUCH          ------------------------------------------------------------
Q7VQA8_BLOFL          ------------------------------------------------------------
E8Q616_BLOVB          ------------------------------------------------------------
Q493H0_BLOPB          ------------------------------------------------------------
A0KJ23_AERHH          KEGADQQEILP-------------------------------------------------
Q0HWQ6_SHESR          KEGADQPSMMP-------------------------------------------------
C4L7L0_TOLAT          KEGEEER-YEP-------------------------------------------------
Q5QVF2_IDILO          KEGADQ-DPLG-------------------------------------------------
Q5E3D5_ALIF1          KEGEEEFEQMP-------------------------------------------------
SECF_HAEIN            KEIDELP-----------------------------------------------------
D4ZB75_SHEVD          DAP---------------------------------------------------------
C3LVV7_VIBCM          AAP---------------------------------------------------------
E1SV06_FERBD          DLP---------------------------------------------------------
A1S8J4_SHEAM          ELLAEKAK----------------------------------------------------
B7VU09_VIBTL          EVEGEYP-----------------------------------------------------
B7VQK9_VIBTL          SLESMP------------------------------------------------------
Q15N35_PSEA6          QELLLNDEP---------------------------------------------------
Q3IL51_PSEHT          QSQALMDMP---------------------------------------------------
A0KLF0_AERHH          LAEAA-------------------------------------------------------
Q2RTI2_RHORT          EDDGEDTPPPRAAPGKAKNAPAVAAGKPAQAKPAAAPPSRKERR----------------
C5ZWZ3_9HELI          QERKALEKKKMREMYERGRV----------------------------------------
C3XE90_9HELI          KAKKQEEKKRMRQLYEGGRV----------------------------------------
E7A9U2_HELFC          KLKRKQEKERLRQLYEHGRV----------------------------------------
A8ERU7_ARCB4          KIKRKKDKEKLRSMYEQGTI----------------------------------------
D1B3G6_SULD5          REKNKIEKAKMRAMYEKGTV----------------------------------------
A6Q513_NITSB          KRKKQQEKERMRAMYEQGMV----------------------------------------
E4U019_SULKY          KQKMQAEKEKMRAQFEQGIV----------------------------------------
A7ZE41_CAMC1          KQRIKKERDKERAMFEKGVV----------------------------------------
E1YHR4_9DELT          ------------------------------------------------------------
A8ZW13_DESOH          ------------------------------------------------------------
B8F9E2_DESAL          ------------------------------------------------------------
E1QIL9_DESB2          AAKAEPAKVAPAAKAQPAAEAGKKAAPATKAQSAAKASANKQRQGKARGKRR--------
C7LN35_DESBD          ----RVEQAAA-------------------------------------------------
C4XR64_DESMR          KAGPRVNAARA-------------------------------------------------
C8X141_DESRD          ----AVQEQTV-------------------------------------------------
B8J2Q5_DESDA          DKFERPGEHGVV------------------------------------------------
A0A0H3AA07_DESVV      ADYEKPGEHGVV------------------------------------------------
Q1MSC2_LAWIP          PIYTRPGENGIV------------------------------------------------
Q3A3C5_PELCD          P-----------------------------------------------------------
Q2LVH3_SYNAS          ------------------------------------------------------------
SECF_CALNY            ------------------------------------------------------------
D4H482_DENA2          ------------------------------------------------------------
SECF_MAGMM            EETP--------------------------------------------------------
SECF_DESIS            EKPEEVV-----------------------------------------------------
E8T6K2_THEA1          ------------------------------------------------------------
SECF_AQUAE            -VQTA-------------------------------------------------------
D3SMD0_THEAH          -LA---------------------------------------------------------
B4U6P7_HYDS0          -KQKPQSI----------------------------------------------------
C0QRM5_PERMH          EKEKAPQV----------------------------------------------------
SECF_PETMO            ------------------------------------------------------------
C5CF37_KOSOT          ------------------------------------------------------------
A7HMQ5_FERNB          ------------------------------------------------------------
A6LP85_THEM4          ------------------------------------------------------------
Q9WZW5_THEMA          ------------------------------------------------------------
B8JH53_ANAD2          AAAAAAAQPQARTAK---------------------------------------------
Q1D3B7_MYXXD          SGNVDHQQPNAA------------------------------------------------
E1X0T7_HALMS          TANA--------------------------------------------------------
Q6MKZ3_BDEBA          ------------------------------------------------------------
A9F8C8_SORC5          KVSRVRTQKRADAVV---------------------------------------------
D0LJ87_HALO1          KGGASNTKTKAKSES---------------------------------------------
B3T9T6_9ZZZZ          LSRPRS------------------------------------------------------
D2BGI5_DEHMV          KLN---------------------------------------------------------
A9WGQ9_CHLAA          QDEVEVRSGA--------------------------------------------------
A9B5U8_HERA2          -DKVKPATAA--------------------------------------------------
SECF_ANATU            ----KPASA---------------------------------------------------
SECF_THET1            PEAAAT------------------------------------------------------
D1C4J4_SPHTD          GQGRQSVPAGKGSRP---------------------------------------------
B4WJX7_SYNS7          ADSVDDDGFEEPVDTAPTSP----------------------------------------
SECF_ACAM1            RGGYN------TMDSSPEEI----------------------------------------
A0A0H3K5W7_SYNP6      QSPQP-------INAET-------------------------------------------
B8HQ25_CYAP4          TAGVENAADTPSEQPPETQTRP--------------------------------------
SECF_SYNP2            -NGQPPTVTKEAVNVTELS-----------------------------------------
SECF_SYNY3            SPKNP-------PREMVAEV----------------------------------------
D3EPH1_ATETH          LSNIK-------LRS---------------------------------------------
