CLUSTAL format seed alignment for MF_01465

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SECY_TRICV            ------------------------------------------------------------
C6KIV7_9STRA          ------------------------------------------------------------
D2ISB1_9CRYP          ------------------------------------------------------------
SECY_HETA2            ------------------------------------------------------------
SECY_VAULI            ------------------------------------------------------------
SECY_CYAPA            ------------------------------------------------------------
SECY_EMIHU            ------------------------------------------------------------
SECY_DIALT            ------------------------------------------------------------
SECY_SYNY3            ------------------------------------------------------------
SECY_ANTSP            ------------------------------------------------------------
SECY_CYACA            ------------------------------------------------------------
SECY_CYAM1            ------------------------------------------------------------
SECY_LACLC            ------------------------------------------------------------
Q04G66_OENOB          ------------------------------------------------------------
SECY2_LACKZ           ------------------------------------------------------------
SECY_STAEQ            ------------------------------------------------------------
SECY_BACLD            ------------------------------------------------------------
B5ZB59_UREU1          ------------------------------------------------------------
Q8EUD2_MYCPE          ------------------------------------------------------------
SECY_MYCGA            ------------------------------------------------------------
E8ZJY0_MYCHL          ------------------------------------------------------------
F0QR54_MYCSL          ------------------------------------------------------------
SECY_MYCCT            ------------------------------------------------------------
B3PMM8_MYCA5          ------------------------------------------------------------
D1J867_MYCHP          ------------------------------------------------------------
Q6KI36_MYCMO          ------------------------------------------------------------
Q4A8J0_MYCH7          ------------------------------------------------------------
C4XFZ5_MYCFP          --------------------------------------------------------MVVY
D4JDN6_9FIRM          ------------------------------------------------------------
E7FW44_ERYRH          ------------------------------------------------------------
SECY_MYCBO            ------------------------------------------------------------
A9WST8_RENSM          ------------------------------------------------------------
A1A089_BIFAA          ------------------------------------------------------------
C7M2Z2_ACIFD          ------------------------------------------------------------
C7MP31_CRYCD          ------------------------------------------------------------
Q1AU49_RUBXD          ------------------------------------------------------------
D3QZ81_MAGIU          ------------------------------------------------------------
D1VTM8_9FIRM          ------------------------------------------------------------
B0RZS9_FINM2          ------------------------------------------------------------
Q18CH6_CLOD6          ------------------------------------------------------------
F4XGV5_9FIRM          ------------------------------------------------------------
E6UBM7_RUMA7          ------------------------------------------------------------
A9KJH4_LACP7          ------------------------------------------------------------
D9QZP1_CLOSW          ------------------------------------------------------------
F2JSH2_CELLD          ------------------------------------------------------------
C7H0Y9_9FIRM          ------------------------------------------------------------
B8D0S8_HALOH          ------------------------------------------------------------
C9KPC7_9FIRM          ------------------------------------------------------------
C9LN14_9FIRM          ------------------------------------------------------------
A4XLR1_CALS8          ------------------------------------------------------------
B0TC76_HELMI          ------------------------------------------------------------
F0SY27_SYNGF          ------------------------------------------------------------
SECY_THET8            ------------------------------------------------------------
Q1IX92_DEIGD          ------------------------------------------------------------
SECY_THEMA            ------------------------------------------------------------
B9K8A6_THENN          ------------------------------------------------------------
C9M915_9BACT          ------------------------------------------------------------
D5EE00_AMICL          ------------------------------------------------------------
B5YDW2_DICT6          ------------------------------------------------------------
D9SX80_CLOC7          ------------------------------------------------------------
A6LPT1_CLOB8          ------------------------------------------------------------
B5Y968_COPPD          ------------------------------------------------------------
SECY_ECOLI            ------------------------------------------------------------
SECY_HAEIN            ------------------------------------------------------------
SECY_BUCBP            ------------------------------------------------------------
Q7WZR8_9GAMM          ------------------------------------------------------------
A5EX98_DICNV          ------------------------------------------------------------
SECY_RICBR            ------------------------------------------------------------
B3CT25_ORITI          ------------------------------------------------------------
Q5GSW3_WOLTR          ------------------------------------------------------------
Q2GEC0_NEOSM          ------------------------------------------------------------
B2KEK2_ELUMP          ------------------------------------------------------------
E1X0K2_HALMS          ------------------------------------------------------------
SECY_BORBU            ------------------------------------------------------------
O83238_TREPA          ------------------------------------------------------------
SECY_HELPJ            ------------------------------------------------------------
D3UIH0_HELM1          ------------------------------------------------------------
SECY_AQUAE            ------------------------------------------------------------
D3DH80_HYDTT          ------------------------------------------------------------
E8T4B5_THEA1          ------------------------------------------------------------
D4H3A7_DENA2          ------------------------------------------------------------
D3P918_DEFDS          ------------------------------------------------------------
E4TEN9_CALNY          ------------------------------------------------------------
E6W730_DESIS          ------------------------------------------------------------
B8IYL1_DESDA          ------------------------------------------------------------
Q1MPP6_LAWIP          ------------------------------------------------------------
C1A6S5_GEMAT          ------------------------------------------------------------
C9RR14_FIBSS          ------------------------------------------------------------
Q1D755_MYXXD          ------------------------------------------------------------
C1F622_ACIC5          ------------------------------------------------------------
E8WZ43_GRATM          ------------------------------------------------------------
Q1ISA2_KORVE          ------------------------------------------------------------
D5UB65_BRAM5          ------------------------------------------------------------
E8R478_ISOPI          ------------------------------------------------------------
D5SQ93_PLAL2          ------------------------------------------------------------
D2R6I9_PIRSD          ------------------------------------------------------------
Q1Q157_KUEST          ------------------------------------------------------------
SECY_CHLTR            ------------------------------------------------------------
B2UQN0_AKKM8          ------------------------------------------------------------
B3E0K3_METI4          ------------------------------------------------------------
D5EJU0_CORAD          ------------------------------------------------------------
A6DRC9_9BACT          ------------------------------------------------------------
D0JAT9_BLASB          ------------------------------------------------------------
C6X1Y0_FLAB3          ------------------------------------------------------------
F4KXT7_HALH1          ------------------------------------------------------------
D1AVF8_STRM9          ------------------------------------------------------------
C7NDL7_LEPBD          ------------------------------------------------------------
E3H907_ILYPC          ------------------------------------------------------------
E0XPY0_9BACT          ------------------------------------------------------------
A0A142V9H9_9CHLR      ------------------------------------------------------------
B8G6Q5_CHLAD          ------------------------------------------------------------
E8N3P4_ANATU          ------------------------------------------------------------
C8WTV3_ALIAD          ------------------------------------------------------------
E3SG16_9MOLU          ------------------------------------------------------------
B2LW75_9MOLU          ------------------------------------------------------------
B1VAC8_PHYAS          ------------------------------------------------------------
A9NEF3_ACHLI          ------------------------------------------------------------
SECY_ARCFU            ------------------------------------------------------------
D2RE43_ARCPA          ------------------------------------------------------------
A0B9U7_METTP          ------------------------------------------------------------
D3SWN3_NATMM          ------------------------------------------------------------
D2RUE9_HALTV          ------------------------------------------------------------
Q2FSG8_METHJ          ------------------------------------------------------------
Q2QAQ7_9EURY          -MAPFYAILVSIPYVGFIIWGTSTDLSEQVKEIKFIGRALKPMIWLSFFLGAIIWGLYDS
B5ICT8_ACIB4          MSEEEIPRKKGLALPVLISWIVFTYLYFSIVNWKLLGLQ-------------EMWKIMTV
SECY_METVA            ------------------------------------------------------------
A6UWW1_META3          ------------------------------------------------------------
SECY_METJA            ------------------------------------------------------------
SECY_METTH            ------------------------------------------------------------
SECY_PYRFU            ------------------------------------------------------------
SECY_PYRAB            ------------------------------------------------------------
B1L789_KORCO          ------------------------------------------------------------
A0RUE4_CENSY          ------------------------------------------------------------
SECY_SACS2            ------------------------------------------------------------
SECY_SULAC            ------------------------------------------------------------
SECY_AERPE            ------------------------------------------------------------
                                                                                  