Q2JKR7_SYNJB          GKSSEDARAGRDPDSLPSEG----------------------------------------
Q7NDR5_GLOVI          TVGAT------GAGAAKAER----------------------------------------
SECF_PROMA            ------------------------------------------------------------
A2CA57_PROM3          AASPQPPLSSSQSPLEGEDVMSDG------------------------------------
Q46L53_PROMT          ------------------------------------------------------------
A5GTK4_SYNR3          VA----------------------------------------------------------
Q7V1E6_PROMP          ------------------------------------------------------------
B5Y8Y1_COPPD          ------------------------------------------------------------
D4JXA7_9FIRM          GESKKDTKNLASKGTVDTKKLMV-------------------------------------
E6UEG8_RUMA7          GSTKKSGRR---------------------------------------------------
D4LA66_RUMC1          LQIRK-------------------------------------------------------
A0A2N0UMZ5_9FIRM      AA----------------------------------------------------------
E1PK78_MAGIU          ------------------------------------------------------------
E6U7Q5_ETHHY          DVVEG-------------------------------------------------------
A3DDV8_HUNT2          AKA---------------------------------------------------------
B8I6M7_RUMCH          AKA---------------------------------------------------------
E0RMP8_PAEP6          GGGAVKTAKS--------------------------------------------------
C6D7X9_PAESJ          KAAAKKAV----------------------------------------------------
C0ZAP7_BREBN          NMKKKKEVM---------------------------------------------------
SECF_ALIAD            RGDKAAPIPE--------------------------------------------------
Q5WHQ4_BACSK          KNKPKKTEEEYI------------------------------------------------
D6XWY7_BACIE          KELQEEQEEQEATPTNG-------------------------------------------
B1YJQ6_EXIS2          KSSKQAS-----------------------------------------------------
B7R9G0_9THEO          --KASVKAAKA-------------------------------------------------
D9TNU6_THETC          -NKVGNKPQKA-------------------------------------------------
C6PXQ6_9CLOT          --SAAKKLNTAK------------------------------------------------
Q892A5_CLOTE          ------------------------------------------------------------
A6LTN3_CLOB8          --KLQKA-----------------------------------------------------
Q97GT8_CLOAB          --QIKAEAQK--------------------------------------------------
D9SMV1_CLOC7          ------------------------------------------------------------
A6TQN5_ALKMQ          -HRVNPDTN---------------------------------------------------
E3GFZ4_9FIRM          KKRAVSNTNKGRNKQPQV------------------------------------------
D9TIR8_CALOO          --KLQAKPKRA-------------------------------------------------
D9RXQ1_THEOJ          ------------------------------------------------------------
D9QVJ2_ACEAZ          ----RNSKQTA-------------------------------------------------
E4RIJ9_HALHG          ----ISK-----------------------------------------------------
B2A264_NATTJ          ----QKNKQTA-------------------------------------------------
A0A1H8CTT8_9FIRM      ADTGK-------------------------------------------------------
D1BLM5_VEIPT          ------------------------------------------------------------
SECF_ACIFV            ------------------------------------------------------------
C8W4E2_DESAS          AA----------------------------------------------------------
A5D3H0_PELTS          RA----------------------------------------------------------
A4J545_DESRM          KATA--------------------------------------------------------
B1I4K4_DESAP          RA----------------------------------------------------------
C9R7V2_AMMDK          KARRA-------------------------------------------------------
B0TF82_HELMI          KAA---------------------------------------------------------
D5XEJ7_THEPJ          KT----------------------------------------------------------
Q2RHU7_MOOTA          VAKADTKAKTRKATSH--------------------------------------------
D7CLE8_SYNLT          ------------------------------------------------------------
Q0AX23_SYNWW          ------------------------------------------------------------
SECF_SEBTE            KKDRSMEKVVV-------------------------------------------------
E3CUY4_9BACT          ------------------------------------------------------------
D5EDU6_AMICL          ------------------------------------------------------------
D4M8L9_9BACT          ------------------------------------------------------------
E6SLR1_THEM7          RAAEARAAG---------------------------------------------------
B5H469_STRC2          RERAGRRAGTGAVV----------------------------------------------
SECF_GEMAT            ARAVRAGEAATTTARGTDRVSAR-------------------------------------
Q67LL9_SYMTH          ARPARA------------------------------------------------------
C4RGU1_MICS3          VLARRGALA----------------------GGETTPKGTPRPAADGDE---PVDADAAL
D2S9H9_GEOOG          VLARRSSQARQGGDRGT----GSGPVASARRAGGVARRAAGVALAEREQDLGPAQADVVV
D3PYP6_STANL          VLARRAETGE---------------------SAESIVAEPDHDADEDDTDKADTTAETVE
SECF_MYCLE            VVKRRTLGSQVGKK----------NADSHVAAGTRKPQNQAESCADASSQEGTEVATAS-
B1MCI7_MYCA9          VLSRR------------------------------KP--DAAPLADAGV--GSKTAKVA-
Q5YTF3_NOCFA          VLAKR------------------------------SNVASARAAAEADRRVSVATGRPA-
D0LCM9_GORB4          VLDRR-----------------------------------------AAIEAGQTPAEEF-
D6Z7I7_SEGRD          VASRR-----------------------------------------RASDAA--------
D5UNI8_TSUPD          VLNKR-----------------------------------------RAVGVEAESAVVQ-
C3PGQ3_CORA7          VAAYRAE-------------------------GGSAEAEDEGAPKATRTVASPAAASAP-
Q79VF7_CORGL          VMKLRDGQSTLI--------------------DATPHTNADASAHGTESDTDGVTPEAP-
D9QAR8_CORP2          VEEHRNP------------------------------QNKAKDSVENSGDVYVSDLSQS-
C4LIX4_CORK4          VEESRKAESSNQ--------------------ENELVAVTSDGSEITPSESSDSEPSAR-
Q4JVE2_CORJK          VERARSLAASQEGTSSNDAAVETSDGDSEKVTVPADNGDEEENTGRAKRNVSSPNAHVA-
B1VDK1_CORU7          VLQARERVAAGE--------------------EPAE--DSEEEPRAGTRTVVSPNAGLG-
C6WCM8_ACTMD          VKARRDNVARK----------------------NAVGAVSEDEVESTDEDSLEAELRKE-
C7MR00_SACVD          VYARREQLARKR-------------------SENGAAVSDDDHFDPGDDEQLAAELRRE-
C8XE15_NAKMY          VLAKRKAEGLVVDADGD------PIARTGGPARVAAAAASSPVATATASSTATSTATAV-
A0LUK2_ACIC1          VATRYGGQVPA--------------TVPVAVAAGGGTVTAAIDPAAGSPSAHGQTP----
D7BWW9_STRBB          VRAK----------------------------------RASAAAKADSDSDAEQKP----
Q0RNU2_FRAAA          VARERGKR-----------------------ARAVASTAAGPGAPVGSPAPDEPVS----
D1AEV5_THECD          LQAR--------------------------------ESSAKRQADKKTKAPVTAAV----
C7QJQ2_CATAD          ASGA--------------------------------QAKAAARAERNAVPTQDRLG----
D7BNQ3_ARCHD          ILA----------------------------------RRAAA---QAETSHETGES----
D6ZHF3_MOBCV          VDK----------------------------------ARAAAVESGAATLKEDGTF----
A0JXA8_ARTS2          VER----------------------------------RRAESAAKEAAATETATA-----
C5CCH8_MICLC          AAA----------------------------------RAARERASEAVTDPDVAPW----
D2NT09_ROTMD          VESGSFKDAEDADEAEGD-------SSEEPAEAAKSEKSAKSEESADKATEDEKAP----
B0REC3_CLAMS          AAS------------------------------------AASRAQAERAAVTVES-----
Q6AFB1_LEIXX          VLS------------------------------------VRPKAAQSAVQSVAAE-----
A6WCH5_KINRD          VRD----------------------------------GAGATAVTAGGAV----------
D1BGW3_SANKS          VLA----------------------------------RRAEKVSAADGSGDTGAED----
D1BSK2_XYLCX          VLA----------------------------------ARAGTAADAGVDE----------
C7MCC3_BRAFD          VLRAR--------------------------------RGEESPESAEDAEQPADEG----
E6SB76_INTC7          V---------------------------ARHTAKRGAVDERSAPGVLPAGEPVSV-----
C7NI43_KYTSD          VRQRQ----------------------RARAAAILARRQEQGTAAEEPADQPASAE----
Q83MZ6_TROWT          ---------------------------------------RLRKASVKAPG----------
D4HDX0_CUTAS          VLR----------------------------------RRER-AAQKAPRVTAETV-----
D7GDS8_PROFC          LAK----------------------------------RRARAAAEPQIRVSATTVP----
D2PVF2_KRIFD          VMA----------------------------------RRAQTAGSAGTPVPALAGA----
A1SJB0_NOCSJ          DKA----------------------------------RQKKVEADRYAAVPAFAEDMPIH
C7LYS7_ACIFD          IAARR-----------------------------------IAPATEAAGTIDT-------
Q1AWC9_RUBXD          AA----------------------------------------------------------
E1QZN4_OLSUV          YGPGA----------------------------------TDTAKMEDDAAPEGAE-----
D8IEE2_BRAP9          ------------------------------------------------------------
                                                                                  

E1R5K6_SEDSS          ------------------------------------------------------------
E0RQA8_SPITD          ------------------------------------------------------------
SECF_BORBU            ------------------------------------------------------------
SECF_TREPA            ------------------------------------------------------------
Q73PW5_TREDE          ------------------------------------------------------------
B0SPU5_LEPBP          ------------------------------------------------------------
Q72PD4_LEPIC          ------------------------------------------------------------
SECF_DICTD            ------------------------------------------------------------
B0VHR6_CLOAI          ------------------------------------------------------------
A1BCH7_CHLPD          ------------------------------------------------------------
SECF_RHOM4            ------------------------------------------------------------
Q9WXE9_PRERU          ------------------------------------------------------------
D5MHP4_9BACT          ------------------------------------------------------------
D8PI88_9BACT          ------------------------------------------------------------
B6ANM4_9BACT          ------------------------------------------------------------
B5ECA5_GEOBB          ------------------------------------------------------------
B3E2R7_GEOLS          ------------------------------------------------------------
SECF_THEYD            ------------------------------------------------------------
SECF_KORVE            ------------------------------------------------------------
E8X5J9_GRATM          ------------------------------------------------------------
Q029K3_SOLUE          ------------------------------------------------------------
SECF_ELUMP            ------------------------------------------------------------
SECF_UNCTG            ------------------------------------------------------------
D0RNY4_9PROT          ------------------------------------------------------------
B6BPL7_9PROT          ------------------------------------------------------------
B4WED0_9CAUL          ------------------------------------------------------------
D5VIW1_CAUST          ------------------------------------------------------------
Q0BS57_GRABC          ------------------------------------------------------------
C6XJ03_HIRBI          ------------------------------------------------------------
Q0ANE7_MARMM          ------------------------------------------------------------
Q0C0W7_HYPNA          ------------------------------------------------------------
E2CQN2_9RHOB          ------------------------------------------------------------
A7HXL1_PARL1          ------------------------------------------------------------
D8JWH2_HYPDA          ------------------------------------------------------------
E3I015_RHOVT          FEPTDTPEVETPTPARVATKPSGYRPPAGRKAGRGKRR----------------------
B0UI93_METS4          ------------------------------------------------------------
B2II62_BEII9          ------------------------------------------------------------
E6VHR2_RHOPX          ------------------------------------------------------------
A7IND7_XANP2          ------------------------------------------------------------
D5BQT4_PUNMI          ------------------------------------------------------------
Q2W4A8_MAGSA          ------------------------------------------------------------
B6ISI3_RHOCS          ------------------------------------------------------------
Q2NBX9_ERYLH          ------------------------------------------------------------
Q1GSE6_SPHAL          ------------------------------------------------------------