SECY_TRICV            ----------------------------------------------MKQTDDKDSLLNRL
C6KIV7_9STRA          ----------------------------------------MNINFNSKSATNKKTLLERT
D2ISB1_9CRYP          ----------------------------------------------------MDELLEKY
SECY_HETA2            ------------------MTLEKNKDSFTNIIDLSLINKEQKVTFTPTKEIYTELLKKRL
SECY_VAULI            -------------------------------------------MNTKLQDSKSPRLKNRI
SECY_CYAPA            ------MLSRLIISIFIIFETIYLQIFKPVNKTFKQGEAKLKRTLQTLQSRELSEIRKRA
SECY_EMIHU            ----------------------------------------------MEQSTTRSLLKGKI
SECY_DIALT            ---------------------------------------------MKKAFVLEGPLVLRL
SECY_SYNY3            --------------------------------MVVSRDKAPSAQETFLQMAQAAGLRGRL
SECY_ANTSP            -------------------------------------------------MKQPTTNKLRF
SECY_CYACA            -------------------------------------------------MRPENNLRLRL
SECY_CYAM1            ---------------------------------------------------MQDNWPTRL
SECY_LACLC            -----------------------------------------MFFKTLKEAFKVKDVRARI
Q04G66_OENOB          ------------------------------------------MFSLLIKALKQKEIRVRI
SECY2_LACKZ           ------------------------------------------------------------
SECY_STAEQ            ------------------------------------------MFQTFVRFFTTKEVRNKI
SECY_BACLD            ------------------------------------------MFKTISNFMRVKDIRNKI
B5ZB59_UREU1          ---------------------------------MTNKQKKKNAFRQLLMIFKNKKVLVAL
Q8EUD2_MYCPE          ------------------------------MNNLSTYQNKKSFWNELKQIFTNKQVLVSF
SECY_MYCGA            ---------------------------------MAKTNSKNLLGQKIIKLLRNRDFVISV
E8ZJY0_MYCHL          ------------------------------------------------MVRGNRDTWVAI
F0QR54_MYCSL          --------------------------------------------------------MISL
SECY_MYCCT            -------------------MVIKKPANKVDKKSTFKSSNKKKNPFKSSFLTKNKDLIYRI
B3PMM8_MYCA5          -------------MAKKNAQLEREKNTEKLERKLAIDQFLNERRNSWQDWWRNHDLFKKI
D1J867_MYCHP          --------------MARKTKLEKEISQEKIERKLALDKFLVDKKNTWNEWWKNHNLFKKI
Q6KI36_MYCMO          -------------MIPKIKDFFANIPT-------SIAKYFFILRNAWKDFRKKRALLNKI
Q4A8J0_MYCH7          -------------MLKLLAKVW-----------LGINSAYVSLKNRAYFAYREKILARKL
C4XFZ5_MYCFP          YIIIKYFIRDKVELVFAMKVRVEYMKKFFSNVGFKISKFFYNFKNKWIVFWSTKEITKKL
D4JDN6_9FIRM          ------------------------------------------MAFRGKAIFTNKDIRNRI
E7FW44_ERYRH          ------------------------------------------MRFF-TDLFKNKEIRIRI
SECY_MYCBO            ------------------------------------------MLSAFISSLRTVDLRRKI
A9WST8_RENSM          ------------------------MVGHGGPTSSEPITSGGRLLSAFGRAFRTPDLRRKL
A1A089_BIFAA          -------------------------------MRRCARRWKEPQVRTLIQALKTKELRNKI
C7M2Z2_ACIFD          ------------------------------------------MIENFLNIVRVRDLRNKV
C7MP31_CRYCD          ------------------------------------------MLKSLVEAFKVPELRNKI
Q1AU49_RUBXD          ------------------------------------------MLGSLANAWKIPELRQKL
D3QZ81_MAGIU          ---------------------------------------MKYVIETLRKAFNVGDMRKRI
D1VTM8_9FIRM          ------------------------------------------MLSTFKNAWKIPQLRKKM
B0RZS9_FINM2          ------------------------------------------MLKTLKDSWKVLDIRKRI
Q18CH6_CLOD6          ------------------------------------------MLSKLKQAWKIKAVRKKV
F4XGV5_9FIRM          ------------------------------------------MIKTVRDAWKIPELRNKI
E6UBM7_RUMA7          ------------------------------------------MIETFRNAWKVPELRRKL
A9KJH4_LACP7          ------------------------------------------MLKTVRNAFKIKDIRNKL
D9QZP1_CLOSW          ------------------------------------------MLKTLRNAFKIKDLRKKL
F2JSH2_CELLD          ----------------------------------------MDLFKTLRNAWKVPELRNKL
C7H0Y9_9FIRM          ------------------------------------------MFRTLAKAWKKQDIRHKM
B8D0S8_HALOH          ------------------------------------------MISALKNAFKVKEIRKKI
C9KPC7_9FIRM          ------------------------------------------MLSALGNIFKIPELRQKI
C9LN14_9FIRM          ------------------------------------------MGSAFANFAANKELKDRV
A4XLR1_CALS8          ------------------------------------------MFETIKNAWRLPDLRRKI
B0TC76_HELMI          ---------------------------------------MSTLVGTLQNAWKLPDLRSKI
F0SY27_SYNGF          ----------------------------------------MALLETLKDAWQVPTIRKKI
SECY_THET8            ------------------------------------------MLKAFWSALQIPELRQRV
Q1IX92_DEIGD          ------------------------------------------MLRAFRDAFRIPDLRRKI
SECY_THEMA            ------------------------------------------MWQAFKNAFKIPELRDRI
B9K8A6_THENN          ------------------------------------------MWQALRNAFKIPELRSRI
C9M915_9BACT          ------------------------------------------MANSFRDVFKLPELKRRI
D5EE00_AMICL          ------------------------------------------MLDSFRDAFKLPDLKRRI
B5YDW2_DICT6          ------------------------------------------MFDTLLRAFRIPDLRKKI
D9SX80_CLOC7          ------------------------------------------MLSTLRNAWKVKDIRGKI
A6LPT1_CLOB8          ------------------------------------------MLQTLSNAFKVPELRKKI
B5Y968_COPPD          ------------------------------------------MWQVLKASWEFKETRVRI
SECY_ECOLI            -------------------------------------MAKQPGLDFQSAKGGLGELKRRL
SECY_HAEIN            -------------------------------------MAKQPGYQARSTNSGKGELKSRL
SECY_BUCBP            ------------------------------------MIKKKLETKLKNFGNQFSELKQRM
Q7WZR8_9GAMM          -----------------------------------------------MISKIYQDIINKM
A5EX98_DICNV          --------------------------------------------MAKPAANPYKELSSRI
SECY_RICBR            -----------------------------------------MNQN--FSKKSSNDLINRI
B3CT25_ORITI          -----------------------------------------MQNS--SFYDQHATLISKV
Q5GSW3_WOLTR          -----------------------------------MGSKSAFNSLDPALLYKG-DLLRRM
Q2GEC0_NEOSM          -----------------------------------------MNQSNFGLLFSSKDLFHRL
B2KEK2_ELUMP          -----------------------------------------MANNTVANIFNAPELKKRL
E1X0K2_HALMS          ---------------------------------------------MSTAHGKLEELKKKV
SECY_BORBU            ------------------------------------------MKELFLSLFTVKDLRNKF
O83238_TREPA          -----------------------------------------MKQGVFAAVFRIRELRARI
SECY_HELPJ            ---------------------------------------------------MNKAIASKI
D3UIH0_HELM1          ---------------------------------------------------MNKTIVNKI
SECY_AQUAE            ------------------------------------------MSEYLKALFELKELRQKF
D3DH80_HYDTT          ------------------------------------------MVEYIKQLLALEDFRKRF
E8T4B5_THEA1          ----------------------------------------MNLSKIFANVTAVPELRRRF
D4H3A7_DENA2          ------------------------------------------MFKKVEEIFSIPELRRRI
D3P918_DEFDS          -------------------------------------------MKKIEEIFSIPDLRKRV
E4TEN9_CALNY          ------------------------------------------MFKKIEDIFSVPELRKRI
E6W730_DESIS          ------------------------------------------MLGAFKHIFTLPDLRKKV
B8IYL1_DESDA          -----------------------------------------MAVGTANTVAGQPSLFKRL
Q1MPP6_LAWIP          -----------------------------------------MAVSTTTLNAA-PELKIKL
C1A6S5_GEMAT          -----------------------------------MADQNNPAAQAVANIYRTPELWAKI
C9RR14_FIBSS          ------------------------------------MEALKKAIDAFVNAFKIEELRKKI
Q1D755_MYXXD          -----------------------------------------MALNAFANVFRIAELRSRL
C1F622_ACIC5          ------------------------------------------MFEKFANIFKIPDLRNRV
E8WZ43_GRATM          ------------------------------------------MFEKIANIFRIEDLRKRV
Q1ISA2_KORVE          ------------------------------------------MFEKLANIFRIPDLRKRV
D5UB65_BRAM5          ------------------------------------------MLKSLANIFKVQELRSRI
E8R478_ISOPI          -----------------------------------------MALPFVGTLRTMPELTNKL
D5SQ93_PLAL2          ------------------------------------------MFSQLAMIFRIPELRQKI
D2R6I9_PIRSD          ------------------------------------------MWQKFRAIFTIPELRQKI
Q1Q157_KUEST          ------------------------------------------MIEQFGNVFRIPELRKKV
SECY_CHLTR            -------------------------------------------MATLRQVFSISELRQKI
B2UQN0_AKKM8          ------------------------------------------MISAFANSMKVPELRRRI
B3E0K3_METI4          ------------------------------------------MLSAFVNVFKIPELRSRI
D5EJU0_CORAD          ------------------------------------------MLSAFTNSLKIPELRQRI
A6DRC9_9BACT          ------------------------------------------MLSAFQNMLKVQDLRKKL
D0JAT9_BLASB          ---------------------------------------MDNLLRSFYHIWNIKELRKKI
C6X1Y0_FLAB3          ---------------------------------------MKEFIQTLKNIWSLKELREKI
F4KXT7_HALH1          ---------------------------------------MKRFLTTLRNIWDIKELRTRI
D1AVF8_STRM9          ------------------------------------MTFKEAIVGRFQAIVRTRELRKRV
C7NDL7_LEPBD          ------------------------------------MTLAEAVTSRVKAIFNIPELEKRV
E3H907_ILYPC          ------------------------------------MTLLERFNEKVNAIGKIPELKQKI
E0XPY0_9BACT          ----------------------------MTQAKQASEFAVPALFRAAADAWRIPDLRFRI
A0A142V9H9_9CHLR      -------------------------------MRQKS--SRPRLLQAMIDAFSLPDLRRRL
B8G6Q5_CHLAD          ------------------------------------------MLQAVLRAIQLPDLRRRI
E8N3P4_ANATU          -----------------------------------------MKRSAWRYLWKSVDIRQKL
C8WTV3_ALIAD          ------------------------------------------MWQAIANLWRLKHLRKRI
E3SG16_9MOLU          ------------------------------------------MKMVINFLRDKSKIIKKI
B2LW75_9MOLU          ------------------------------------------MKKIINFFSNKKDIIKKI
B1VAC8_PHYAS          ------------------------------------------MKHKLKLILGNPKLIFQI
A9NEF3_ACHLI          ------------------------------------------MWQRIKNVLANNSVMARV
SECY_ARCFU            -----------------------------MDSVIRALQPYFERIPSVERPKGHVHFREKF
D2RE43_ARCPA          ---------------------------MDINDVLRRLQPYFERIPSVERPKGHVPFKEKF
A0B9U7_METTP          ---------------------------MNQQSFFYAIEPFVRRLPAVERPAGHVHFKRKL
D3SWN3_NATMM          ------------------------------MGWKEAAEPVLTRMPAVRRPEGHVPFKRKL
D2RUE9_HALTV          ------------------------------MGWKEAAEPVLTRMPTVRRPEGHVPFKRKL
Q2FSG8_METHJ          -----------------------------MGEILDRMEPILAKMPAVKTPEGHVHFKNKL
Q2QAQ7_9EURY          SMVGFLLVGIILMGLMSGLCLACLLYTGDESSRLYGLKRLVDVYPSITKPEGHVRFNSKL
B5ICT8_ACIB4          QWVDFLVYVLWSVPLFY-LGYLIVSYNGDKS-KLYGLKPVLDYLPIIRKPKGHVQFKHKL
SECY_METVA            ----------------------------------MKIKPILELIPEVKRPLKGVSFKEKI
A6UWW1_META3          -----------------------------MEEFLKKIRPILEYIPEVQRPIREITFKEKL
SECY_METJA            ---------------------------------MKKLIPILEKIPEVELPVKEITFKEKL
SECY_METTH            -----------------------------MEQLKEKFEPLFSVLPQVKSPGYRVPFREKL
SECY_PYRFU            ------------------------------MGARDIIYALERWFPEVERPKRRVPLRERF
SECY_PYRAB            ------------------------------MGARDIIYAIEKWFPEVERPKKHVPLKEKF
B1L789_KORCO          -----------------------------MSLVRQIVSKMNKGIPEVERPKRSPTLKEKL
A0RUE4_CENSY          -----------------------MAEGTATALIRKMVLVAEPYLPQVPKPKKKLSLQTRL
SECY_SACS2            ------------------------------MSFIDSLATLGQYLPAVTKPKEKPSLGQKL
SECY_SULAC            ------------------------------MGFMDFLAKMGENLPAVSKPKDKPTLTRKL
SECY_AERPE            ------------------------------MGVIDVLAAVGERFPAVRKPERKPTLYRRL
                                                                                  

SECY_TRICV            LLSLGILLFIRMGTFLPVPGIDHGHLEFYIERHFRLRTL---------VSTFAGDN-TVV
C6KIV7_9STRA          LITLAVIAAVRFGTFIPIPGVDQSYLYTELKNS-QILNF---------ISSFSQGN-FFV
D2ISB1_9CRYP          VITLGLLILSRLGMFIPLPGIDYESFYSINRYN-SALQN---------VITFSGHG-LTF
SECY_HETA2            LTIALLVFIIKIGMAIPLPYIDQTKLLNNATSMFDLS--------GPGLAAVSARA-SQK
SECY_VAULI            LLTISLLTIVRIGSFIPVPYITKEVLVNLLSAENSSNNTF-----AQLLNTFSGGG-NSS
SECY_CYAPA            ISTLCLIFLIRIGTFLPIPGTALNFDLESFQQN-NSRNEL-----ANILNLLSGGA-FLE
SECY_EMIHU            LKILTLLLLVRLGLYIPVPGV----ELDILTQG-QTSNPM-----FGFAKTLVGNS-FLG
SECY_DIALT            FRTIMILIFARLGNYIPIPGITEVESFYESSFRNTSIYN---------LSALSGGS-N-V
SECY_SYNY3            LITIGLLILVRVGIFIPVPDIDRQAFSQAINDNSVIGFL----------NIFTGGG-LST
SECY_ANTSP            TITLVILFLARVGIFIPISGIDHQTFNNTIQQNGIINFL----------NIFAGGG-FST
SECY_CYACA            FQTMKFIALERLGLFVPIPGIDQKLFSSDYSNNAISNLL----------NVFDNNQ-APK
SECY_CYAM1            AITCLLVAIERLGMYIPVGLIS----------NPQANWL----------NGG--------
SECY_LACLC            LFTIFILFVFRLGAHITAPGVNVQNLQQVADL-----------PFLSMMNLVSGNA-MQN
Q04G66_OENOB          YWTLLILLVYRFGAYITVPGVNASALTKLMDQT----------SLLSILNLFSGGG-LSA
SECY2_LACKZ           ----MILIIYRALFFVTIPGVNSAALAKLSNN-----------SSLTMLSMFSGGG-FEN
SECY_STAEQ            FFTLAMLVIFKIGTYIPAPGVNPEAFNHPQGSQ----------GATELLNTFGGGA-LKR
SECY_BACLD            IFTLLMLIVFRLGSFIPVPHVNTEVLKA-QDQM----------SVFGILNTFGGGA-LFN
B5ZB59_UREU1          IVTLSILILFRIGSVIPMPYIKLNGNFGN------------QGSFFSIINLLGGGG-LSQ
Q8EUD2_MYCPE          VATLVLLILFRIGSAITMPGLTITDSLSDST----------QSSFLGVLNLLGGGG-ISR
SECY_MYCGA            FVTLFLILLFRVISVIPLPGITISQNKNNLNNG--------VSDFFDLFNLLGGGG-LSQ
E8ZJY0_MYCHL          FSTLFILFIFQLGSHVTVPGITLNNFKNE-------------GGLSQLLNLLGGGG-LKK
F0QR54_MYCSL          SATFAILFLFQIGSHITAPLVDSSRKNSL-------------SGLAQLLNLFGGGG-FKR
SECY_MYCCT            LFTLLALIIIRLGVYITVPGVTLDKRFATDSS---------RIQFFQLLSTLGGGS-IGR
B3PMM8_MYCA5          LFTLFILTIFIAAGTITIPGVNLVNQNSITQG-----------DFVGILNLVGGGG-LRN
D1J867_MYCHP          LFTLFIITLFLATGTITIPGVNLANPDSLTQG-----------DFFGILNLVGGGG-LRQ
Q6KI36_MYCMO          VFTIFLLSIFAIAGSITLPGVSVGNLDSNT--------------FLGILNLVGGGG-LRN
Q4A8J0_MYCH7          IFTFFLLVIFIVCGTITIPGLKLLQFQLDSN------------SFLGIINTVGGGG-LLN
C4XFZ5_MYCFP          LYTLLLLSIYILMTTIKAPFVKLSDVNINDD------------PFLNTLNLVGGGG-LKN
D4JDN6_9FIRM          LFTLFAFLVYRLGSAITVPDVNTADLVAGIED----------NSLFAMINLLGGGG-LEQ
E7FW44_ERYRH          IFTLALLLIYRLGTVIPVPNVDSVKVAGSMASELN------SNTLVGMMNILGGGF-IQS
SECY_MYCBO            LFTLGIVILYRVGAALPSPGVNFPNVQQCIKEASA-GEA---GQIYSLINLFSGGA-LLK
A9WST8_RENSM          LFTLGIIVIFRLGAFVPSPGVNYNNVQQCLAPGGG-DTS---GGIYQLVNLFSGGA-LLQ
A1A089_BIFAA          LFTLGIIIIYRIGSFIPTPGVDYTVVQQCVGKMN--NAS---ENFIGLVNLFSGGA-MLQ
C7M2Z2_ACIFD          LFTLAMIGLYQLGSNIPVPGISYHAIQQVFSEAS----G---QGVLGFLDLFSGGA-LSR
C7MP31_CRYCD          LFTLAILALYRLGSFIPVPGIPFASFAQAYEQAG--------GAAMTMIDVFSGGA-LSH
Q1AU49_RUBXD          FFTAAMLAAYRAGAFVPLPGINREVLAAGGLDQN---------AITGLFGVFTGGA-FNN
D3QZ81_MAGIU          IFTIGMIILFRVGGNIPVPGIDRQLFSHLIDRFG---------QIGSMMNIISGGA-LKA
D1VTM8_9FIRM          LFTLFMLLLYRLGSHIAVPFMNTSVIEQLFNGAN---SS---LFA--FMDLMAGGN-FRN
B0RZS9_FINM2          GFTLLMIVVFRLGNTIPVPFMDKAIIKQIMSGQE---GG---IVS--LLNLLSGGS-LRQ
Q18CH6_CLOD6          MYTLMMIVIFRIGTTIPVPGIDTSIIQKMVGG-----NS---LLS--LYNMFTGGA-FSN
F4XGV5_9FIRM          LFTIFALLIFRLGAAIPVPYINGDQLETYL--TA---QS---GTILGLMNAMSGSA-FSM
E6UBM7_RUMA7          LFTFFIIVIYRIGGTVPVPYLDSAALNTWFEGSK---NS---GDFFSYLNVLSGGN-FSK
A9KJH4_LACP7          LFTFMVLIIVRLGSQLPVPGVNQAVIANWLQNNF---GS---GL--SFLDSFTGGS-FTR
D9QZP1_CLOSW          IFTFLMLVVTRIGSQLPIPGVETSFFKDFFAQQN---ND---AF--GFFNAMTGSS-FTN
F2JSH2_CELLD          IYTLWMFLFIRIGVSITVPGVDRAALAAANAANA---NS---GFVNQFMSMITGGA-NQD
C7H0Y9_9FIRM          IFTLLMMIVYRLGANIPVPGINREVLSKLFDGG---------GGIFELFNLFSGGA-FSQ
B8D0S8_HALOH          LFVLGMMVVYRIGAHIPVPGIDVVKLREILFQGT---A----QGVFDYLDLFAGGA-LRN
C9KPC7_9FIRM          IFTLIMFAIFRMGTHIPVPGVDPTAIEKLFANG----------NLFGLLDLFSGGA-FSK
C9LN14_9FIRM          LFTMVMFFVFRLGVHIPVPGVDTSILESLFSSG----------NLFGFLDLFSGGA-LSK
A4XLR1_CALS8          LFTLFMLLIFRLGAFIPVPYIDRDALAKVINDL----------TMLGFFDVVAGGT-FKN
B0TC76_HELMI          IFTLMMFLVFRIGAHIPVPGINREVIEQLLNSG----------ALFGFFDVISGGS-FRN
F0SY27_SYNGF          AFTLLMLLVFRVGAHIPIPFMDRNTLQQMMGSG----------GIFDFFNTFSGGS-LKR
SECY_THET8            LFTLLVLAAYRLGAFIPTPGVDLDKIQEFL-----RTAQ---GGVFGIINLFSGGN-FER
Q1IX92_DEIGD          VFTLLLLAVFRLGSAIPTPGVNTDALQ--------RATS---GGLFGLISLISGGN-LSQ
SECY_THEMA            IFTFLALIVFRMGIYIPVPGLNLEAWGEIFRRIAETAGV---AGILSFYDVFTGGA-LSR
B9K8A6_THENN          IFTFLALIVFRMGIYIPVPGLNLEAWGEIFRRIAETAGV---AGILSFYDVFTGGA-LSR
C9M915_9BACT          IFTLMMLLVFRIGAHIPTPGIDTAAMSHAFA-------G---NGVLGFLDMFAGGA-LRR
D5EE00_AMICL          LFTLGVLFIFRLGAHIPTPGIDTAAMARLFEQ------G---AGVLGFLDIFAGGA-LRR
B5YDW2_DICT6          LFTLFIFAVYRLGAHIPVPGVDRVALANLFR-------S---QGALGFLDLFTGGA-LAR
D9SX80_CLOC7          IFTLLMLVVFRIGNYIPVPGVNKDALMKVMDTNSN--------NLLGFYDLMNGGA-LKQ
A6LPT1_CLOB8          LWTVLLVAVFRMGSHIPLPGINSDFLKNLSQSGG----------LLGFYDMLSGGA-FSR
B5Y968_COPPD          LYTVLFLVIFRAGTFLPIPGVNPEAINVLQEQAG----------FLGILNFFTGGSSYYT
SECY_ECOLI            LFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQ---RGT-----IIEMFNMFSGGA-LSR
SECY_HAEIN            LFVLGALIVYRIGSFIPVPGIDAAVLAQLVEQQ---KGT-----IIDMFNMFSGGA-LSR
SECY_BUCBP            YFVIFSLIVFRMGSYIPIPGIDTVALASLLEHH---RGT-----IIEMFNMFSGGA-LSR
Q7WZR8_9GAMM          RFILVAIIIYRIGVHITVPGVDCLKLHNLIQAN-----S-----AISLFNMFSGGA-FER
A5EX98_DICNV          RFLVISLIIYRIGVHIPVPGVNLDRIRDMFDSG---QGS-----IFQLFNMFSGGA-LSN
SECY_RICBR            IFTIFVLIICRFGSFIPIAGIDAIALGSIAEKN---QSG-----ILGMFNMLSGGS-LGR
B3CT25_ORITI          LFTLMMLMICRIGVYIPIAGIDSNSLNELLPQN---QIG-----ILGMFNILSGGA-FVN
Q5GSW3_WOLTR          LFTLIALICYRLGTYVPIPGINLDIINDIFPKE---GAG-----IFGVFNLFSGGA-LAR
Q2GEC0_NEOSM          CFLLVALLVYRIGTFITLPSVNPAHVSEIFSAN--LSSG-----IIGMFNTFSGGA-LGR
B2KEK2_ELUMP          LFVLGAIFVFRVAAAIPIPGINTDVIKQIFAMQ---QHG-----VLGFLDIFSGGA-MSR
E1X0K2_HALMS          FFTFLLLAVYRMAAQIPVPGVNAAAIASYFAES---GGG-----IFDLINTFSGGA-FKR
SECY_BORBU            LFTLFVLFLFRVGSYLPIPGIDSVALKSYFKSQ-S-DFS-----IANYFDFFSGGA-FSN
O83238_TREPA          FFTLSVLTVFRFGSVLTVPSVDPRALSAYFRSQVR-GNA-----FADYMDFFVGGA-FSN
SECY_HELPJ            LITLGFLFLYRVLAYIPIPGVDLAAIKAFFDS--N-SNN-----ALGLFNMFSGNA-VSR
D3UIH0_HELM1          LITLMFLFAYRVLAYIPIPGVDLAVIKDFFNTAGN-SQN-----ALGLFNMFSGNA-VSR
SECY_AQUAE            IFTLLMFVIYRLGSHIPIPGINPEALRDFLKAF-EGS-------VFALYDIFSGGN-LGR
D3DH80_HYDTT          LYTLLMFAIYRLGSHIPLPGIDTTALEDFFKSF-QGT-------IFYLYDIFSGGN-LGR
E8T4B5_THEA1          LFTLALLAVFRLGAHIPVPGINVEALVDFFQRA-QGT-------VFGMMDIFSGGA-LRK
D4H3A7_DENA2          LWTLFFLFVYRIGAHVPTPGIDGEALSQFFAQQ-SGN-------LLGFFDMFTGGA-LSK
D3P918_DEFDS          LFTLFLLIVYRIGTHIPTPGINADALAQFFARQ-SGT-------LLGFFDMFTGGA-LKR
E4TEN9_CALNY          LFTLFLLIVYRIGTHIPTPGINSTALTEFFARQ-SGN-------ILGFFDMFTGGA-LSR
E6W730_DESIS          LFTLGVLAVYRLGAHIPLPGIDPQALSEFFSAQ-SSA-------LLTFFDMFSGGA-LGR
B8IYL1_DESDA          GWTFLILCCYRIGVHVPIPGVDASALASFFQSM-QGT-------LFSLFDMFSGGG-LSN
Q1MPP6_LAWIP          LWTVGLLCAYRIGVHIPVPGVDGIALTHFFESV-AGT-------LFGLFDMFSGGG-LRN
C1A6S5_GEMAT          TFTFMCMVIYRLGSHITAPGIDVQALTDYFTRQ-QGGG------LLGLYDMFVGGG-LSR
C9RR14_FIBSS          LFTLGLLIVYRIGSHISIPGVNAAVLAEYFKN--SNN-------LFGLYDSFTGGA-FAK
Q1D755_MYXXD          AYTLALLAVYRIGIFINTPGVDRSAMNAFMDAQ-KQSGG-----LVSLFNLFSGGA-LEQ
C1F622_ACIC5          LFMLGMLAIYRLGAFIPTPGVNWHVIEQFFNSN-SG--S-----SLGLVDLFSGGN-LRR
E8WZ43_GRATM          LFTLGLLAIYRLGAHIPTPGIDAKQLAQFFNNN-SG--S-----ALGLVDLFSGGN-LRR
Q1ISA2_KORVE          FFTLALLAVYRIGGHIPTPGVNADMLQQFFQNN-RG--S-----VLGFVDLFSGGQ-LRR
D5UB65_BRAM5          LFTIIAILVYRIGSHIPTPGIDPAALLGFLSSS-QGGAG-----LLTIMDLFSGGA-LFR
E8R478_ISOPI          LFTLGLLAIYRIGFYVPLPIIDQAKLQSFQESVSSEGG---LGKLMSTVAMFGGTD-IGM
D5SQ93_PLAL2          LLTLVLLAVYRMGGLIPLPFIDQMKLAETLQSQGSDG----MGRVMSMISLFSGTS-IGM
D2R6I9_PIRSD          IFTAILLGVFRIGYHIPLPVVNQAQLAANMDSQSNE-----LAKFFTNVAVFSAAD-LKQ
Q1Q157_KUEST          LITLGLIALCRVGVYLPIPGIDTTVLKSYFNQFSQSG----IGQLLGMVDMFAGGA-MSS
SECY_CHLTR            FFTFSLLALCRIGVFIPVPGINGDRAVAYFNQLLGSS-----QNLFQLADIFSGGA-FAQ
B2UQN0_AKKM8          LFTLAMIVVVRLGVQIPLPGIDVMELQKVIEASANASGP--GAGLATVLTIFSGGG-LQQ
B3E0K3_METI4          LFTLGVIIIIRLGSAIPCPGVNPNVLGEFFRTVVDQQAQ--GS-VVGMLNLFSGGA-LEN
D5EJU0_CORAD          FFTLALLFIARVGANIPLPGFDPGPIKDFFREQADA-----GGGLVGMFNMFTGGA-LLN
A6DRC9_9BACT          LYTVWVIVLVRVLKNVPIPGIDLNVLADLMDYVKNQSES--ANKLVGMANVFSGGA-LQK
D0JAT9_BLASB          IATLSLLLVYRFGAYIPLPGINPLGISDFIEKFNS--GSK---GLMQILSSFTGGA-FNR
C6X1Y0_FLAB3          LFTLGLVLVYRFASYISLPAINMAEVGNLLDHYQNQGGNKQGAGLLGLLSSFTGGA-FSR
F4KXT7_HALH1          LFTLGMIFIFRVGSFIVLPGVLPSVLKQQSQSDDN--------SLLGLINAFTGGA-FSQ
D1AVF8_STRM9          LFTLGCFLVARIGVHIPVPGINMELFRDFTG----------GSTLAQFLNLFTGGA-VQR
C7NDL7_LEPBD          TFTLLMIMVARVGIHIAVPGINTEAFKNFQQ----------GNAIAQFLNLFSGGA-VER
E3H907_ILYPC          IFTLLMFLIARVGTHIPAPGVDIDRLSSMTA----------QNDLLGYINMFSGGA-FQR
E0XPY0_9BACT          LFTLGILVIFRFFAHVPVPGVDREALAAAFEA----------NPLLGFLDLFSGGA-LRN
A0A142V9H9_9CHLR      LITLGILIAARFIAHVPLPGVDSVALQELFDQ----------NGALGMLDLFSGGA-MRY
B8G6Q5_CHLAD          LFTLGMLFLFRLIAHIPVPNINPTTLEQLRQALA-------TNQLAQLLNLFAGGA-LEN
E8N3P4_ANATU          LITFLLLVIYRLAANIPVPGVNTEVIRGLLQGSGG------AQSFLGLLDLLSGGT-ISN
C8WTV3_ALIAD          LFTLMVLAVYRIGTYIPVPGMNVSALNAGAGNN----------ALFSLLNMFSGGA-FYR
E3SG16_9MOLU          LFTLVILFIFVIGNKLVIPSVTFQEQLD-FDYKQK---------LFKLSKSSLFEV-NGS
B2LW75_9MOLU          FFTLFIIFIYVVGANLYIPFLP-ESKYE-LIISHQ---------KLPFLFGFLGEH-FNT
B1VAC8_PHYAS          LFTFFIIFLFQLGTRISLPFIPSGFSGW-KLSGKE---------IFFIA----------P
A9NEF3_ACHLI          GITLLLIFIFRVASYIPIPLFNIELFRSNQTWSSG---------FLGILNSYTGQA-LAR
SECY_ARCFU            GWTAAILLLYFILSNVPVFGLSP-----------------ESIDIFAAYRALFAGS---T
D2RE43_ARCPA          GWTVAILLLYFILVNVPVFGLDP-----------------SSIDIFAQYRAFFAGA---T
A0B9U7_METTP          GWTVGILLLYFVLSNIPLFGLSK-----------------HSIDLFGYYRAFFAGS---F
D3SWN3_NATMM          AWTAGILMLYFFLTNITLLGIEAG----------------QADDLFGEFRAILAGE---H
D2RUE9_HALTV          MWSAGILVLYFFLTNIALLGVQTG----------------GANDLFGQFRSVLAGE---M
Q2FSG8_METHJ          AWTAAILILYFALTNIPVFGLSP-----------------ESQDMFQYFRALLAGS---S
Q2QAQ7_9EURY          WTTTFVLIIYFAMTNVMIWGLSEA-----------------TIDVFSSFRAIMAGA---S
B5ICT8_ACIB4          MWTFLTLLIYFSLTNIYIYGLDRA----------------KTIDLFASFRAIMAGA---S
SECY_METVA            QWTGLVLILYFILGTIDIYMGGAE-----------------MPAMFAFWQTVTASK---M
A6UWW1_META3          KWTALVLIVYFLMGTIDIYTAGAT-----------------IPAQFEYLQTIFASK---I
SECY_METJA            KWTGIVLVLYFIMGCIDVYTAGAQ-----------------IPAIFEFWQTITASR---I
SECY_METTH            KWTGIILVLYFFLAQIPLYGLSAN-----------------AVDQFAQFRAVLAGN---F
SECY_PYRFU            MWTGVALILYYVLAEIPVYGIPER-----------------IQDYFQFLRVVLAGR---N
SECY_PYRAB            MWTGLALILYYVLAEIPVYGIPER-----------------IQDYFQFLRVVLAGR---N
B1L789_KORCO          AWTGLVLIVYYFLTQVPLYGVPRG-----------------GLDYLAQIRVIFAGA---Q
A0RUE4_CENSY          LWCGLALLIYMVMAQTPLFGATVP-----------------EFDFLAFARVIFASQ---Q
SECY_SACS2            VWSLVAVIIYLIMASTPLYGITSA----------------SFFKNLILEQIIFAST---T
SECY_SULAC            LWTFIGLIVYLLMASIPLYGVTSSN---------------SFLSNFLAQQIIFASS---Q
SECY_AERPE            AWTGVILVLYFIMSNIPLYGIPPQ----------------NIGGQVDLQRIIFASS---A