D4YYJ1_SPHJU          ------------------------------------------------------------
SECF_RHOCB            ------------------------------------------------------------
SECF_KETVY            ------------------------------------------------------------
D0D195_9RHOB          ------------------------------------------------------------
SECF_RICPR            ------------------------------------------------------------
A5CDU1_ORITB          ------------------------------------------------------------
B9KH24_ANAMF          ------------------------------------------------------------
Q2GI09_EHRCR          ------------------------------------------------------------
Q5GT97_WOLTR          ------------------------------------------------------------
C6V4R4_NEORI          ------------------------------------------------------------
C1D5X5_LARHH          ------------------------------------------------------------
B1XW93_LEPCP          ------------------------------------------------------------
B6BWI7_9PROT          ------------------------------------------------------------
A5EWX6_DICNV          ------------------------------------------------------------
C0N4C3_9GAMM          ------------------------------------------------------------
A5CVL6_VESOH          ------------------------------------------------------------
A1WXP7_HALHL          ------------------------------------------------------------
Q31FZ8_HYDCU          ------------------------------------------------------------
D3S9V5_THISK          ------------------------------------------------------------
D3RSH8_ALLVD          ------------------------------------------------------------
C7RB48_KANKD          ------------------------------------------------------------
A4GK29_9BACT          ------------------------------------------------------------
A4GHV4_9BACT          ------------------------------------------------------------
B8KFI4_9GAMM          ------------------------------------------------------------
Q21KV9_SACD2          ------------------------------------------------------------
Q2SDV4_HAHCH          ------------------------------------------------------------
E4PKE9_MARAH          ------------------------------------------------------------
A6VYM8_MARMS          ------------------------------------------------------------
E1V6F3_HALED          ------------------------------------------------------------
Q0VS96_ALCBS          ------------------------------------------------------------
B3PDJ9_CELJU          ------------------------------------------------------------
Q8GEL5_PSEPU          ------------------------------------------------------------
D0SG96_ACIJO          ------------------------------------------------------------
Q1QBR5_PSYCK          ------------------------------------------------------------
Q83CH4_COXBU          ------------------------------------------------------------
Q5ZU08_LEGPH          ------------------------------------------------------------
A0A0B3WJC7_FRATU      ------------------------------------------------------------
B8L1U9_9GAMM          ------------------------------------------------------------
D0KW98_HALNC          ------------------------------------------------------------
B7J4R6_ACIF2          ------------------------------------------------------------
SECF_ECOLI            ------------------------------------------------------------
Q8D162_YERPE          ------------------------------------------------------------
Q1LSN7_BAUCH          ------------------------------------------------------------
Q7VQA8_BLOFL          ------------------------------------------------------------
E8Q616_BLOVB          ------------------------------------------------------------
Q493H0_BLOPB          ------------------------------------------------------------
A0KJ23_AERHH          ------------------------------------------------------------
Q0HWQ6_SHESR          ------------------------------------------------------------
C4L7L0_TOLAT          ------------------------------------------------------------
Q5QVF2_IDILO          ------------------------------------------------------------
Q5E3D5_ALIF1          ------------------------------------------------------------
SECF_HAEIN            ------------------------------------------------------------
D4ZB75_SHEVD          ------------------------------------------------------------
C3LVV7_VIBCM          ------------------------------------------------------------
E1SV06_FERBD          ------------------------------------------------------------
A1S8J4_SHEAM          ------------------------------------------------------------
B7VU09_VIBTL          ------------------------------------------------------------
B7VQK9_VIBTL          ------------------------------------------------------------
Q15N35_PSEA6          ------------------------------------------------------------
Q3IL51_PSEHT          ------------------------------------------------------------
A0KLF0_AERHH          ------------------------------------------------------------
Q2RTI2_RHORT          ------------------------------------------------------------
C5ZWZ3_9HELI          ------------------------------------------------------------
C3XE90_9HELI          ------------------------------------------------------------
E7A9U2_HELFC          ------------------------------------------------------------
A8ERU7_ARCB4          ------------------------------------------------------------
D1B3G6_SULD5          ------------------------------------------------------------
A6Q513_NITSB          ------------------------------------------------------------
E4U019_SULKY          ------------------------------------------------------------
A7ZE41_CAMC1          ------------------------------------------------------------
E1YHR4_9DELT          ------------------------------------------------------------
A8ZW13_DESOH          ------------------------------------------------------------
B8F9E2_DESAL          ------------------------------------------------------------
E1QIL9_DESB2          ------------------------------------------------------------