                            .                                                     

SECY_TRICV            VGLFTLNIFPYINASIIMQLL--VSLLPGLSKLQKEGGAEARRSINSLTRLLTLGWSLIQ
C6KIV7_9STRA          LGLFTLGILPNINASIVIQLL--TSTFPPLQRLQKEEGEAGRRRILQITRYLTAAVALQY
D2ISB1_9CRYP          VGLFALGIVPHINASIFIQLV--ANLIPFLQNLQKEEGECGRRKLAQITRHLALVLAIIQ
SECY_HETA2            IGLFTLGITPSINASIILQLA--FVINPNLKKLQREEGESGRRKLIKYTRYLTLLLAITQ
SECY_VAULI            FGLLSLGILPYINASIIIQLL--TTIIPALSKMQKDEGEYGRRKLVDFTRYLTFFWAIVE
SECY_CYAPA            IGFFTLGILPYMNASFFLQVL--TKILPSLERFQKEQEEIAQREFKKWTRYLTVIWAFIQ
SECY_EMIHU            IG--SLGILPYINASIIIQLL--TPLFPNLERLQKEEGELGRQQISRYTRYLTCIWAIVL
SECY_DIALT            ISILTLGLGPFFSASLAVQFL--VKLYPAFEKLQNEEGEEGRKTIVRYTRILTVLFCIIE
SECY_SYNY3            VGIFALGILPYINASIIMQLL--TAAIPALEDLQKNEGEAGRRKISQYSRYIAFGWCIIQ
SECY_ANTSP            IGIFALGIVPYIYASIIIQLL--IKLIPYLENLQKEEGEIGRQKINQLTRYLTLLWALIQ
SECY_CYACA            LSVFALGIIPYINATITIQIL--SSAFPALKKLQSEEGEIGKKKLNKITKYLSFCFAFIE
SECY_CYAM1            -GWFVLGIIPTINASIVMQIL--ISIVPALTRLQKEEGEMGQKQIQKYTRYLTFFLAGIQ
SECY_LACLC            YSLFAMGVSPYITASIIVQLLQ-MDILPKFVEWSKQG-EIGRRKLNQATRYITLVLAMAQ
Q04G66_OENOB          YSLFALGVSPYVTAQIIIQLLQ-MDIVPKLVEWSKQG-ETGRRKTTQVTRYLTIVLAFIQ
SECY2_LACKZ           FSIMSLGVTAYITAQIIVQLLQ-ADVIPTFTQWSKEG-QTGRKKLDQVTRSLTLVLGLVQ
SECY_STAEQ            FSIFAMGIMPYITASIVMQLLQ-MDIVPKFTEWAKQG-EMGRRKINNVTRYFAIILAFIQ
SECY_BACLD            FSILAMGIMPYITASIIIQLLQ-MDVVPKFTEWSKQG-EVGRRKLAQFTRYFTIVLGFIQ
B5ZB59_UREU1          FSLFAIGIGPYITAQIIMQLLS-SELVPPLAKLSKSG-ERGRKKIEVITRIITLPLAVMQ
Q8EUD2_MYCPE          LSFMAIGVSPYITAQIIVQLLS-SDLIKPLTRLSKAG-ERGKRKLEIITRLITIPFAIMQ
SECY_MYCGA            LSLFAVGISPYISAQIIMQLLS-TDLIPPLSKLAKSG-ELGRRRIELITRFVTLPFAVVQ
E8ZJY0_MYCHL          VSLFSVGISPYITAQIIIHMMS-NDIVRHLAELRKGG-ERGRYKMELYTRLLAFPFAVMT
F0QR54_MYCSL          ASIFSVGISPYITAQIIMQILS-NDLIKKLTELRKAG-EMGRVKIELYTRLLTLPFAIIT
SECY_MYCCT            FSILALGVSPYITASIIVQLLS-TDVIPVLTRWSKSG-ERGRKKLDKLTKIIMIPFALMQ
B3PMM8_MYCA5          FSIVALGIGPFISASLVMMILQ-TKAFPAIHRLSQSG-PQGRIKINFITWFITVFFAVVQ
D1J867_MYCHP          FSVVALGIGPFISSSLVMMILQ-TKAFPAIHRLSQSG-PQGRIKINFITYGVTFVFAIVQ
Q6KI36_MYCMO          FSIVALGISPFITASLVMQILQ-TKLFPPIYRLSQSG-PIGRRKINIITRAITIFLGVVQ
Q4A8J0_MYCH7          FSVVALGISPFITASLFMLIAQ-TKLFPPIHRLSQSG-PAGRRKINIITRFLTLLVAVIQ
C4XFZ5_MYCFP          FSLAALGISPFINASLIMSLLQ-TKLFPPIQKLSQSG-PQGRRKLNIITRILTLFIAFPQ
D4JDN6_9FIRM          FSIFALGVTPYITASIIIQLLS-MDVVPHLSELAKNG-ATGRKTLDKYTRYLAVVFAFVQ
E7FW44_ERYRH          FSIFALGVGPYITASIIIQLLS-MDVIPYLTELTKSG-QKGKLQLDRITRYLGVVLAYVQ
SECY_MYCBO            LTVFAVGVMPYITASIIVQLL--TVVIPRFEELRKEG-QAGQSKMTQYTRYLAIALAILQ
A9WST8_RENSM          VSIFALGIMPYITASIIIQLL--RVVIPRFQELHLEG-GQGQTKLTQYTRYLTIALGLLN
A1A089_BIFAA          LSIFALGVMPYITASIVIQLL--RVVIPRFEALHKEG-QSGEAKLTQYTRYLTIGLAVLQ
C7M2Z2_ACIFD          AALFGLGVMPYITSSIIIQLL--TGVIPKLYQWRDEG-SSGERKITQTTRYLTIGLALVQ
C7MP31_CRYCD          FSVFALGIMPYITASIIMQLM--QGVVPAVGRWAKEG-EPGRKKITQTTRWLTLALGLLN
Q1AU49_RUBXD          LSVFALGIMPYITAAIVMQLM--TVAIPRLQELAREG-EVGQQKITQYTRVFTLALSFIQ
D3QZ81_MAGIU          ASIFAMGITPYINSSIIIQLM--TVVLPSLQNLQKEG-ETGRKKMQSIVRYVTIGLGLIQ
D1VTM8_9FIRM          FTIFACNIYPYVTASIVLQLL--TIAIPSLEALAKEG-DTGRKAIAKYTRYLAIAIAAVQ
B0RZS9_FINM2          MSIFALSIYPYITASIILQLL--TVAFPRLGELTREG-EEGKKRMGKYTKICSIILAFIQ
Q18CH6_CLOD6          FSLFALGISPYITASIIIQLL--TVGFESLAELQKSG-EEGKKKINKYTKYTALALAVVQ
F4XGV5_9FIRM          ATLFALSVQPYINSSIIIQLL--TVAIPALERLAKEGGEEGRKKIASITRYTTVAIGLLQ
E6UBM7_RUMA7          ATLMALSVGPYINAQIIIQLL--TYALPPLERLSKEG-MEGRKTLNKITKYTALGIALFQ
A9KJH4_LACP7          MSLFALGIGPYITSSIIMQLL--TIAIPKLEEMQKDG-ESGRKKIAEISRYVTIGLSIIE
D9QZP1_CLOSW          MSVFALSITPYITSSIIMQLL--TIAIPKLEEMQRDG-EDGRKKIAEYTRYVTVGLALIE
F2JSH2_CELLD          LALFALGVGPYITASIIMQLL--QVAISKLEELAKEG-EEGRKKINKYTRYVTLGLAVVQ
C7H0Y9_9FIRM          MTIFALSITPYITASIILQLL--TIAIPKLETLAKEG-GEGQKKIAQYTRYLTVVLSLVQ
B8D0S8_HALOH          FTIFAMSITPYITASIILQLL--TGVIPRLEELQKQG-VEGRKKLTQYTRYGTVVLAIIQ
C9KPC7_9FIRM          FSIFAMSITPYINAAIIIQLL--NVVIPTLEQWSKEG-EEGHKKTTQVTRYLTVVLAFLQ
C9LN14_9FIRM          FSLFAMSITPYINSSIIMQLL--TSVIPTLEEWRKDG-QEGYKKIQKVTRYFTIFLAVVQ
A4XLR1_CALS8          MSIFAMSVTPYINSSIIMQLL--TIAIPALEELAKQG-EEGRKKLAEWTRYGTAILAFLQ
B0TC76_HELMI          FSVFAMSITPYINASIIMQLL--TVVIPSLEQLAKEG-EEGRKKITEYTRYFTILLAFIQ
F0SY27_SYNGF          FSVFSLSIMPYITASIIIQLL--TVVVPYLERLSKEG-EDGRKKIMQYVRYATVVLGFIQ
SECY_THET8            FSIFALGIMPYITAAIIMQIL--VTVVPALEKLSKEG-EEGRRIINQYTRIGGIALGAFQ
Q1IX92_DEIGD          FSIFALGVLPYITASIVIQLL--TTTVPALEKLSKEG-EEGRKKINQYTRYAAIGLGAVQ
SECY_THEMA            FSVFTMSVTPYITASIILQLL--ASVMPSLKEMLREG-EEGRKKFAKYTRRLTLLIGGFQ
B9K8A6_THENN          FSVFTMSVTPYITASIILQLL--ASVMPSLKEMLREG-EEGRKKFAAYTRRLTLLIGGFQ
C9M915_9BACT          FSVFSLGVAPYINASIVMQLA--CVIFPTLERMQKEG-PQGQKKLTQYTRWGAILFGFAQ
D5EE00_AMICL          FGIFALGVTPYINSSIVFQLL--VVVFPALEKMQKES-EDGRKKIIQFTRWGTILFAGIQ
B5YDW2_DICT6          FSIFSMGIIPFINASIMMELL--TAVFPSLAELKKE--EDGRKKLTRYARNLSVLLAAIE
D9SX80_CLOC7          SSIFALGVMPYINTSIIMQLL--TVAIPHLENLSKEG-EEGRKKIQKYTKYISVVFAVIQ
A6LPT1_CLOB8          SSILALGVMPYINASIIIQLL--TVAIPQLEQLSKEG-DTGRKKIQNATRYVSLGIAFIL
B5Y968_COPPD          ISIFTLGVLPYINASIIMQLL--GVIFPALENLRKEG-EEGRKKLQMYVRWLGAALSVIM
SECY_ECOLI            ASIFALGIMPYISASIIIQLL--TVVHPTLAEIKKEG-ESGRRKISQYTRYGTLVLAIFQ
SECY_HAEIN            ASILALGIMPYISASIVIQLL--ATVSPALAELKKEG-AAGQRKISKYTRYATVVFATIQ
SECY_BUCBP            ASIFALGIMPFISSSIIVQIL--TLIHPKFIEMKKDG-EQGRHRINKYIRYITLILAALQ
Q7WZR8_9GAMM          LSIFSIGLMPYISASIIMQVI--TGMFLDVE--------VSKHKLTSYLRYLTFMLSVIH
A5EX98_DICNV          ASLLALGVAPYISASIVMQLL--THMLPALKDLRQEG-SAGQKKITQYTRYFTLFLAIMQ
SECY_RICBR            MSIFALAIMPYITASIIIQLM--SVAYKPLENLKKEG-EAGKRKINQLSRYLTVLLASLQ
B3CT25_ORITI          MSIFALAIMPYITASIIIQLL--SMAYPALDKLKKEG-ERGRQQITQLTRYCTIALASFQ
Q5GSW3_WOLTR          MTILVLNVMPYIVASIVMQLL--SSAVKGINEVKNDG-ELGRRRMNSYIRYMTIVFCIFQ
Q2GEC0_NEOSM          MTLFALNVMPYIVSSIVVQIF--FSMLKSEGKVSAE--FMNESRLSFYSKLVALFLAFFQ
B2KEK2_ELUMP          FSILALGIMPYINASIIMGLVRGAHLIPALDRMHKEG-EAGRRKENQITRVFALILACVQ
E1X0K2_HALMS          FSVLALGIMPYITTSIIFSLL--GEVIPQIQELQ-ED-SEGNKKIQKWTRYATVLLCAVQ
SECY_BORBU            FSIFMLSIGPYISASIIVQLL--VYSFPSLKKMQ-EG-DGGRQKTKKYTKYLTIVAAVVQ
O83238_TREPA          FSVFMLGVMPYISTQILMQLS--MIVFPSLKKVV-ED-VGGRRRVQFWTRVATVFVCLIQ
SECY_HELPJ            LSIISLGIMPYITSSIIMELL--SATFPNLAKMK-KE-RDGMQKYMQIVRYLTILITLIQ
D3UIH0_HELM1          LSIISLGIMPYITASIVMELL--AATFPNLAKMK-KE-RDGMQKYMQIVRYLTIAVTVVQ
SECY_AQUAE            LTVFALGVMPYISASIMMQLL--TVAIPSLQRLAKEEGDYGRYKINEYTKYLTLFVATVQ
D3DH80_HYDTT          MTLFALGVMPYISASIMMQLL--TVAVPELQRLAKEEGDYGRYKINQYTRYLTVFVAFVQ
E8T4B5_THEA1          LTIFALGVMPYISSSIIMQLL--TVAIPSIEKLAKEEGEYGRRKINQYTRYGAVLLAFIQ
D4H3A7_DENA2          LTVFGLGIMPYISAAIILELM--TVAVPHLAELKKRG-QEGRDKITRYTRYGTVAISLVQ
D3P918_DEFDS          LTVFGLGIMPYISAAIILELL--TVVSPVLAELKKQG-AQGREKITKYTRYGTVLISAIQ
E4TEN9_CALNY          LTVCGLGVMPYISASIIMELL--AVVSPYLAELKKQG-SEGRAKITKYTRYGTVLISMIQ
E6W730_DESIS          VTLFALGVIPYISASIVLQLM--TVVVPALEKLKKE--PDGQKKITEYTRYATVVLAFVQ
B8IYL1_DESDA          VSVFALGVMPYISASIIMQLL--QVISPDVKRMAKEEGQAGRRKLTQYTRYLTVLITLVQ
Q1MPP6_LAWIP          VSVFALGIMPYISASIIMQLL--QVIIPDFKRMAKEEGAAGRYKITQYTRYGTVIITLIQ
C1A6S5_GEMAT          ATVFALGIMPYISASIFVQIG--GAVLPNVDKMQKDE--EGRKKLTQYTRYLTVVLALVQ
C9RR14_FIBSS          ATVFALGIMPYISASIILQLM--GSVIPAIQMLQKEG-QEGRAKLNQYTRYFTVVLSALQ
Q1D755_MYXXD          MSIFGLGIMPYVSASIIMQLL--AVVVPSLERLQKEG-AGGRQKINQYTRYGTIALSVVQ
C1F622_ACIC5          MTIFALGIMPYITASIIFQLL--TVVYEPLKKMQNEG-EMGRKKITQWTRYMTVILGVVQ
E8WZ43_GRATM          LTIFALGIMPYITASIIFQLL--TVIYEPLAKLQKEG-EMGRRKITQWTRYVTVMLGIVQ
Q1ISA2_KORVE          LTIFALGIMPYITASIILQLL--TVVYEPLAKLQKEG-ELGRKKITQWTRYLTFGLSAMQ
D5UB65_BRAM5          FSILALGIMPYISASIIMQLL--GVVIPALERMQKEG-ESGRKKINQYVRYLTLVLCIVQ
E8R478_ISOPI          ATIFGLGIMPYISASIVFQLL--GSVVPQLEALMKEG-ESGRKKINEYTRYATVLFCVIQ
D5SQ93_PLAL2          STIFGLGIMPYISASIIFQLL--GTVYPPLEKLQKEG-EAGRKKINEYTRIATVFIAFGQ
D2R6I9_PIRSD          VTIFGLGIMPYISASIILQLL--GSVWKPLEDLRKEG-ETGRKKINEYTRYLTVAMCVVQ
Q1Q157_KUEST          GAIFGLGVMPYISASIIFQLL--VGVVPYLERLQKEG-EVGRKKINQYTRIATVGLCLFQ
SECY_CHLTR            MTVIALGVVPYISASIIVQLL--VVFMPTLQREMRESPDQGKRKLGRMTRLFTLVLACVQ
B2UQN0_AKKM8          CGIFALGIMPYISASIMTQLL--SAVVPQWAKMVRE--EGGRQKMTKWTRAIAIVIALVQ
B3E0K3_METI4          CAIFSLSVMPYISASIMMQLL--TTVVPTLGKLARE--EGGRQKLTQYSRLLTVLLCLFQ
D5EJU0_CORAD          GALFALGIMPHISASIIMQLM--GAVFPAIARLQQEG-DVGRQKINQYTRYLTLIICVVQ
A6DRC9_9BACT          LAIGVLGIMPYITASIIMQLM--TPVFPNLEKLQKDG-SHGRQKLNQYTRYMTIVICAVQ
D0JAT9_BLASB          ASVFALGIMPYISASIIIQLM--CIIIPYLQRLQR-DGESGRKQISLITRWLTVGICLIQ
C6X1Y0_FLAB3          ASIMALGIMPYISASIIVQLM--GMAIPYLQKLQK-DGESGRNTLNQITRWLTIAVCLVQ
F4KXT7_HALH1          ASVFALGIMPYITASIIIQLL--GFAVPYFQRLQTKEGESGRKKLSSITRLLTVAITLVQ
D1AVF8_STRM9          ASIFSLGITPYINASIVFQIL--GVLWPKIEEMQKEG-GKEAEKVTQWTRYLTIAITLFQ
C7NDL7_LEPBD          ASIFALGIVPYINASIVFQLL--GVIFPKIDEMQKEG-GKERDKITQWSRYVTIVLAIIQ
E3H907_ILYPC          VSIFALGVMPYINASIVVSLL--AVIIPKLEEIQKEG-ESGRNKVTQWTRYLTIVVAMIQ
E0XPY0_9BACT          LSIAALGVYPYITASIILQIL--TPIIPTLKNLSQEG-EGGRQTINKYTHYLTVPLAFLQ
A0A142V9H9_9CHLR      FSVAALGVYPYITASIIMTLL--TPVIPKLSALSKEG-DAGRNKINTITHWLAVPTAALA
B8G6Q5_CHLAD          FSVAAMGVYPYITAQIIMQLL--QPLIPALQELQKEG-EQGRLRLNRYQLWLTIPLAYLQ
E8N3P4_ANATU          FSILAMGVYPYITAQIILQLL--VPIIPALEQRLKDNPREGQIWMEKWTIILTIPMAFLS
C8WTV3_ALIAD          FSIFAMSVTPYITASIIVQLLQ-SGVIPRFEEWQKEG-ESGRQKLTQVTRYLTVALGLLQ
E3SG16_9MOLU          IYFLSLGVYPYITASIMVQFS--QKLFPFMKEWQDQG-ERGKYKTNLVARSLTLLFAIGL
B2LW75_9MOLU          LCILSLGVMPYITSSIFVQIM--QKFFLPLKEWSEQG-EKGKYKMSIFTRVLTFFFAIAQ
B1VAC8_PHYAS          QKLFGLGIYPYITASIVVQFL--QKFFPFCREWKEQG-QIGKHKINFLTRALALLLAFAQ
A9NEF3_ACHLI          FSVLSLGISPYITASIAVQLL--QTVVPSMKEWQEQG-DTGKVKTQRMTKYLAIVLAFAQ
SECY_ARCFU            GSIIALGIGPIVTASIILQLLV-GAGIIKLDLTNPED----RAAYQDFQRFLVFVMIAVE
D2RE43_ARCPA          GSILALGIGPIVTASIVLQLLV-GAGIISLDLTNPED----RATYQDFQRFLVFVMIALE
A0B9U7_METTP          GSLMLLGIGPIVTASIVLQLLV-GAEIIKLNLRDPRD----QAIFQGTQKALVFVMIVVE
D3SWN3_NATMM          MSLLQVGIGPIVTASIVLQLLG-GANLLGLDTDDPRD----QVLYQGLQKLLVIVMTALT
D2RUE9_HALTV          GSILQVGIGPIVTASIVLQLLG-GANLLGLDTDDPRD----QVLYQGLQKLLVVIMTALT
Q2FSG8_METHJ          GSIVHLGIGPIVTASIVLQLLK-GADLIHIDTSEIRG----QIQYMGLQKLMIFIMIVVE
Q2QAQ7_9EURY          GSIMHLGIGPIVTGSIIMQLFA-GAKIIKLDLGDSDD----KQLYQGVQKILVLIMIPVE
B5ICT8_ACIB4          GSLVHLGIGPIVTASIIMQLFV-GAKLFNIDLTKDDD----KAIYQSTQKLLVIIMIFVE
SECY_METVA            GTLITLGIGPIVTAGIIMQLLV-GSELISLDLSKPMN----RALFQGLQKLFGIFLCFLE
A6UWW1_META3          GTLITLGIGPIVTAGIIMQLLV-GSELIKLDLSKPEN----RASFQGLQKLFGIFLCFME
SECY_METJA            GTLITLGIGPIVTAGIIMQLLV-GSGIIQMDLSIPEN----RALFQGCQKLLSIIMCFVE
SECY_METTH            GSILTLGIGPIVSASIILQLLV-GGKILKLDLSRHED----KAFFQGLQKLLAIVFTFFE
SECY_PYRFU            GSILTLGIGPIVTAGIILQLLV-GSEIIKLDLANPED----RRFYQALQRVFSVFMCFFE
SECY_PYRAB            GSILTLGIGPIVTAGIILQLLV-GSEIIKLDLANPED----RRFYQALQRVFSVFMCFLE
B1L789_KORCO          GSIVELGIGPIVTAGIVLELLV-GSKIVKLDLTDPED----RKFFQEAQRVAAIFFILFE
A0RUE4_CENSY          GTLVELGIGPIVTAGLLMQLLR-GSEILKFDFKKPEE----RGIFQTATKMVSYVVIVVE
SECY_SACS2            GTLAQLGIGPIITAGLIMQILA-GSKLISIDLNDPDD----RVKFTEAQKGLAFIFILVE
SECY_SULAC            GTLAQLGIGPVITSGLIMQILV-GSKLINVDLTTQEG----KSKFTQAEKALALIFIIVE
SECY_AERPE            GTLMELGIGPIVTASLIIQVLV-GAKIIKLDLADPEG----RRKFTSAQKVLALAFAALE
                             : . .   :   .                                        

SECY_TRICV            STSVAF-YLKRALF--------------------------------------EWNLVLAF
C6KIV7_9STRA          GFIIAF-YLKPFVF--------------------------------------GWTIFRAC
D2ISB1_9CRYP          SFGLSL-WLKTYAI--------------------------------------KPGSAFIL
SECY_HETA2            SVFLIF-SLRAFIF--------------------------------------EWSILKLF
SECY_VAULI            SISISY-SLREVIF--------------------------------------EWNLQVYF
SECY_CYAPA            SIVISWIWIRPYAL--------------------------------------NWDFFLGL
SECY_EMIHU            SSAIAFFLIKPITF--------------------------------------GWSLKLGL
SECY_DIALT            SFFLSN-SLRSFVF--------------------------------------NWNSISYF
SECY_SYNY3            GLGLTVGLLRPYAN--------------------------------------NYGPLFIF
SECY_ANTSP            SLSIAI-----WIN--------------------------------------HMYLIHLF
SECY_CYACA            SLAIVLRL-QKYAF--------------------------------------DWNLYFIV
SECY_CYAM1            AFTLSQQW-CTW------------------------------------------------
SECY_LACLC            SIGITAGFQAMS---SLNIVQNP-------------------------------NWQSYL
Q04G66_OENOB          SIGITAGLNALGEPIGVTLLKNT-------------------------------SLNSYF
SECY2_LACKZ           ATGITLGINTLTN--GKFMIEN--------------------------------NPFTII
SECY_STAEQ            SIGMAFQFNNYL---KGQLIIEK-------------------------------SVMSYL
SECY_BACLD            ALGMSYGFNNMA---GGALITDP-------------------------------GVGTYL
B5ZB59_UREU1          AVIIINLMTRANGF-------------------ISIVPNAPFAIGS---------PLFYV
Q8EUD2_MYCPE          AYAVLSLAGTQGLV-------------------SSFFGQSALSSVP---------AGQII
SECY_MYCGA            AFAIIALINNQRN------------------------GAIRFENGG---------ILHQA
E8ZJY0_MYCHL          SLGTITLVSAGNAVKFKNF------------AGSEVAGFWSLPAG------------ERT
F0QR54_MYCSL          SLGTLYLLN-NEGISFIHLWEPPTRDGTLYKAGQQVAENLSTTGGKPFITFGQLYFMQKV
SECY_MYCCT            AEATIFTLSSQGLII------------------PGWDNTNAIANSA----------FYYI
B3PMM8_MYCA5          AFLITRALIN-PRSGF----------------GITFAKQVTTVFGP-----NGNAIYGYF
D1J867_MYCHP          AYLITKALVN-PRQGF----------------GITFSPKLEKLFGQ-----SGMVAYQYF
Q6KI36_MYCMO          SMTIVSALSA-QNS------------------FISLTNEFNVFW------------YQFI
Q4A8J0_MYCH7          AVVLIRTVIL-NPDYG----------------FVRLEINTPVFI--------------WL
C4XFZ5_MYCFP          AILLTKSLSLGDNPFI----------------GFTPIQKLPREV------------TIYL
D4JDN6_9FIRM          SFSLVYGFSQTYTTLIEGG----------------------------------VTMAKIM
E7FW44_ERYRH          AIGIISLLNNQHKILLSS------------------------------------TVADYF
SECY_MYCBO            ATSIVALAANG-GL-----LQGC------------------SLD-----IIADQSIFTLV
A9WST8_RENSM          ATTLVSLARSG-QL-----LGGC------------------GQDGTPSAIIPDTSIVTTI
A1A089_BIFAA          STTILVTARSG-AL-----FNYQ------------------CSQ-----VVPDGSVWNLV
C7M2Z2_ACIFD          ATGLVFVFHSGLGL-----FLAN------------------GQS---VDLIPQFTVLRVL
C7MP31_CRYCD          AVGYLLLFQSARYG-----VVFS------------------DQV---------PYALTSI
Q1AU49_RUBXD          SVAMVLFLRSGQFG-----PVLA------------------GAG-----------ALDLF
D3QZ81_MAGIU          SVAFWYATRSAAST-----VMP--------------------------------SVLNAF
D1VTM8_9FIRM          AVGYTFGIFRQAV--------------------------------------NATTYLEYF
B0RZS9_FINM2          GYATVNGLFNRAI--------------------------------------VDKSFLTGF
Q18CH6_CLOD6          ALGITLGIVRSAL--------------------------------------ISNSVFFIT
F4XGV5_9FIRM          GFGYY-TLINSYG----------------------------LVE-----TDGLPAVWVGL
E6UBM7_RUMA7          GWAYYRTLMNVDGQ-----QI-V------------------LYT-----GHTFERYFTEA
A9KJH4_LACP7          SVAMVIGFSGSGA------------------------------------LEGGLTFTNIV
D9QZP1_CLOSW          SVAMAVGFGGQGL------------------------------------LKE-FNAMSVI
F2JSH2_CELLD          SWAMVLTNRNVLV------------------------------------DDSIWTFLLVM
C7H0Y9_9FIRM          AIGITYGIVKPS--------------------------------------LNDTGKLSIA
B8D0S8_HALOH          AFGITMLIGRHNV-------------------------------------IVNPNLFNLM
C9KPC7_9FIRM          AIGMSIGLK----------------------------------A-----AILNPNPVNIL
C9LN14_9FIRM          AFGMTYALRIN--------------------------------H-----ALVDNSWLYFG
A4XLR1_CALS8          AVGIYFGLKNAQGL-----TGGV------------------PVI-----TTQGQGFLGFI
B0TC76_HELMI          AIGLSYGLKGA---------------------------------------VANPSFAQYL
F0SY27_SYNGF          GFGLTFGLRGAL------------------------------IS-----TSTALKVPLYF
SECY_THET8            GFFLATAFLGAEGG-----R--------------------------FLLPGWSPGPFFWF
Q1IX92_DEIGD          ALFFSLYITSNPA---------------------------------FIAVGWDPGIFTVL
SECY_THEMA            AFFVSFSLARSNPD--------------------------------MVAPGVNVLQFTVL
B9K8A6_THENN          AFFISFSLARSNPD--------------------------------MVAPGVNALQFTIL
C9M915_9BACT          AIGLVFWLR-------------------------------------RLGVFSG-GSMDFF
D5EE00_AMICL          AVGMTFWLG-------------------------------------RLGIFSG-GLFAGL
B5YDW2_DICT6          AFGLTIFMH-------------------------------------NFKVIPSLSPLYVV
D9SX80_CLOC7          SYGIYAIMTQLGAI-----DD---------------------------YSKF-----NVA
A6LPT1_CLOB8          AYGIFATISSSGAT-----VG---------------------------LTAI-----QKT
B5Y968_COPPD          SYAAYLYFSYGLAV-----GG---------------------------SSLITPSFQSAV
SECY_ECOLI            SIGIATGLPNMP----GMQGLVI------------------N--PGFA---------FYF
SECY_HAEIN            AVAISTGLPNM------LSGLVP------------------N--VGFS---------FYF
SECY_BUCBP            SFGMSISLPNIP----GLKDVII------------------D--PSIS---------FYG
Q7WZR8_9GAMM          SLVVSILFLEK--------SVVY------------------Y--KKSV---------VYL
A5EX98_DICNV          GFAISRTVMAA--------GMTI------------------S--AGSG---------FLL
SECY_RICBR            AYGVAVSLESIV----TNTGPVV------------------II-PGLF---------FKI
B3CT25_ORITI          AFGIAIWLEHFT----TESGAVV------------------IM-PGIY---------FRL
Q5GSW3_WOLTR          SVTILIGLERMN----REGTLVV------------------IE-PGVM---------FRT
Q2GEC0_NEOSM          GFIIVAGLERT-----KAFVGGN------------------EE-FYSL---------LKY
B2KEK2_ELUMP          GFGLTFALGKMS----APGGISA------------------IVDPSIA---------FYI
E1X0K2_HALMS          GWGMAVMFEGFK----SAGNIPV------------------IPEPGML---------FRI
SECY_BORBU            GYATSLYAKGI-----PGAV---------------------TIPFYR----------YIF
O83238_TREPA          SSAVTVYANQI-----PGAI---------------------VIQSYAV---------HLF
SECY_HELPJ            AVSVSVGLRSI-----SGGANGA------------------IMIDMQV---------FMI
D3UIH0_HELM1          SVSVSFLLRNM-----GNGANGA------------------IMIDMQI---------FIV
SECY_AQUAE            SLGIAFWIRGQ----VSPKGIPV------------------VENPG---------ISFIL
D3DH80_HYDTT          SLGVSLWLQNQ----VSPRGFPI------------------VPDSG---------IVFTL
E8T4B5_THEA1          ALGIAIGLESM----TSPTGVPI------------------VPNPG---------FTFLF
D4H3A7_DENA2          GMGIAIGLEGM----TSPGGSPV------------------VMFPG---------TGFRI
D3P918_DEFDS          GLGIAIGLEAM----TSPNGSSV------------------VLFPG---------WGFRL
E4TEN9_CALNY          GTGIAIGLEGM----TSPTGASV------------------VIYPG---------WGFRI
E6W730_DESIS          GYGIGIGLEAM----TSPSGMPI------------------VMYGG---------FSFQL
B8IYL1_DESDA          GLGIAVGLENM----TSPAGTPV------------------VLNPG---------WQFRM
Q1MPP6_LAWIP          GIGIAIGLESM----YSPTNIPI------------------VLEPG---------WVFRI
C1A6S5_GEMAT          AYGFALFTASL----PAA-----------------------VSRPG---------PWFTI
C9RR14_FIBSS          GWGISMWLSNLKV--TTAAGTGI------------------SVLSENFSSGL-GNVGFRL
Q1D755_MYXXD          GIGISRWLASLGRSDGGQSGFNQ------------------VVVPDD-------SVWFTF
C1F622_ACIC5          STAIALALLHGST------GQQL------------------VLDPG---------IGFVL
E8WZ43_GRATM          STAIALTLTNTQT------GQSM------------------VTISK---------WAFIP
Q1ISA2_KORVE          SFGIAVTLTKQP---------GM------------------VLNPG---------WGFIL
D5UB65_BRAM5          SAAMASWIQSINE------GAMI------------------FMNPG---------IGFIL
E8R478_ISOPI          SSAWLRFLM---------------------------------ERDIIPAAY--QSFGFIA
D5SQ93_PLAL2          SFFWIRQLAVSGG--IMG-----------------------NEGSLLIAAY--SGVFFQL
D2R6I9_PIRSD          SMMFLGTMLSSGDGQAST-----------------------IHPDFLSGNS--LHWSWYI
Q1Q157_KUEST          AFVMTRTLYTVEF----------------------------NGVPVIPVYL--QGVSFQL
SECY_CHLTR            SLLFAKFALRMNLVVPGI-----------------------VLPAMLSLKLFGVPWVFYL
B2UQN0_AKKM8          GWFLVGTLE-HPERLQAV----G------------------LNIPADCQLVIDPGIQFAL
B3E0K3_METI4          GYLLSIGFE-NPESIPLLHGIHG------------------IIEKLGSPLVPEPGWSFRL
D5EJU0_CORAD          GLLLLVALSSNPASIVGS----G------------------FNPAEYGNVVIANKFQFLV
A6DRC9_9BACT          SAMMAVAMH-TPSKLLGV--------------------------PGFEDLVINKGSAFVI
D0JAT9_BLASB          APVYLISLTQQFIPFSSNSSD---------------------KTYLIDINTFYGKSMFWI
C6X1Y0_FLAB3          APSYLTSITQMFLPHAQFAS-----------------------AYYVHPESV----MFWL
F4KXT7_HALH1          GGGYLRYLFFLKAVDPRIDQ-----------------------------------GIFWF
D1AVF8_STRM9          STGLALILQ-------------------------------------SNNLVRDPGTTFIL
C7NDL7_LEPBD          SFGIAVLMQ-------------------------------------NQGLVLEPGPKFIL
E3H907_ILYPC          GFGVCMWLQ-------------------------------------SAGLVTTPGFGFVT
E0XPY0_9BACT          GYGQLNLFAGSFVS---------------------------TGGAAISGIGLGANTLNTM
A0A142V9H9_9CHLR      GYSQLLLLQRE-------------------------------------GAVAQTEPLAAI
B8G6Q5_CHLAD          AYGQTLTLERTINPNNDP-----------------------TASLFRTPFDLAANFLPTF
E8N3P4_ANATU          AIGQINIFGSLLQGG--------------------------IAAILPNYGWSGANLLPTL
C8WTV3_ALIAD          AAGFTYMFARSGLL-----------------------------------LPGANNWWSYV
E3SG16_9MOLU          ALSSIQRDG---------------------------------------IASFANNKAHVL
B2LW75_9MOLU          SLALILNSK---------------------------------------VFYPNDDLFLII
B1VAC8_PHYAS          TMAFIQKSNS---Q---------------------------------LESNLKISSFNYF
A9NEF3_ACHLI          SLLLILGTGVRGSQ---------------------------------IQVGVDSGFFTYF
SECY_ARCFU            AIPQI-AGGLLKPD----LNLAAQ--------------------------LGVSPGIISF
D2RE43_ARCPA          AFPQV-VGGLLKPN----LDVANA--------------------------LGVPPSVLSF
A0B9U7_METTP          ALPQI-TGGYLLPD----QALATS--------------------------LGVSLSIISL
D3SWN3_NATMM          ALPMVFAGGFLPAQ----QSLTLGG-------------------------FTFDHTQIQL
D2RUE9_HALTV          ALPMVFAGDFLPAM----QSLSLGG-------------------------LEFNQTQVQV
Q2FSG8_METHJ          ALPMI-VGGFLKPD----PAIASAL-------------------------FGGNSGVLAI
Q2QAQ7_9EURY          SIPQV--YGFLDAS-------PALV-------------------------SDFGQGWANA
B5ICT8_ACIB4          AIPQV--FGYLQPSNTFVKGLDAFA-------------------------PGHGMFLAQL
SECY_METVA            AVMFVGAGAFGVV-----------------------------------------NSTLAL
A6UWW1_META3          AIMFVSVGAFGAL-----------------------------------------SGSTMW
SECY_METJA            AVLFVGAGAFGIL-----------------------------------------TPLLAF
SECY_METTH            ALIFVLTGSLAPS-----------------------------------------APQFVW
SECY_PYRFU            AAVWILGGAFGRVGV-------------------------------------DVTYAIAV
SECY_PYRAB            AAIWVLGGAFGRVGV-------------------------------------DVTYAIAA
B1L789_KORCO          VSAYTLGGRFGNL-----------------------------------------TTQQAL
A0RUE4_CENSY          SSIYGIAVYGPGI----------------------------------------ADPSVLY
SECY_SACS2            SALFGYVLARTSTTIN------------------------------------ASILFIAG
SECY_SULAC            SSLFGYVFTRATSNIL------------------------------------LPI-----
SECY_AERPE            AVAFTVGGRYWVGTAI------------------------------------EPGPLDYA
                                                                                  