C7LN35_DESBD          ------------------------------------------------------------
C4XR64_DESMR          ------------------------------------------------------------
C8X141_DESRD          ------------------------------------------------------------
B8J2Q5_DESDA          ------------------------------------------------------------
A0A0H3AA07_DESVV      ------------------------------------------------------------
Q1MSC2_LAWIP          ------------------------------------------------------------
Q3A3C5_PELCD          ------------------------------------------------------------
Q2LVH3_SYNAS          ------------------------------------------------------------
SECF_CALNY            ------------------------------------------------------------
D4H482_DENA2          ------------------------------------------------------------
SECF_MAGMM            ------------------------------------------------------------
SECF_DESIS            ------------------------------------------------------------
E8T6K2_THEA1          ------------------------------------------------------------
SECF_AQUAE            ------------------------------------------------------------
D3SMD0_THEAH          ------------------------------------------------------------
B4U6P7_HYDS0          ------------------------------------------------------------
C0QRM5_PERMH          ------------------------------------------------------------
SECF_PETMO            ------------------------------------------------------------
C5CF37_KOSOT          ------------------------------------------------------------
A7HMQ5_FERNB          ------------------------------------------------------------
A6LP85_THEM4          ------------------------------------------------------------
Q9WZW5_THEMA          ------------------------------------------------------------
B8JH53_ANAD2          ------------------------------------------------------------
Q1D3B7_MYXXD          ------------------------------------------------------------
E1X0T7_HALMS          ------------------------------------------------------------
Q6MKZ3_BDEBA          ------------------------------------------------------------
A9F8C8_SORC5          ------------------------------------------------------------
D0LJ87_HALO1          ------------------------------------------------------------
B3T9T6_9ZZZZ          ------------------------------------------------------------
D2BGI5_DEHMV          ------------------------------------------------------------
A9WGQ9_CHLAA          ------------------------------------------------------------
A9B5U8_HERA2          ------------------------------------------------------------
SECF_ANATU            ------------------------------------------------------------
SECF_THET1            ------------------------------------------------------------
D1C4J4_SPHTD          ------------------------------------------------------------
B4WJX7_SYNS7          ------------------------------------------------------------
SECF_ACAM1            ------------------------------------------------------------
A0A0H3K5W7_SYNP6      ------------------------------------------------------------
B8HQ25_CYAP4          ------------------------------------------------------------
SECF_SYNP2            ------------------------------------------------------------
SECF_SYNY3            ------------------------------------------------------------
D3EPH1_ATETH          ------------------------------------------------------------
Q2JKR7_SYNJB          ------------------------------------------------------------
Q7NDR5_GLOVI          ------------------------------------------------------------
SECF_PROMA            ------------------------------------------------------------
A2CA57_PROM3          ------------------------------------------------------------
Q46L53_PROMT          ------------------------------------------------------------
A5GTK4_SYNR3          ------------------------------------------------------------
Q7V1E6_PROMP          ------------------------------------------------------------
B5Y8Y1_COPPD          ------------------------------------------------------------
D4JXA7_9FIRM          ------------------------------------------------------------
E6UEG8_RUMA7          ------------------------------------------------------------
D4LA66_RUMC1          ------------------------------------------------------------
A0A2N0UMZ5_9FIRM      ------------------------------------------------------------
E1PK78_MAGIU          ------------------------------------------------------------
E6U7Q5_ETHHY          ------------------------------------------------------------
A3DDV8_HUNT2          ------------------------------------------------------------
B8I6M7_RUMCH          ------------------------------------------------------------
E0RMP8_PAEP6          ------------------------------------------------------------
C6D7X9_PAESJ          ------------------------------------------------------------
C0ZAP7_BREBN          ------------------------------------------------------------
SECF_ALIAD            ------------------------------------------------------------
Q5WHQ4_BACSK          ------------------------------------------------------------
D6XWY7_BACIE          ------------------------------------------------------------
B1YJQ6_EXIS2          ------------------------------------------------------------
B7R9G0_9THEO          ------------------------------------------------------------
D9TNU6_THETC          ------------------------------------------------------------
C6PXQ6_9CLOT          ------------------------------------------------------------
Q892A5_CLOTE          ------------------------------------------------------------
A6LTN3_CLOB8          ------------------------------------------------------------
Q97GT8_CLOAB          ------------------------------------------------------------
D9SMV1_CLOC7          ------------------------------------------------------------
A6TQN5_ALKMQ          ------------------------------------------------------------