SECY_TRICV            EIVIWLTTGAMIVLWLSEIITEYGL-GNGPSLLIYTNIVSSLPGFVK---QVITESSG--
C6KIV7_9STRA          EIALTLTVGSLITLWFSEVITEKGL-GNGTSLLVFVNISSSLPILIR---NFGSVEAT--
D2ISB1_9CRYP          GTCLSLSAGFMLNLWISEQITEKGI-GDGPSLLIFVGIVSHVPRLLQ---HEVIPYVK--
SECY_HETA2            ELSCVLSSGAMIILWISECITKTGI-TNGSSFLIFLNIVSVLPEQIG-----MSFKNL--
SECY_VAULI            LISLSLITGSMIVLWFSELITKNGL-GNGSSLLICFNIVSNLPDQIKF--SLISLKNQ--
SECY_CYAPA            KVVVALTLGAVIVMIIAEQITEIGL-TNGSSLLIFINIIARIPNSIEQLFNSNINWTF--
SECY_EMIHU            EIVLSLTVGSILSMWFAELITEESL-GNGSSMIIFINIVGGIPNNLSSLSKTFSAANL--
SECY_DIALT            VVAAAVTTGSLVLVWLSEVITERGI-GNGSSLLILIGNLSRFRFLINK-DDFDSLNVS--
SECY_SYNY3            QTVLAITAGSMFVMWISELITERGI-GNGASLLIFVNIVATLPQTLGQTIEYAQSGG---
SECY_ANTSP            ELCASLTTSSMIAMWFSEIISEYGV-GNGPSLLIFQNIISSIPKNL-QNYTFNIGTT---
SECY_CYACA            QTTLILISGAMLVMWLADNISYKGI-GTGASVIIFVNIASAFAKFLLNQLFVHSIK----
SECY_CYAM1            ---LLIVSGAMLVMWLAEQMTHKGI-GNGTSIFVCSNIAANFLHHPIEAPWSLAM-----
SECY_LACLC            MIGVLLTTGSMVVTWMGEQINEKGF-GSGVSVIIFAGIVSGIPSAIKSVYDEKF---LN-
Q04G66_OENOB          VIAAVMTVGSMFSVWLGEQIQDKGI-GNGVSMIIFAGIVAQLIPGIWQLFQEDV---LE-
SECY2_LACKZ           VIAVSMTAGSFIAMWLGDLITENGL-GNGISVIITAGILVRFPSMINDVIKGVT---FG-
SECY_STAEQ            LIAVVLTAGTAFLIWLGDQITQFGV-GNGISLIIFAGILSTLPSSLEQFAQSVF---VG-
SECY_BACLD            LIAIVLTAGTAFLMWLGEQITSHGV-GNGISIIIFAGIVAGIPQTINQIYAQQF---VD-
B5ZB59_UREU1          TYIFLMVGGTYISLFLADLISKKGV-GNGITLLILTGIVASLFNHFIAIFSNLG----S-
Q8EUD2_MYCPE          LLLLGMTAGTYLTIFISDIISKRGV-GNGVTLIILSGIVASIYPNFTSVFQVLTG--SS-
SECY_MYCGA            FYIVTMTAGTYIGIFIGDIISKKGV-GNGITLLILSGILARLPDGFIVMYRVLGG--VI-
E8ZJY0_MYCHL          LLVILFVSGTYISLFLADIISKRGL-GNGITILMMSGIASSLPDTFTQAYKYLSSDNTV-
F0QR54_MYCSL          LMVLVFVSGTYISLFLSDLISKKGL-GNGISLLIVSGIISSIPENFYSSYQYLSSLEGG-
SECY_MYCCT            LIPLVMLGGSFFMLWIADQITIKGI-GNGISIVIFIGIIISMPSNLKSTFEYWVS-NSG-
B3PMM8_MYCA5          VLPIILISGSFFSLFLSEQITNKGV-GNGTSLLIFVGIATNLIPTFRSAFEYYVP--SV-
D1J867_MYCHP          ILPAILVAGSFFSLFLSEQITNRGV-GNGTSLIIFVGIASALIPSFKSAFKFYVP--SA-
Q6KI36_MYCMO          ILPVILIAGTVFSIFIGDQITDKGV-GNGTTLLIFTGIVITLPTQFTATFNALVG--EQ-
Q4A8J0_MYCH7          VLPLVLVAGSLFSLFLAEQITDKGV-GNGTSLLIFSGIVVGLPRRFQHAFEYLV---DL-
C4XFZ5_MYCFP          ILPLILIGGSLFSLFIAEQITDKGL-GNGTSLIIFVGIAFQLQSQFKGAFSLFVG--SE-
D4JDN6_9FIRM          YIATIFTAGSMFLVWIGDQISIKGI-GNGISMVIMAGIVGRMPQQFADAWTTLIG-----
E7FW44_ERYRH          FMGTVMAAGTMFLLWLGDQITQKGV-GNGLSMIIFAGIVSNLPSQFKGAFAEMTK-----
SECY_MYCBO            VIVLVMTGGAALVMWMGELITERGI-GNGMSLLIFVGIAARIPAEG--------------
A9WST8_RENSM          LLIITLTAGTGLIMWMGELVTEKGV-GNGMSLLIFTSIVARFPISL--------------
A1A089_BIFAA          VMVLIMTGGTGLIMWMAELVTDKGL-GQGMSILIFMSICSGFLPQL--------------
C7M2Z2_ACIFD          FIILTLTAGTALVMWMGELITERGV-GQGMSILIFANVVSVIPTAG--------------
C7MP31_CRYCD          LIVFTLVAGTAFIMWMGELITQRGI-GNGMSLIIFTSIVSRVPSAI--------------
Q1AU49_RUBXD          LVVVTLTTGVMVTMWFGELITQRGL-GNGISLIITASILSQAPNAV--------------
D3QZ81_MAGIU          VVILSFTAGTAVIMWIGEQINEWGV-GNGISLLIYAGILSRVPYMTSGLFQY--------
D1VTM8_9FIRM          TIIISIVAGSTILIWIGEQITEHGI-GNGISILIFAGIVARFPVDIFQS--------IA-
B0RZS9_FINM2          VILISLVAGSMFLVWLGEMITERGI-GNGISILIFLGIISNMPRQIGTM--------IY-
Q18CH6_CLOD6          TVVITLVSASMLVMWIGDKITEKGI-GNGSSVIIFAGIISRIPTDVIKI--------SQ-
F4XGV5_9FIRM          VIVLSFTAGSAFLMWLGEQITEFGI-GNGISILLFAGIVSRFPRMVGDIITGLGYYNNP-
E6UBM7_RUMA7          IIVLCFVAGASLTIWLGDRINEKGI-GNGVSMLLFAGIIARGPDAV-----------IT-
A9KJH4_LACP7          VITASFTAGSAILMWLGERITEKGV-GNGISVILLINIVANMPRDIYGLIE-----KFV-
D9QZP1_CLOSW          IAVATMTAGSALLMWIGERITEKGV-GNGISMVLSFNIISSFPSDASTLYT-----RFM-
F2JSH2_CELLD          IA---FIAGSMLVMWIGEQITSKGV-GNGMSLYIFIGIIYSLPTNFAGI--------FV-
C7H0Y9_9FIRM          LVVVVLTAGTAFLMWLGEQINQYGI-GNGISLLIFAGIIARMPTLLQGSMVKY-------
B8D0S8_HALOH          LIVISLTAGTAFLMWLGEQITDKGI-GNGISIIIFTSIISRFPSYIHRNWELY-------
C9KPC7_9FIRM          IIAITLTAGTVFLMWVGEQITAQGV-GNGISLIIFAGIVAALPKNLGTIYHYV-------
C9LN14_9FIRM          FIIVVLTAGTCLLMWIGEQITEHGI-GNGISLIIFCGIVARFPEAISTVIEYL-------
A4XLR1_CALS8          TITLALTAGTVFLMWIGEQITENGI-GNGISLLIFAGIISRIPNGAVSLWNYVA----K-
B0TC76_HELMI          LVATTLTAGTVFLMWIGERITEKGI-GNGISLIIFAGIVSRLPAGIATLYEYV-------
F0SY27_SYNGF          TVAIVLTAGTAFLMWLGEQITEKGI-GNGISLIIFAGIVAGIPDAIKHLYSLL-------
SECY_THET8            VVVVTQVAGIALLLWMAERITEYGI-GNGTSLIIFAGIVVEWLPQILRTIGLI-------
Q1IX92_DEIGD          VMVLTQVAGIAFTMWIGERITEVGV-GNGISLIITAGIIARYPQEIAATGQLF-------
SECY_THEMA            -STMSMLAGTMFLLWLGERITEKGI-GNGISILIFAGIVARYPSYIRQA-----------
B9K8A6_THENN          -STMSMLAGTMFLLWLGERITERGI-GNGISILIFAGIVARYPSYIRRA-----------
C9M915_9BACT          VAICTVVAGSIAVMWLGEEISDHGI-GNGISVIIYAGIVARFPEGVIRTFGLL-------
D5EE00_AMICL          IVVLTVTAGAVTVMWLGEEITDHGI-GNGISLLIFAGIVARIPEAILRSWQML-------
B5YDW2_DICT6          SSVITLTAGSTFIMWLGEQISQYGI-GNGVSLLILTSIVARFPTDLARTFALL-------
D9SX80_CLOC7          MIMLTLTAGSVFLVWLGDQITVKGF-GNGVSLIIAFGIISRVPDSVLRINSQV-------
A6LPT1_CLOB8          IVVFALVVGTTFCMWLGDQLTVKGI-GNGTSILIFVNIISRVPATIASMMTLQ-------
B5Y968_COPPD          VTTLILAAGSMFLVWLGEVFTMKGL-GNGVSLIIFSGILARVVPSLIQFFQTS-------
SECY_ECOLI            TAVVSLVTGTMFLMWLGEQITERGI-GNGISIIIFAGIVAGLPPAI-AHTIEQAR-----
SECY_HAEIN            TSVVSLVTGTMFLMWLGEQITERGI-GNGISILVFGGIVAGLPSAI-LQTIEQAR-----
SECY_BUCBP            IAIISLITGTIFLMWLGELITEKGI-GNGISIIIFSGIVSGLPSSF-LNTVEKVR-----
Q7WZR8_9GAMM          TIILTFVTGAIFLMWLGEQITDKGI-GNGISLIILSGLVSVIPNALGRTLFLTIK-----
A5EX98_DICNV          TATIGLTAGALFMMWLGEQITERGI-GNGISMLIFGGIAVNMPSGI-LGLFNQAK-----
SECY_RICBR            TTVITLVVGTMLLMWLGEQITQRGI-GNGTSLIIFIGIISGVPSAI-ISMFELSR-----
B3CT25_ORITI          TTVVTLVVGTIFLMWIGEQISSRGI-GNGSSLIIFIGIVSGIPKSI-ITTFELSR-----
Q5GSW3_WOLTR          VGIFSLLGGTMFLIWLGEQISASGI-GNGISLIIFTGIISELHNAF-SFLLTLNK-----
Q2GEC0_NEOSM          TSVLTLVCGTFSLIWLGQQINSRGI-GNGMSLIIFAGIVAEMPAIF-GNLFSGIG-----
B2KEK2_ELUMP          TTTLTLATGTMFVMWLGEQITEKGI-GNGISLIIFAGIVDRLPSAV-MKVVQLVQ-----
E1X0K2_HALMS          TTVITLCAGTMFLLWLGERITEYGL-ENGISLIIFAGIAVELPAEM-MQKLTLYR-----
SECY_BORBU            VAILTVTTGTFILLWFGEQINQRGV-GNGTSLIIFSGIVVRLQAALFNLFQSMQDP----
O83238_TREPA          VTMLTVTSGSMITLWLGEQITARGI-GNGVSMIIFSGIVARLPHALAEMWRLQR------
SECY_HELPJ            VSAFSMLTGTMLLMWIGEQITQRGV-GNGISLIIFAGIVSGIPSAISGTFNLVN------
D3UIH0_HELM1          LSVFSMLTGTMLLMWIGEQITQRGI-GNGISLIIFSGIVSGIPSAIAGTFRLVN------
SECY_AQUAE            ITVLTLVAGTMFLVWIADRITEKGI-GNGASLIIFAGIVANFPNAVIQFYEKVKT-----
D3DH80_HYDTT          TTVIALVSSTMFLVWVGDRITEKGI-GNGMSLLIFAGIVANFPNASIRVLEMLKN-----
E8T4B5_THEA1          VTVTTLTAGSTFLMWLGEKITEKGI-GNGMSLLIFAGIVASIPSAVIRVLTMVKS-----
D4H3A7_DENA2          VTAITLTTGTVFLMWLGEKISEKGL-GNGISVIIFAGIIAGFPSAVSRTLTLVQT-----
D3P918_DEFDS          TTMITLTTGTVFLMWLGEKITEKGI-GNGISLIIFAGILARFPAAVINTIRLLQT-----
E4TEN9_CALNY          ITALTLTAGTIFLMWLGEKITEKGI-GNGMSMIIFAGIVAAIPNAVTNTLRLLQT-----
E6W730_DESIS          MTAISLAAGTTFLMWLGEQVTERGV-GNGISLLIFAGIVAAIPGAIVQSYTLLQS-----
B8IYL1_DESDA          VTMTTFTAGSVLVMWLGEQITERGI-GNGISLIIFCGIVVGIPRGIIQSVALIQA-----
Q1MPP6_LAWIP          VTVLTLTAGTVLIMWLGEQISEKGI-GNGISLIIFSGIVVGIPGAIVKTYQLIIL-----
C1A6S5_GEMAT          QMMLFLTTGAIFVMWLGEQITERGL-GNGASLIIFFSIVERMWPSIFQTFNFVTT-----
C9RR14_FIBSS          LATLTFTVGTIFLMYLGEQITSHGV-GNGISLIIFAGIVGGLPRAILAEAEMFNE-----
Q1D755_MYXXD          MTVVSLTAGTAFIMWLGERITERGI-GNGISLIIFAGIVAGLLPGAKQLLDLTRQ-----
C1F622_ACIC5          MTILTLTTGTTFVMWLGEQITERGI-GNGMSLLIFAGIIVGLPAGIADIVNTARDHK---
E8WZ43_GRATM          MCVLTLTAGTAFIMWLGEQITERGI-GNGMSLLIFTGIVVGLPRGIEELYTKATTNA---
Q1ISA2_KORVE          MTMLTLTTGSVFIMWLGEQITERGI-GNGMSLLIFAGIVVGLPRGVADLVDKIKTQY---
D5UB65_BRAM5          LVVVTATAGTMFLMWLGDQITERGL-GNGISVIIFAGIVARIPAGVYDVIQKRESEY---
E8R478_ISOPI          SCVIVMTAGTIFLMWLGEQIDEYGI-GNGISMLIMAGILARAPAAIQTLATNATFKLS--
D5SQ93_PLAL2          ICTLTMTAGTLLLMWIGEQIDEYGI-GNGISLIIMAGILARMPQAGQALLEPAFQNGV--
D2R6I9_PIRSD          TCILTMTCGTMFVMWIGEQIDEFGI-GNGISLLIMAGILAQMPVALIDFTTNMKWSLT--
Q1Q157_KUEST          MAAILLTTGTMILMWIGEQIEEHGI-GSGISIVIMVGIIERLPWAFNQIVQNFTFSVA--
SECY_CHLTR            TTVVVMITGTLLLMWVGEQISDKGI-GNGISLIITLGILASFPSVLGSIFNKLNLG-S--
B2UQN0_AKKM8          MTVLIMVAGTMFLMWIGDQITERGV-GNGVSLIISVNIIHALPGAVTLAWKTLVYKDG--
B3E0K3_METI4          ITMISLTTGTMLLMWLGEQITDKGI-GNGVSLIITIGILARLPAGLVQGWSKLISPS---
D5EJU0_CORAD          TGTIFLTAGTMIMVWLGEQITARGI-GNGISLLITVSIISGLPGAVASAYQMFVAPVG--
A6DRC9_9BACT          QTTIIVTASAILIMWLGEQITDKGL-GNGASIIITINVLSSMPQAFAAVYSKYQEGE---
D0JAT9_BLASB          IGIMILTSGTLFTMWLGDKITDKGI-GNGISLIIMSGIIARFPDAVAKEIFSKLEIGS--
C6X1Y0_FLAB3          PSIVILVAGSVFAMWLGEKITDKGI-GNGISILIMVGILADLPGAFIQEVATQTGKGG--
F4KXT7_HALH1          SNIIILAAGTVFAMWLGEKITDRGL-GNGVSLIIMAGIIARLPFALGFEFQSQLDNN---
D1AVF8_STRM9          TSVVLITGGTAFLMWLSERISIKGI-GNGTSMLIFLGIVSNLPQVVRSTISQLTTVD---
C7NDL7_LEPBD          STVVLITGGTSFLMWISERISIRGI-GNGTSMLIFLNIVAGLPTVISAMYTGLPSGM---
E3H907_ILYPC          TTVTTLTAGTVFLMWVGEQISLKGV-GNGISLLIFLNVISRMPSTVVQTVQNMKGSK---
E0XPY0_9BACT          AILTAMTAGTMLLVWMGELITEKGI-GNGISLIIFAGIVSTLPSVVGQLWLLRD------
A0A142V9H9_9CHLR      AIVLSIVAGTMFMVWLGEQITSYGI-GNGISLIIFAGIVAGLPDMIGRGLMASD------
B8G6Q5_CHLAD          TVLTTMVAGTMLLIWLGEQINERGI-GNGISIIIFGGIVSRLPGLIIQGFQISQAGDF--
E8N3P4_ANATU          TVILTMMGGTMFGIWLGQLISEYGIPKQGLSLIIFAGIVARIPANLLSILSDQQ------
C8WTV3_ALIAD          VIVVTLTAGDTLLMWFGEMITEKGV-GNGISLLIFTSILSRFSTLGQEVYANWFMNQS--
E3SG16_9MOLU          TIVFFLAVGAFISIWLADLITSKGV-GNGISIFVAISVSKNLYDTLQFLIN---------
B2LW75_9MOLU          QTLFFLIVGAFICIWLSDLITSKGI-GNGVSLLLVLSISKEVFNLFKFLIK---------
B1VAC8_PHYAS          LIPLIAAAGCAILIWFSDLITSRGV-GNGTSLLIIASMGGSLIASFQELNINYLSKLR--
A9NEF3_ACHLI          YMALVVTAGSAFAIWLADLITAKGV-GNGSSILIGVGVLTSIPIMITTLSDKYLG-----
SECY_ARCFU            LIFIQLFIGGVLIVYMDEVVSK-WGIGSGVSLFILAGIAQSIVVGLFNWVIPPNS-----
D2RE43_ARCPA          LIFLQLFIGGVLIVYMDEVVSK-WGIGSGVSLFILASISQAIVVGLFNWFNP-QG-----
A0B9U7_METTP          IIFLQVCLGGVLILYMDEVVSK-WGIGSGVGLFIVAGVSQQLVTGLFNWATG-DG-----
D3SWN3_NATMM          LMFTQIFIGGVLILYMDEVVSK-WGIGSGIGLFIVAGVSQRLVTGFIQPAEG--------
D2RUE9_HALTV          LIFAQIFAGGILLLYMDEVVSK-WGVGSGIGLFIIASVSQSLVTGFLQPTQG--------
Q2FSG8_METHJ          LIFIQICIGGVLIFLMDEVVTK-WGIGSGVGLFIIAGISEAIINGFINWAP---------
Q2QAQ7_9EURY          IIVSQLFIGSLLVFLLDELVSK-WGIGSGISLFIAAGVAQSTFVGTLSPLAVNPG-AYGL
B5ICT8_ACIB4          IIVLQLFFGSYLVFLMDEVVSK-WGIGSGISLFIAAGVSEAIFTGVVSWIPPHPNMPLSI
SECY_METVA            ILVLQLALGAILVIYLDEIVSR-YGIGSGIGLFIAAGVAQTIFVGAFGA-----------
A6UWW1_META3          LVIAQVALGAILVIYLDEIVSR-YGIGSGIGLFIAAGVSQTIFVGAFGP-----------
SECY_METJA            LVIIQIAFGSIILIYLDEIVSK-YGIGSGIGLFIAAGVSQTIFVGALGP-----------
SECY_METTH            VLILQLTIGGILIIFLDEVVSK-WGFGSGVGLFIAAGVSQEIIVGAFNPLSAP-------
SECY_PYRFU            LMILQLAMGGIVLIILDELVSK-WGIGSGISLFIAAGVSQTILTRSLNPLTDPNI-----
SECY_PYRAB            LMILQLAFGGIILIVLDELVSK-WGIGSGISLFIAAGVSQRILTRSLNPLTDPNI-----
B1L789_KORCO          MTIAQLSLGSFLLMMLDDLVAK-WGIGSGISLFILAGVAQEAIWSMFSPKIEP-------
A0RUE4_CENSY          ILIGQLMASSIIIMFLDELIQKGWGLGSGISLFIMAGVAQQILWSLFSPLPAG-------
SECY_SACS2            IVIAQLIVATYLILLLDELIQKGWGLGSGVSLFILAGVMKIMFWDMFGIASVSSQ-----
SECY_SULAC            IVVVQLIIASYIILLLDEMIQKGWGLGSGVSLFIMAGIMKVIFWNMFGIVSVQSQ-----
SECY_AERPE            LVSLQLFLGALLVIYFDEVMQKGWGIGSAISLFILAGVAQGVVWSIFGTIPGVAQ-----
                              .      . : .        .  . :  .                       

SECY_TRICV            ------KVPIGSWLLS-------------------------------GFVLFVALYGIVL
C6KIV7_9STRA          ------TLK----LFF-------------------------------ALIFLIGVICIVI
D2ISB1_9CRYP          ------NTNILKNITL-------------------------------GFLFLTMMAGVAI
SECY_HETA2            ------DIFSFEGLIV-------------------------------ILTFSITVWAAIF
SECY_VAULI            ------INNFSNIFLL-------------------------------ISIFLITTIGCIY
SECY_CYAPA            ------PMISSLILS--------------------------------LSLSFITMFVIIG
SECY_EMIHU            ------ASAIPLLLTG-------------------------------LGIYLGIVLIIIF
SECY_DIALT            ------SQSNLYIIYI-------------------------------IITLVSMLIFSTL
SECY_SYNY3            ------RQSITAVVLL-------------------------------MLVFLVMIVGIVF
SECY_ANTSP            ------NTVLNGSLIL-------------------------------SFGIIILIINI-L
SECY_CYACA            ---------FLDFASY-------------------------------FALIVFSIACIVF
SECY_CYAM1            ------------------------------------------------VVLIFTMLGMIA
SECY_LACLC            -VRPSEIPMSWIFVIG------------------------------LILSAIVIIYVTTF
Q04G66_OENOB          -GPAV---NGWISFGV------------------------------LFLALLIVVTFVTW
SECY2_LACKZ           -TKVN-----WIRFSE------------------------------LMIGAAILILLIVW
SECY_STAEQ            -Q-DDTSL-AWLKILG------------------------------LIVALILLTVGAIF
SECY_BACLD            -AGDQLFL-QIIKVVV------------------------------ILVAILAIVVGVIF
B5ZB59_UREU1          -LTSSKVS-QIIGFIL------------------------------YILFYIMILIGVVF
Q8EUD2_MYCPE          -QISNQLL-RYFSFAV------------------------------YLVFFFLILLATTF
SECY_MYCGA            -ISTNPILTSAINFSL------------------------------YFLAFLVLLLAISF
E8ZJY0_MYCHL          -IPEHKEFIAIFKFVI------------------------------YLFFYFLILLLIVF
F0QR54_MYCSL          -AHNVKLLINIFKFLI------------------------------YVFFYVMVIALMVF
SECY_MYCCT            -EEANIFFSGLLNFMI------------------------------YISVFLLVILSVVI
B3PMM8_MYCA5          -NKTSLVLRELINFFV------------------------------YLLGYMLVIMVVVI
D1J867_MYCHP          -QQNNLVLQEAINYAV------------------------------YIFCYLLVIFIVLI
Q6KI36_MYCMO          -QRVSSLSNGIVTFIS------------------------------YVFGFIILMYIIGF
Q4A8J0_MYCH7          -SFSSSLISQVLSFIL------------------------------YIFGFLLILLIAIY
C4XFZ5_MYCFP          -S-TAAIFVGALKFLT------------------------------YLFVYFALLFIIAL
D4JDN6_9FIRM          --AESTIENGAWLFAG------------------------------YILVYLLIIIFVTL
E7FW44_ERYRH          --GGTTM--GFVWCAV------------------------------YVLLYLAIIILVIY
SECY_MYCBO            -QSILESRGG-------------------------------VVFTAVCAAALIIIVGVVF
A9WST8_RENSM          -GEIWTKSVG-------------------------------QFFIVI-VLGIVVMALVIF
A1A089_BIFAA          -WEIGWGTNGTDGNW--------------------------GKFAAVVGTLLVIMILVIY
C7M2Z2_ACIFD          -RLIYDQAGA-------------------------------LKLIVIVVVVVALLVAIVF
C7MP31_CRYCD          -FSSGTSQDDAGMGL--------------------------AITLLILVVVAICIPAIIF
Q1AU49_RUBXD          -RTLIEDGSV-------------------------------LTMVILGIIAVMIVAAIVF
D3QZ81_MAGIU          -FQAWSAANNFYIAL--------------------------FFALLVVIAFVVIIVFVSY
D1VTM8_9FIRM          -RVRAGLASSIYLWI-------------------------------FLVLAIAICVFVVI
B0RZS9_FINM2          -QSRQGMLSWWKISL-------------------------------FVLIAIIILVVVVL
Q18CH6_CLOD6          -QVKSGEVAPWVIVI-------------------------------LAVVILLTVTGVTF
F4XGV5_9FIRM          -LTDEMKASMSETQIAAY----------------ENAALAPWMVPVIIIGMLALVVFIVF
E6UBM7_RUMA7          -LCKMMTTGDTKNMI---------------------------LVPIIIVVFVLMIAFIIF
A9KJH4_LACP7          -LGESVVKGVTAAII-------------------------------IVAVILLSVVLIIL
D9QZP1_CLOSW          -SGKSVAVAAVAAII-------------------------------ILAVIIAIVVFVII
F2JSH2_CELLD          -LNK---DRIYIPII-------------------------------VLIAFIALVGFTVL
C7H0Y9_9FIRM          ---EAGEVDAVSIAL-------------------------------FVLFAVVIIVGIIM
B8D0S8_HALOH          ---KTGDITALNILF-------------------------------FLVLAVVIIAGVIF
C9KPC7_9FIRM          ---QAGTISYFSVFM-------------------------------FGVIALAMVVFVIH
C9LN14_9FIRM          ---KIGTISPFQLLL-------------------------------FVIIALGMILMVIE
A4XLR1_CALS8          -LNEFSLTSIIGVLL-------------------------------FLVMALAIIVFIIV
B0TC76_HELMI          ---RVGTTNVLNVLL-------------------------------FLIIAGATIAGIIY
F0SY27_SYNGF          ---SVGEVSWLAILG-------------------------------ILLLCVIVIAGVVF
SECY_THET8            ---RTGEVNLVAFLF-------------------------------FLAFIVLAFAGMAA
Q1IX92_DEIGD          ---RTDQVSLLQLVA-------------------------------FVVVILATIAGIVY
SECY_THEMA            ---YLGGLNLLEWIF-------------------------------LIAVALITIFGIIL
B9K8A6_THENN          ---YLGGLNILEWIF-------------------------------LIAIALITIFGIIL
C9M915_9BACT          ---RDGQVGLITMLV-------------------------------ALAIMVGVLAGAVL
D5EE00_AMICL          ---RLGEMNILVLIL-------------------------------AIGLMFVVIAGCIL
B5YDW2_DICT6          ---SRGEIGVLNVIA-------------------------------FFALLILIIIGVVW
D9SX80_CLOC7          ---TNEQVTPLEVII-------------------------------LGAILIALLISVIV
A6LPT1_CLOB8          ---QAGSASIVEIVL-------------------------------FGVFTVFLLATILY
B5Y968_COPPD          ---KSASSSIISVVI-------------------------------AIIFGLALVFITTA
SECY_ECOLI            ----QGDLHFLVLLLV-------------------------------AVLVFAVTFFVVF
SECY_HAEIN            ----QGQMHPLVLLLI-------------------------------AAIVFAVTYFVVF
SECY_BUCBP            ----QGSLHVLLFCFI-------------------------------GIVIFLVTLLVVY
Q7WZR8_9GAMM          ----DSSWMYIQIFKV-------------------------------VSLVLITIILVVV
A5EX98_DICNV          ----IGEIGYGRFFLL-------------------------------LGIIVSLFALIVY
SECY_RICBR            ----KGALSPLVAIAV-------------------------------CAGVVILISIIIF
B3CT25_ORITI          ----RGGDSPFISVIF-------------------------------LVVIVILIAFIVF
Q5GSW3_WOLTR          ----NGSMSLLIILFV-------------------------------FVLFFLLLLLIIF
Q2GEC0_NEOSM          ----SPGSGILGIFVS-------------------------------LSLLVFVVFLVVL
B2KEK2_ELUMP          ----AGEMQFFSSIAI-------------------------------FAAVIIIMILVVW
E1X0K2_HALMS          ----NGELSGISLLIT-------------------------------VAVILAGFFIVTF
SECY_BORBU            ----SQNVNPVFVILI-------------------------------ISIFILVVILIIY
O83238_TREPA          ----LGELNMVFVIVA-------------------------------FVMFVGIIVLVVY
SECY_HELPJ            ----TGVINILMLIGI-------------------------------VLIVLATIFAIIY
D3UIH0_HELM1          ----TGEINFLVLLVM-------------------------------LVIIVFTVFVIIY
SECY_AQUAE            -----GDIGPLTLLLI-------------------------------IALIIAIIVGIVY
D3DH80_HYDTT          -----GDLSPFAFVGA-------------------------------IIFVIAVIVGIVF
E8T4B5_THEA1          -----GDMSLFKLLTV-------------------------------VAIIVLMIAAIVY
D4H3A7_DENA2          -----GEVQLITIIAV-------------------------------LAIILAVTAAIVF
D3P918_DEFDS          -----GELQLITLIIV-------------------------------LAIIVVVTAAVIF
E4TEN9_CALNY          -----GELQILTLVAI-------------------------------LVIVVAVTAGIVF
E6W730_DESIS          -----GEMSIFLALGL-------------------------------VFAALFMIAAIVF
B8IYL1_DESDA          -----GDMSIFMAVVI-------------------------------VVFMAAVLVAIVF
Q1MPP6_LAWIP          -----GDMNILIALVL-------------------------------MLFMFAVLTGVVF
C1A6S5_GEMAT          -----GAIAPLSLVVL-------------------------------GLVMVAVVAGVVA
C9RR14_FIBSS          -----GIQPLAIEVFI-------------------------------LAIVVVIVGFIVF
Q1D755_MYXXD          -----DVISMAEVLAL-------------------------------VVFMLIIIAAVVY
C1F622_ACIC5          ----FGAFTVPALILL-------------------------------VAGMVAVVAFIVF
E8WZ43_GRATM          ----WGAFTPIALLIL-------------------------------VALMVAVVAFIIY
Q1ISA2_KORVE          ----WGPFTVPAMLLL-------------------------------ILVMFLIVAFIVY
D5UB65_BRAM5          ----LNSL---VIVLF-------------------------------FIIFAIVIFCVVY
E8R478_ISOPI          --EDPGEIGPVKLLLL-------------------------------LAMFIGVIVGVVI
D5SQ93_PLAL2          --KLGSQTGIEKFLLL-------------------------------GILFVGVIVGVVA
D2R6I9_PIRSD          --AF-SEVGIEHIVVL-------------------------------AILFVAVVFGVVF
Q1Q157_KUEST          --PAEHQIGIVKLLIL-------------------------------LGMFFAIVGGVVY
SECY_CHLTR            --QDPSEFGIVSLLIL-------------------------------CAVFVFVLMATVL
B2UQN0_AKKM8          --AVVPM-GAMLLVAL-------------------------------IAFLIVVVALVVT
B3E0K3_METI4          --SITAS-SPFLIALL-------------------------------LLFLFGVIATTVA
D5EJU0_CORAD          --SDTPQLGVPQGVLM-------------------------------LALLFAVTAGLVA
A6DRC9_9BACT          -------WNLVQILVV-------------------------------VGILFIVTAATVA
D0JAT9_BLASB          --G-----GFIILFLE-------------------------------FLLWLLVILFSII
C6X1Y0_FLAB3          --L-----GTIMILIE-------------------------------VLFWMLVVLLAIV
F4KXT7_HALH1          --------GLLFFVVE-------------------------------MALWFGVVLLSIM
D1AVF8_STRM9          -------KGTILGYSS-------------------------------LILFILIIIIMVF
C7NDL7_LEPBD          -------GKVLLGLS--------------------------------IVAFVVFIALMVI
E3H907_ILYPC          -------FLIPILVIV-------------------------------AAFALITVAGIVI
E0XPY0_9BACT          --------QVFQVGML-------------------------------IFIALAIVYMIVY
A0A142V9H9_9CHLR      --------QFAGLAVY-------------------------------AFMALLTTVLIVI
B8G6Q5_CHLAD          -------STILGLIGF-------------------------------VVIALLTIVGIVL
E8N3P4_ANATU          -------NGWWMLLVI-------------------------------LAILVLTIFAIVY
C8WTV3_ALIAD          ---GHLFLGILKTLIL-------------------------------IAGIVVIFALIVF
E3SG16_9MOLU          ---VNNSDFVVKRIFT-------------------------------LVVLLILLILTVI
B2LW75_9MOLU          ---GDGNMGITERIII-------------------------------LFLFFLLLILTVI
B1VAC8_PHYAS          --DGFDSELFSQFLLL-------------------------------VLILILFLVLTVI
A9NEF3_ACHLI          ---TGEWTDILIYVLI-------------------------------LLLYVGILLGVVY
SECY_ARCFU            -AMPAGIIPRWIWIAQN--YPLDQLFTGSGLAFLLIQG-----GILALITTAAIILLVVF
D2RE43_ARCPA          -GMPPGVFPRLVWMFQN--YPLEYLLSTDGLITLFVDG-----GILALITTIIIILLVVF
A0B9U7_METTP          -GLPIGIVPKWISIIRLGLIGLDEIFTAEGLKFIFVTG-----GLLALISTVGIILLVVL
D3SWN3_NATMM          -----GFFYNWYLILTGQ-MEIGSLVSGDGLYTLLMGD---GGQIIALLTTILIFAIVVY
D2RUE9_HALTV          -----GFFYNWYLIFTGE-IQVGSLVSSDGLMTLLVTDQ--GGQLIALLTTLLIFGIVVY
Q2FSG8_METHJ          -------VNDMYPVGFFP-RLFAVVLDGANFIQYFGTD------LIAFITTIAIFILIVY
Q2QAQ7_9EURY          QNPPAGTLPMIFYTLRTA--TFSEMVTANGFESILLGDAAHPNAVVALFSSVVVFLVVAY
B5ICT8_ACIB4          HNPPSGTIPKTIYILTHS--SAAQLYSGR-IESILFAP---PNPIIALIGTTIIFLFVAY
SECY_METVA            -----------EGYLWKF---FSAMSVGS------LGIA--FEYILPILSTLFVFLVVVY
A6UWW1_META3          -----------GGYLWKF---FDAMVQGA------IGTA--FEFLLPILGTIIVFLIVVY
SECY_METJA            -----------EGYLWKF---LNSLIQGV------PNI----EYIAPIIGTIIVFLMVVY
SECY_METTH            -----TQPGVPAGRITGF---LYLLFTGQ------SPDF--QYYVLPVLALIAVFLVVVY
SECY_PYRFU            -IDPLTGQPAIVGAIPYF---IQHILKGDLWGAIYRGGS--APDMLSVVATIVVFFIVVY
SECY_PYRAB            -IDPLTGKPAIVGAIPYF---IQHILKGDLKGALYRGGT--APDMMAVIATIIVFLVVVY
B1L789_KORCO          ------TTKRYVGAIPAL---IAEGVGAI------YRGS--LPGLVGLISTFVVFIAVIW
A0RUE4_CENSY          -----DGFAVGIFPFIGQ---WASVGMGNFEDIFFRYNQ--LPSIFGLLLTGGVLLILVY
SECY_SACS2            -NLPIGFFPALFTALASH---SDVLNLIV--NTSTKNLF--QPDLVGLVTTIALIIITIY
SECY_SULAC            -NLPVGFFPLLVSYITSG---RNLQEIVL--NTSSTTPY--QPDLIGLIATVGLTILIVY
SECY_AERPE            -DY------GLVPAIISN---PDLTLLAR--PNG-------FPDLTGFFTTLAAIILLVY
                                                                                  

SECY_TRICV            LQEGMRKVYLISSKQLNQT---SLPFSGSSNLESGYYIPLRFNQAGVMPIILTTAVLVIP
C6KIV7_9STRA          MQNATRKIPLLSVK----------SLSRSVEKTQQNYLPFKLNPSGILPLIFTSTFLN--
D2ISB1_9CRYP          IHEGTNKILLISSK----------QLTKNKINTSANHIPFKVNHAGVTPIVLASTSLNLI
SECY_HETA2            LQQTLYIIPLKNPK----L---GQNELTKKLVEDSLYLPFRLNQAGVMPVVFASYLIPIL
SECY_VAULI            INEAIIKIPLVSARQ---L---LKKTKSEEKNSSNSILPLRINQAGVMPLVFTSYAILFF
SECY_CYAPA            LQESGRPVPVLIARQEAERQKFNEPITEAERRKTQAYIFFQLLPAGIMPVIFASTIFDLA
SECY_EMIHU            FQESYKKITIVSAKQLNLT---TSAQTQSERLANNSFIPLKLNQGGIMPLVFSSTI--AV
SECY_DIALT            SQEGARKIPVVSAKQ---------LIDGVEDDMRRSYIPIRFGQAGVVPIIFSSSILLFL
SECY_SYNY3            VQEGTRRIPIISARR---------QVGKKLYRERTSYLPLRLNQGGVMPIIFASAVLILP
SECY_ANTSP            IQEGERKIAILSAK----------QLGKINELNHKVIFLLKLNQGGVMPFVFASAVVHTF
SECY_CYACA            VQEAIRKVPIISAK----------QLDSTSFYSNDYFLPLRINQGGVMPIILASSLLALV
SECY_CYAM1            LQEAVRAIPILSAK----------QLIQS--IAQVYLLPMRLNQGGVMPIIFASSTLALL
SECY_LACLC            VQQAERKVPIQYTKLTQ--------GA-----PTSSYLPLRVNPAGVIPVIFAGSITTAP