E3GFZ4_9FIRM          ------------------------------------------------------------
D9TIR8_CALOO          ------------------------------------------------------------
D9RXQ1_THEOJ          ------------------------------------------------------------
D9QVJ2_ACEAZ          ------------------------------------------------------------
E4RIJ9_HALHG          ------------------------------------------------------------
B2A264_NATTJ          ------------------------------------------------------------
A0A1H8CTT8_9FIRM      ------------------------------------------------------------
D1BLM5_VEIPT          ------------------------------------------------------------
SECF_ACIFV            ------------------------------------------------------------
C8W4E2_DESAS          ------------------------------------------------------------
A5D3H0_PELTS          ------------------------------------------------------------
A4J545_DESRM          ------------------------------------------------------------
B1I4K4_DESAP          ------------------------------------------------------------
C9R7V2_AMMDK          ------------------------------------------------------------
B0TF82_HELMI          ------------------------------------------------------------
D5XEJ7_THEPJ          ------------------------------------------------------------
Q2RHU7_MOOTA          ------------------------------------------------------------
D7CLE8_SYNLT          ------------------------------------------------------------
Q0AX23_SYNWW          ------------------------------------------------------------
SECF_SEBTE            ------------------------------------------------------------
E3CUY4_9BACT          ------------------------------------------------------------
D5EDU6_AMICL          ------------------------------------------------------------
D4M8L9_9BACT          ------------------------------------------------------------
E6SLR1_THEM7          ------------------------------------------------------------
B5H469_STRC2          ------------------------------------------------------------
SECF_GEMAT            ------------------------------------------------------------
Q67LL9_SYMTH          ------------------------------------------------------------
C4RGU1_MICS3          AGA-----TPKVGARPAGKRSTGAR------GGRPAGGGGNRPGGA---KRR--------
D2S9H9_GEOOG          ESPE----SVRPDPRPSPRSGATAAP---RPGARPRPGAG-RSGGR---KRR--------
D3PYP6_STANL          DEPDDAEDTEERKSRPKALSNASAP----RPGARS--GDNKRPTGARKKKRR--------
SECF_MYCLE            --------VPTVLSKLAPGVRP------------VRPTGTRRPTGKRNNVGRR-------
B1MCI7_MYCA9          --------TSGTSDAAATGVRP------------AKPKPGARPQGKRNTRRH--------
Q5YTF3_NOCFA          --------APGGPARPRPN---------------AAPRPGARPSGKRHRRN---------
D0LCM9_GORB4          --------RPRTGRRSSGTRGE------------IIDAEAARPTGKRRRTR---------
D6Z7I7_SEGRD          ------------------------------------------------------------
D5UNI8_TSUPD          --------TAQRLSRP--------------------------PVRKRDRRRG--------
C3PGQ3_CORA7          --------AATQTESGPRSDE--------------SGGASWRP--GR-------------
Q79VF7_CORGL          --------AKRTVSKPIVDDH--------------RSSGTWRP--GRS------------
D9QAR8_CORP2          --------HKRTVSSPT------------------STGASWRP--QRR------------
C4LIX4_CORK4          --------ASRRRGSSRIVHHSDRDREAGRFHSREGGGASWRPDDNRRRNNSPFDGN---
Q4JVE2_CORJK          --------ADSTEDFKRETHN-------------EDAGRSWRP--GM-------------
B1VDK1_CORU7          --------AQRKQQ-PDTSGL-------------DTSGVSWRP--GM-------------
C6WCM8_ACTMD          --------KAFTAAAGVPARHAKA----------ADARRTNRPTGKKQR-----------
C7MR00_SACVD          --------KARAAAASVPARHPKS----------TAQRRPGRPTGKKKR-----------
C8XE15_NAKMY          --------RPDAKPGAAPKPGVKPVRPTGKTGPRGKSGSGPKPSGKRSR-----------
A0LUK2_ACIC1          --------------APGDASRRDAPADDGDDGD---GTPSAQPIASGAVI----------
D7BWW9_STRBB          --------------QDVTPQPR---AEDGDE---------PTPAAAGAGQ----------
Q0RNU2_FRAAA          --------------GEVAALSAGGAALADDPVGRPGGPGAREPVPAGAGLGGPGRRPPTA
D1AEV5_THECD          --------------GGGGTGGETDPAAAGDPAAAP-----QEPVRKVKVV----------
C7QJQ2_CATAD          --------------EEYPGDPEDFEAAAAGEQ--------TRDVPRGPRN----------
D7BNQ3_ARCHD          --------------DKLDPVETIA----GAHVGHHAQPKRKKKRKKR-------------
D6ZHF3_MOBCV          --------------QEITPAVVAAPMVPGHHKGQASQPKRKKNKK---------------
A0JXA8_ARTS2          ------------------------------------------------------------
C5CCH8_MICLC          --------------DDGARL----------------------------------------
D2NT09_ROTMD          --------------EKPAKKPARATIEIHRVNLNG-------------------------
B0REC3_CLAMS          ------------------------------------------------------------
Q6AFB1_LEIXX          ------------------------------------------------------------
A6WCH5_KINRD          ------------------------------------------------------------
D1BGW3_SANKS          --------------AETSQVQYVGQLSPGSHQGHAAQPRKRKGSR---------------
D1BSK2_XYLCX          ---------------ELAVAGVVTQLRPGQHLGQGAQPRKKR------------------
C7MCC3_BRAFD          --------------AAGTDAHTAGGRRRRTIHRGSR------------------------
E6SB76_INTC7          ------------------GADGVGEPVAPGPVPSAARPVHKYVQAGPRN-----------
C7NI43_KYTSD          --------------ETGQDAEETGQDAEETERTRRGRALTDEVEGAGRTI----------
Q83MZ6_TROWT          ------------------------------------------------------------
D4HDX0_CUTAS          ------------------AAEGPRDVTTITGSD---------------------------
D7GDS8_PROFC          ------------GGATVSSVEGTADHDVSASAHEGGGPTARQMRDV--------------
D2PVF2_KRIFD          ------------GATGATAAPAGATRVQDVRPKSKGVTAGTPVASNRPVK----------
A1SJB0_NOCSJ          DEPGVADVPEGDGPVARPASPGRAPQTPEAAGRGRIAPQGHGPVRP--------------
C7LYS7_ACIFD          ------------------------------------------------------------
Q1AWC9_RUBXD          ------------------------------------------------------------
E1QZN4_OLSUV          ------------------------------------------------------------
D8IEE2_BRAP9          ------------------------------------------------------------
                                                                                  

E1R5K6_SEDSS          ------------------------
E0RQA8_SPITD          ------------------------
SECF_BORBU            ------------------------
SECF_TREPA            ------------------------
Q73PW5_TREDE          ------------------------
B0SPU5_LEPBP          ------------------------
Q72PD4_LEPIC          ------------------------
SECF_DICTD            ------------------------
B0VHR6_CLOAI          ------------------------
A1BCH7_CHLPD          ------------------------
SECF_RHOM4            ------------------------
Q9WXE9_PRERU          ------------------------
D5MHP4_9BACT          ------------------------
D8PI88_9BACT          ------------------------
B6ANM4_9BACT          ------------------------
B5ECA5_GEOBB          ------------------------
B3E2R7_GEOLS          ------------------------
SECF_THEYD            ------------------------
SECF_KORVE            ------------------------
E8X5J9_GRATM          ------------------------
Q029K3_SOLUE          ------------------------
SECF_ELUMP            ------------------------
SECF_UNCTG            ------------------------
D0RNY4_9PROT          ------------------------
B6BPL7_9PROT          ------------------------
B4WED0_9CAUL          ------------------------
D5VIW1_CAUST          ------------------------
Q0BS57_GRABC          ------------------------
C6XJ03_HIRBI          ------------------------
Q0ANE7_MARMM          ------------------------
Q0C0W7_HYPNA          ------------------------
E2CQN2_9RHOB          ------------------------
A7HXL1_PARL1          ------------------------
D8JWH2_HYPDA          ------------------------
E3I015_RHOVT          ------------------------
B0UI93_METS4          ------------------------
B2II62_BEII9          ------------------------
E6VHR2_RHOPX          ------------------------
A7IND7_XANP2          ------------------------
D5BQT4_PUNMI          ------------------------
Q2W4A8_MAGSA          ------------------------
B6ISI3_RHOCS          ------------------------
Q2NBX9_ERYLH          ------------------------
Q1GSE6_SPHAL          ------------------------
D4YYJ1_SPHJU          ------------------------
SECF_RHOCB            ------------------------
SECF_KETVY            ------------------------
D0D195_9RHOB          ------------------------
SECF_RICPR            ------------------------
A5CDU1_ORITB          ------------------------
B9KH24_ANAMF          ------------------------
Q2GI09_EHRCR          ------------------------
Q5GT97_WOLTR          ------------------------
C6V4R4_NEORI          ------------------------
C1D5X5_LARHH          ------------------------
B1XW93_LEPCP          ------------------------
B6BWI7_9PROT          ------------------------
A5EWX6_DICNV          ------------------------
C0N4C3_9GAMM          ------------------------
A5CVL6_VESOH          ------------------------
A1WXP7_HALHL          ------------------------
Q31FZ8_HYDCU          ------------------------
D3S9V5_THISK          ------------------------
D3RSH8_ALLVD          ------------------------
C7RB48_KANKD          ------------------------
A4GK29_9BACT          ------------------------
A4GHV4_9BACT          ------------------------
B8KFI4_9GAMM          ------------------------
Q21KV9_SACD2          ------------------------
Q2SDV4_HAHCH          ------------------------
E4PKE9_MARAH          ------------------------
A6VYM8_MARMS          ------------------------
E1V6F3_HALED          ------------------------
Q0VS96_ALCBS          ------------------------
B3PDJ9_CELJU          ------------------------
Q8GEL5_PSEPU          ------------------------
D0SG96_ACIJO          ------------------------
Q1QBR5_PSYCK          ------------------------
Q83CH4_COXBU          ------------------------
Q5ZU08_LEGPH          ------------------------
A0A0B3WJC7_FRATU      ------------------------
B8L1U9_9GAMM          ------------------------
D0KW98_HALNC          ------------------------
B7J4R6_ACIF2          ------------------------
SECF_ECOLI            ------------------------
Q8D162_YERPE          ------------------------
Q1LSN7_BAUCH          ------------------------
Q7VQA8_BLOFL          ------------------------
E8Q616_BLOVB          ------------------------
Q493H0_BLOPB          ------------------------
A0KJ23_AERHH          ------------------------
Q0HWQ6_SHESR          ------------------------
C4L7L0_TOLAT          ------------------------
Q5QVF2_IDILO          ------------------------
Q5E3D5_ALIF1          ------------------------
SECF_HAEIN            ------------------------
D4ZB75_SHEVD          ------------------------
C3LVV7_VIBCM          ------------------------
E1SV06_FERBD          ------------------------
A1S8J4_SHEAM          ------------------------
B7VU09_VIBTL          ------------------------
B7VQK9_VIBTL          ------------------------
Q15N35_PSEA6          ------------------------
Q3IL51_PSEHT          ------------------------
A0KLF0_AERHH          ------------------------
Q2RTI2_RHORT          ------------------------
C5ZWZ3_9HELI          ------------------------
C3XE90_9HELI          ------------------------
E7A9U2_HELFC          ------------------------
A8ERU7_ARCB4          ------------------------
D1B3G6_SULD5          ------------------------
A6Q513_NITSB          ------------------------
E4U019_SULKY          ------------------------
A7ZE41_CAMC1          ------------------------
E1YHR4_9DELT          ------------------------
A8ZW13_DESOH          ------------------------
B8F9E2_DESAL          ------------------------
E1QIL9_DESB2          ------------------------
C7LN35_DESBD          ------------------------
C4XR64_DESMR          ------------------------
C8X141_DESRD          ------------------------
B8J2Q5_DESDA          ------------------------
A0A0H3AA07_DESVV      ------------------------
Q1MSC2_LAWIP          ------------------------
Q3A3C5_PELCD          ------------------------
Q2LVH3_SYNAS          ------------------------
SECF_CALNY            ------------------------
D4H482_DENA2          ------------------------
SECF_MAGMM            ------------------------
SECF_DESIS            ------------------------
E8T6K2_THEA1          ------------------------
SECF_AQUAE            ------------------------
D3SMD0_THEAH          ------------------------
B4U6P7_HYDS0          ------------------------
C0QRM5_PERMH          ------------------------
SECF_PETMO            ------------------------
C5CF37_KOSOT          ------------------------
A7HMQ5_FERNB          ------------------------
A6LP85_THEM4          ------------------------
Q9WZW5_THEMA          ------------------------
B8JH53_ANAD2          ------------------------
Q1D3B7_MYXXD          ------------------------
E1X0T7_HALMS          ------------------------
Q6MKZ3_BDEBA          ------------------------
A9F8C8_SORC5          ------------------------
D0LJ87_HALO1          ------------------------
B3T9T6_9ZZZZ          ------------------------
D2BGI5_DEHMV          ------------------------
A9WGQ9_CHLAA          ------------------------
A9B5U8_HERA2          ------------------------
SECF_ANATU            ------------------------
SECF_THET1            ------------------------
D1C4J4_SPHTD          ------------------------
B4WJX7_SYNS7          ------------------------
SECF_ACAM1            ------------------------
A0A0H3K5W7_SYNP6      ------------------------
B8HQ25_CYAP4          ------------------------
SECF_SYNP2            ------------------------
SECF_SYNY3            ------------------------
D3EPH1_ATETH          ------------------------
Q2JKR7_SYNJB          ------------------------
Q7NDR5_GLOVI          ------------------------
SECF_PROMA            ------------------------
A2CA57_PROM3          ------------------------
Q46L53_PROMT          ------------------------
A5GTK4_SYNR3          ------------------------
Q7V1E6_PROMP          ------------------------
B5Y8Y1_COPPD          ------------------------
D4JXA7_9FIRM          ------------------------
E6UEG8_RUMA7          ------------------------
D4LA66_RUMC1          ------------------------
A0A2N0UMZ5_9FIRM      ------------------------
E1PK78_MAGIU          ------------------------
E6U7Q5_ETHHY          ------------------------
A3DDV8_HUNT2          ------------------------
B8I6M7_RUMCH          ------------------------
E0RMP8_PAEP6          ------------------------
C6D7X9_PAESJ          ------------------------
C0ZAP7_BREBN          ------------------------
SECF_ALIAD            ------------------------
Q5WHQ4_BACSK          ------------------------
D6XWY7_BACIE          ------------------------
B1YJQ6_EXIS2          ------------------------
B7R9G0_9THEO          ------------------------
D9TNU6_THETC          ------------------------
C6PXQ6_9CLOT          ------------------------
Q892A5_CLOTE          ------------------------
A6LTN3_CLOB8          ------------------------
Q97GT8_CLOAB          ------------------------
D9SMV1_CLOC7          ------------------------
A6TQN5_ALKMQ          ------------------------
E3GFZ4_9FIRM          ------------------------
D9TIR8_CALOO          ------------------------
D9RXQ1_THEOJ          ------------------------
D9QVJ2_ACEAZ          ------------------------
E4RIJ9_HALHG          ------------------------
B2A264_NATTJ          ------------------------
A0A1H8CTT8_9FIRM      ------------------------
D1BLM5_VEIPT          ------------------------
SECF_ACIFV            ------------------------
C8W4E2_DESAS          ------------------------
A5D3H0_PELTS          ------------------------
A4J545_DESRM          ------------------------
B1I4K4_DESAP          ------------------------
C9R7V2_AMMDK          ------------------------
B0TF82_HELMI          ------------------------
D5XEJ7_THEPJ          ------------------------
Q2RHU7_MOOTA          ------------------------
D7CLE8_SYNLT          ------------------------
Q0AX23_SYNWW          ------------------------
SECF_SEBTE            ------------------------
E3CUY4_9BACT          ------------------------
D5EDU6_AMICL          ------------------------
D4M8L9_9BACT          ------------------------
E6SLR1_THEM7          ------------------------
B5H469_STRC2          ------------------------
SECF_GEMAT            ------------------------
Q67LL9_SYMTH          ------------------------
C4RGU1_MICS3          ------------------------
D2S9H9_GEOOG          ------------------------
D3PYP6_STANL          ------------------------
SECF_MYCLE            ------------------------
B1MCI7_MYCA9          ------------------------
Q5YTF3_NOCFA          ------------------------
D0LCM9_GORB4          ------------------------
D6Z7I7_SEGRD          ------------------------
D5UNI8_TSUPD          ------------------------
C3PGQ3_CORA7          ------------------------
Q79VF7_CORGL          ------------------------
D9QAR8_CORP2          ------------------------
C4LIX4_CORK4          ------------------------
Q4JVE2_CORJK          ------------------------
B1VDK1_CORU7          ------------------------
C6WCM8_ACTMD          ------------------------
C7MR00_SACVD          ------------------------
C8XE15_NAKMY          ------------------------
A0LUK2_ACIC1          ---RRQ-QANARRRGRPSSKKRRR
D7BWW9_STRBB          ---RRQPTSRGRGRGRPSGKRR--
Q0RNU2_FRAAA          GAARRAGGRKPGRRGRPSGKKRR-
D1AEV5_THECD          ----QTGPRRQPRRGTRRQRRRGR
C7QJQ2_CATAD          -----QPVRGDRGRNRPSGKRR--
D7BNQ3_ARCHD          ------------------------
D6ZHF3_MOBCV          ------------------------
A0JXA8_ARTS2          ------------------------
C5CCH8_MICLC          ------------------------
D2NT09_ROTMD          ------------------------
B0REC3_CLAMS          ------------------------
Q6AFB1_LEIXX          ------------------------
A6WCH5_KINRD          ------------------------
D1BGW3_SANKS          ------------------------
D1BSK2_XYLCX          ------------------------
C7MCC3_BRAFD          ------------------------
E6SB76_INTC7          ------QPRRPPKSKR--------
C7NI43_KYTSD          --AGGGRPRHPSAWAGN-------
Q83MZ6_TROWT          ------------------------
D4HDX0_CUTAS          --------RHQPRRSTRAERKK--
D7GDS8_PROFC          -----GDGRAQPVRTPRSKRKK--
D2PVF2_KRIFD          --STGAAGRPQPTRKPRSKRGK--
A1SJB0_NOCSJ          ---SSAAGRQQPTRQPRSKRGKK-
C7LYS7_ACIFD          ------------------------
Q1AWC9_RUBXD          ------------------------
E1QZN4_OLSUV          ------------------------
D8IEE2_BRAP9          ------------------------