Q04G66_OENOB          FYGAVRRLPMQYTRSDR--------NY-----GDESYLPLRVNVSGVIPVIFASSLITTP
SECY2_LACKZ           FTRSELRIPIQYARRAQ--------LT-----GKDSYLPLKIIVPGVIPVIFASTIMTIP
SECY_STAEQ            VLEAKRKIPIQYAKKQS-AQR----LG-----SQATYLPLKVNSAGVIPVIFAMAFFLLP
SECY_BACLD            IQQAVRKISIQYAKGSGRSPV----PG-----GQSTHLPLKVNPAGVIPVIFAVAFITTP
B5ZB59_UREU1          VNNSTRKIPIQQTGQAL-ILD----H------EKLPFLPIKIMTAGVMPVIFASSVLAIP
Q8EUD2_MYCPE          VNGSVRKIPIQQIGQGL-SKE----V------DEMPYLPIKLNAAGVIPVIFASSIMTIA
SECY_MYCGA            VNSSTRRIPIQQTGEGM-VLG----N------EKLPYLPIKLNAAGVIPVIFASSIMSIP
E8ZJY0_MYCHL          INGSTRKIPIQQTGQGL-IFD----R------KKLSYLPIKLMPAGITPVVFAGSLMVFP
F0QR54_MYCSL          ITGSVRKIPIQQTGAGL-ILD----K------KKLGYLPIKIMPVGIMPVVFAGSVMIFP
SECY_MYCCT            MNEAERKIPIQQTGSGL-TDS----S------EHTPYLPLKLNNAGVIPVIFASAIISTP
B3PMM8_MYCA5          FTIAERRIPIQQVGAGL-SRN----E------KELSYLPIKANPAGIMSVIFSLMILSLP
D1J867_MYCHP          FTIAERHIPIQQVGAGL-SKN----E------KELSYLPIKANPAGIMSVIFSMMILSVP
Q6KI36_MYCMO          VYNAERRIPIQQVGAGR-AKN----E------KELSYLPIKINPGGISPIIFALIIISFP
Q4A8J0_MYCH7          VYLAERKIPIQQTGSGM-SKN----I------KEISILPLKLNPAGIMPVIFALIIVSLP
C4XFZ5_MYCFP          VYNAERHVPIQQIGAGR-SRN----I------NEMGKLPIKLNPGGIMPIIFASMLVSFP
D4JDN6_9FIRM          INTAERRIPIQYTSSSI-QLS----KR-----SESNYLPLKVNSASVIPVIFASSLMMAP
E7FW44_ERYRH          MNGAVRKISIQYTSNVG-GTT----RG-----KSMNHLPLMINSASVIPVIFAGAIMQAP
SECY_MYCBO            VEQGQRRIPVQYAKRMVGR---------RMYGGTSTYLPLKVNQAGVIPVIFASSLIYIP
A9WST8_RENSM          VEQSQRRIPVQYAKRMIGR---------RTVGGTTTYIPIKVNMAGVVPVIFASSLLYLP
A1A089_BIFAA          VELAQRRIPVQYTRRMIGR---------KMYGGSSTYLPLKINMSGVIPPIFASSILAVP
C7M2Z2_ACIFD          VELGQRRIPVVFARRVVGR---------RMYEGGRTYIPLKVNQAGVVPIIFAASILYFP
C7MP31_CRYCD          MERAQRRIPVSYAKRVQGR---------KMMGGQSTYIPLKVNAAGVIPIIFASCLIYFP
Q1AU49_RUBXD          VNEGQRRIPITYAKRQVGR---------RMSQGGTTYLPLKVNMAGVIPIIFASSLLIFP
D3QZ81_MAGIU          VSLAERRIPVTYAKRVIGR---------KQFGGQTTYLPLKVNQSGVLPIIFALSLLSLP
D1VTM8_9FIRM          LNEGERRIPVQYAKRVVGR---------KMYGGQATHIPIKVLLTGVMPIIFANSLLAIP
B0RZS9_FINM2          INQGERRIPVQYAKRVVGR---------KMYGGQSTHIPIKVNMGGVMPVIFASAILQLP
Q18CH6_CLOD6          IQEATRKIPVQYAKRVVGR---------KMYGGQSSHIPMKVNQSGVMPIIFASSLLAFP
F4XGV5_9FIRM          ISNAERRLPVQYAKRVVGR---------KMYGGQSTHIPIKVNMSGVMPIIFAQSIASLP
E6UBM7_RUMA7          MNNAERRIPIQYAKRVVGR---------KQYGGQNTFIPIKIAMSGVLPIIFAMSFMSIP
A9KJH4_LACP7          LNAAQRKIAVQYAKKVQGR---------KMVGGQSSHIPLKVNTAGVIPVIFAVSIMQFP
D9QZP1_CLOSW          LQDGERRIPVQYSKKMQGR---------KMVGGQASNIPLKVNTAGVIPVIFASSIMSFP
F2JSH2_CELLD          MAQGERRVSVQYAKRMAGR---------KVYGGQSQYIPVKVNLGGVLPIIFAMSIMNFP
C7H0Y9_9FIRM          IQEGQRRVPVQYAKRVVGR---------KMYGGQSSHIPMKVNQAGVIPVIFSMAFLQTP
B8D0S8_HALOH          IQQGERRIPVQYSKRVVGR---------KVYGGRSTHIPMRINQAGVIPVIFAQAVLQFP
C9KPC7_9FIRM          VETGFRRIPISYAKRVVGQ---------RAYGGHSSHIPLKVNQAGVIPIIFASSVLMFP
C9LN14_9FIRM          VNEGQRRVSIQYAKRVVGR---------KMYGGHSTFLPLKVNQAGVIPIIFASSIIMLP
A4XLR1_CALS8          IQEGERRIPVQYAKRIVGR---------RVYGGQSTHIPIKVNIAGVIPIIFAISLVMLP
B0TC76_HELMI          ISEGQRRIPVNYAKRVVGR---------RVYGGQSTHIPLKVNQAGVIPVIFASSILALP
F0SY27_SYNGF          IQEGQRRIPVQYAKRVVGR---------RVYGGQSTHIPLKVNQAGVMPIIFGVSLMAFP
SECY_THET8            VQQAERRIPVQYARKVVGR---------RVYGGQATYIPIKLNAAGVIPIIFAAAILQIP
Q1IX92_DEIGD          VYQGERRVPVTYARARGGAPT----GAARNLGGQATWLPIKVNQAGVIPVIFASAMLIIP
SECY_THEMA            VQQAERRITIQYARRVTGR---------RVYGGASTYLPIKVNQGGVIPIIFASAIVSIP
B9K8A6_THENN          VQQAERRITIQYARRVTGR---------RVYGGASTYLPIKVNQGGVIPIIFASAIVSIP
C9M915_9BACT          LQEGQRRLPVQYAKRVVGN---------RVYGGQSTFIPLRINQGGVMPIIFASSLLIFP
D5EE00_AMICL          LQEGQRRLPVQYAKRVVGN---------KVYGGQSTFIPLKVNQAGVMPIIFASSVLLFP
B5YDW2_DICT6          EESAERRIPVQYSRRIVGR---------RVYGGQSTYLPLKLNQAGVIPIIFAITILMVP
D9SX80_CLOC7          MTLAERRIPIQYASK---ANG-------RHFK-QNSNLPFNLTASVVISIIFAMSFMRLP
A6LPT1_CLOB8          FSLSERRIPVQYAGKFASGNS-------NMVKSQSTHIPLSIIGSAVLAIIFSMSVMDFP
B5Y968_COPPD          AYLAERKIPVQYASRI--RGT-------KVYGGQATTIPIRLLQAGVMPIIFASAFINAP
SECY_ECOLI            VERGQRRIVVNYAKRQQ-GR--------RVYAAQSTHLPLKVNMAGVIPAIFASSIILFP
SECY_HAEIN            VERGQRRIRVEYAKRQQ-GR--------QILGGHSTHLPLKVNMANVMPAIFASSIILFP
SECY_BUCBP            IERSQRKITISYAKRNL-GH--------RTYSMNSTHLPLKLNMSGVIPAIFASSIVLFP
Q7WZR8_9GAMM          IESGQIRIKVSYPRRLI-GK--------KLYATQSSYLPLKLNMAGVIPAIFASSSLIIT
A5EX98_DICNV          VERAQRRIKIHYAKRQQ-FG--------TSAMGERFYLPLKINMAGVIPAIFASAIITLL
SECY_RICBR            FEKAQRKLLVQYPKRQV-GN--------KIYGGDSTYMPLKLNTSGVIPPIFASSILLFP
B3CT25_ORITI          FEKAQRRILVHYPRRQL-GN--------KIYGGDTTHIPLKLNIPGVIPPIFASSLLLFP
Q5GSW3_WOLTR          VESSYRKVTVQYPKK-Q-FK--------RLHSDDFTYIPLKINLSGVIPTIFANAILLTP
Q2GEC0_NEOSM          VERASKNIPVHYPRRRT-WG--------STHGDAASNIPVKINVSGVIPPIFANALILFP
B2KEK2_ELUMP          VETAQRQIPVQYAKRQI-GN--------KVYGGQTSYLPLKIDQSGVIAVIFASSIIYMP
E1X0K2_HALMS          IERSQRSVPVQYAKKVV-HN--------RVYGGAQS-LPIRVDTGGVMPPILASSLLAAP
SECY_BORBU            EYKAQMRIAIHYARANS-N------------NTVSSYLPIKLNPSGVLPVIFASVLITLP
O83238_TREPA          EQQGQRKIPIHYARRVV-GR--------KMYGGQSTYIPFKINPSGVIPIIFASSFLTFP
SECY_HELPJ            VELAERRIPISYARKVV-MQ--------NQNKRIMNYIPIKLNLSGVIPPIFASALLVFP
D3UIH0_HELM1          IELAERRIPVSYARKVI-MQ--------NQNKRIMNYIPIKINLSGVIPPIFASAILVFP
SECY_AQUAE            VQEAERRIPIQYPGRQV-GR--------QLYAGRKTYLPIKINPAGVIPIIFAQALLLIP
D3DH80_HYDTT          MQEAERRIPVQYPRRQI-GR--------QEVAGGSTYLPIKINPAGVIPIIFAQSLLIIP
E8T4B5_THEA1          IQEAERRVPLQYARRTV-GR--------QAVGRYTSYLPIKLNPAGVIPIIFAASILMFP
D4H3A7_DENA2          METSSRRLPIQYVRKG--GG--------GKGNVATSYLPLKLNPAGVIPIIFAMSILAFP
D3P918_DEFDS          MEISYRRIPIQYVRRGTYAG--------MKSNVANSYLPIRLNPAGVIPIIFAASIVAFP
E4TEN9_CALNY          VEAASRRIPIQYIKRGA-VG--------IRGNVATSYLPLKLNTSGVIPIIFAASIISFP
E6W730_DESIS          IERGQRKIPVAYAKRMV-SG--------KVVGGKNTYIPLKVNTAGVIPVIFASSIIAFP
B8IYL1_DESDA          VERSQRRIPISYAKRQV-GR--------KMYGGQNSHLPLRLNTAGVIPPIFASSLLLFP
Q1MPP6_LAWIP          MERAQRRIPIQYAKRQL-GR--------KVYGGQSTHLPLRVNTAGVIPPIFASSLLLFP
C1A6S5_GEMAT          ITVAARRVLIQIPQRTMARG--------RQREAARNFIPLRINTAGVMPIIFAQSVIVIP
C9RR14_FIBSS          VEQATRRIPLQSPRRTV-GN--------KVLGGQASYLPFKVNTANVIPVIFASCIMFIP
Q1D755_MYXXD          VERGMRRIPIQYAKRMA-GR--------RMFAGQATYFPMKVNTSGVIPPIFAGAVLSFP
C1F622_ACIC5          VERSERRIPVQYAKRIV-GR--------RLMGGQSTHLPLRVNSGGVMPIIFAASVLSAP
E8WZ43_GRATM          VERSERRIPVQYAKRIV-GR--------RMTQGGATHLPLKVNSGGVMPVIFASSILSAP
Q1ISA2_KORVE          VERSERRITVQYAKRIV-GR--------KMMGGTSTFLPLRVNSGGVMPVIFASSILTLP
D5UB65_BRAM5          EESGQRRIPVQYAKRVV-GR--------KVFGAQSTHIPFKINPSGVIPIIFASALMAIP
E8R478_ISOPI          MTESQRRIPTQSARHVRGRR---------MTVGARQYLPLKVNQAGVMPIIFASSLMSLP
D5SQ93_PLAL2          ITQAQRKIPVQSAKHVRGRS---------VAGGQRSYLPLRLNQSGVMPIIFASSLLLFP
D2R6I9_PIRSD          ITLGQRQIPTQSAKHVRGRR---------QFGGGRQYLPLRLNQSGVMPIIFASSLLMLP
Q1Q157_KUEST          ITQGQRRIPIQQAKHTRGRR---------VYGGQRHFLPLRVNQAGVMPIIFAQSLLIFP
SECY_CHLTR            IIEGMRKIPVQHARRIIGRR---------EVVGGGSYLPLKVNYAGVIPVIFASSLLMFP
B2UQN0_AKKM8          VTQAQRRIPVQYAKRVMGNK---------MFNGATQYLPLKLNYSGVMPVIFATAILSLP
B3E0K3_METI4          MTQAMRKIPIHYAKQVRGNK---------IYGGQTSFLPLKVNYSGVMPIIFAQAILLFP
D5EJU0_CORAD          ITQGQRKIPVQYAKRVVGRK---------VYGGQSSFLPLKVNYAGVMPVIFGSAILMFP
A6DRC9_9BACT          LVQGMRKIPLKYARDASSRN---------AMIEKTSYLPLKVNHAGVMPIIFASALMMFP
D0JAT9_BLASB          IIQAIRKIPVQYVSHYKSLE-----VGSQLIQKKHQYIPLKMTAAGVMPIIFSQAIMLFP
C6X1Y0_FLAB3          LSVAVRKIPIQYVSRAQARGG----ANRNLMQGARQWIPLKVNASGVMPIIFAQALMFVP
F4KXT7_HALH1          IIQAVRRIPIQMAKKAVGRT------DSTGMRSEQDFIPLKLNASGVMPIIFAQALMFLP
D1AVF8_STRM9          IQLGERRIPIQYVGKSSRGVG----NSQATVVGRKTYLPIKINTAGVMPIIFASMIMAVP
C7NDL7_LEPBD          VQLAERRIPIQYAGKGSLGFG----GGQ-STVGKRTYLPLKINMSGVMPIIFASVLMAAP
E3H907_ILYPC          IQLGQRNIPVHYVGRGFSGKG----G-----VAQSTYLPLKINTAGVMPVIFASVLMMIP
E0XPY0_9BACT          FAEAQRRIPVQYGRSVFRGGQ-------MYRQSGATHIPLRVNAAGMIPLIFAFSILILP
A0A142V9H9_9CHLR      FTEAHRRIPVQYAQTVIRSGK-------MYRRGGESHIPLRVNSAGMIPLIFASALVMLP
B8G6Q5_CHLAD          IQEGQRRIRVQYARRV-RGNK-------VYG-GQSSFIPLKVNSAGMIPLIFAQSIIIFP
E8N3P4_ANATU          VQQGRRNVPVVFPGRR--VGN-------RMSMPVHSNLPLMVNMAGMIPLIFAQAILTFP
C8WTV3_ALIAD          VQQAERKIPVQYAKRVVGRT---------VYSGQQSYIPIKLLAAGVIPVIFAISLLFLP
E3SG16_9MOLU          LSAAYLKVPITYATKQNND-------------KIKNHIPLKLNTSGILPVILANSLLQVF
B2LW75_9MOLU          LSSSYLKIPIQYTTKVNNDS------------KLERNIPIKVNVVGVLPIILANTLLNVI
B1VAC8_PHYAS          VQITALKVKVNYARNRVSS-------------ESGSYIPLKINTAGVMPVILAQYLMMPF
A9NEF3_ACHLI          MNIAKRKIPINYANRQGGKT------------RTDSNIPLKINSAGVLPVIFASTILSVP
SECY_ARCFU            FEGTRVEIPLAHAV----------------ARGARGRFPIKLIYASVLPMIFVRALQANV
D2RE43_ARCPA          AEGTRVEIPLAHHL----------------VRGARGRFPIKLIYASVLPMIFVRALQALI
A0B9U7_METTP          VESTRIEIPLAHSR----------------VRGARGRFPVKLVYASVLPMILVRALQANI
D3SWN3_NATMM          AESVRVEIPLSHAR----------------VKGARGRFPVKLIYASVLPMILVRALQANI
D2RUE9_HALTV          AESVRVEIPLSHAR----------------VKGARGRFPVKLIYASVLPMILVRALQANV
Q2FSG8_METHJ          VESTRVEIPLAHTQ----------------VRGARARFPVKLIYASVLPMILVRVLQANV
Q2QAQ7_9EURY          AESSKLELPLTHGK----------------VRGHRGQYPIRLVYASNIPVILMAALLANL
B5ICT8_ACIB4          VQSIKIELPLAHER----------------ARGARGRYPIKLMYSSNIPVILTSALLANV
SECY_METVA            VESIRVEIPLAHGR----------------VKGAVGKYPIKFIYVSNLPVILAAALFANI
A6UWW1_META3          AESMRVEIPLAHGR----------------VRGAVGKYPIKFIYVSNLPVILAMALFANV
SECY_METJA            AECMRVEIPLAHGR----------------IKGAVGKYPIKFVYVSNIPVILAAALFANI
SECY_METTH            AESMRVEIPISMGGGKR------------LSRGAVGKYPLRFIYASNMPVILTSALLLNV
SECY_PYRFU            FESMRVEIPLGYRG-----------------VTVRGSYPIRFLYVSNIPIILTFALYANI
SECY_PYRAB            FESMRVEIPLGYRG-----------------VTIRGRYPIRFLYVSNIPIILTFALYANI
B1L789_KORCO          AYEVRVNISIAHSL----------------YGGLRTKYPIRLLYVSNVPIIFASALLGDI
A0RUE4_CENSY          TQGMKIEIPIVSTK----------------YRGFSATYPIKLMYVSNIPVILASALTANA
SECY_SACS2            LTTMTIEIPVTSQK----------------LRGIRRTIPLNFLYVSSIPVIFVAVLGSDI
SECY_SULAC            LVNTNIYIPVTTQR----------------LRGIRTTVPLNFLYVSSIPVIFVSVLGADI
SECY_AERPE            LQAMRVEIPITSER----------------FKGIRSRVPLQFIYVTNIPILLVGILVSDL
                             :                               .        . ::        

SECY_TRICV            TF-----IY---------------------------------------------------
C6KIV7_9STRA          ------------------------------------------------------------
D2ISB1_9CRYP          TS-----LC---------------------------------------------------
SECY_HETA2            KTGGIYILL---------------------------------------------------
SECY_VAULI            SSLFEIIKK---------------------------------------------------
SECY_CYAPA            LPA---------------------------------------------------------
SECY_EMIHU            VFM---------------------------------------------------------
SECY_DIALT            TTS---------------------------------------------------------
SECY_SYNY3            SSLAG--FA---------------------------------------------------
SECY_ANTSP            LFISN--NT---------------------------------------------------
SECY_CYACA            DYVIR--YG---------------------------------------------------
SECY_CYAM1            H-----------------------------------------------------------
SECY_LACLC            ATILQFLQRSQGS-----------------------------------------------
Q04G66_OENOB          QTILQAFVGSWG------------------------------------------------
SECY2_LACKZ           QTILMFF--NAGQ-----------------------------------------------
SECY_STAEQ            RTLTLFFP----------------------------------------------------
SECY_BACLD            RTVATFFG----------------------------------------------------
B5ZB59_UREU1          AQVAEFLDK---------------------------------------------------
Q8EUD2_MYCPE          PTISQFLPS---------------------------------------------------
SECY_MYCGA            ITIAEFQP----------------------------------------------------
E8ZJY0_MYCHL          SALGELLKNK--------------------------------------------------
F0QR54_MYCSL          IGIAELTKSS--------------------------------------------------
SECY_MYCCT            ITISQIIEAVNP------------------------------------------------
B3PMM8_MYCA5          MMIGNLTNPN--------------------------------------------------
D1J867_MYCHP          TMIANLFDPN--------------------------------------------------
Q6KI36_MYCMO          QLFASVF-PI--------------------------------------------------
Q4A8J0_MYCH7          TLFSGFLDRN--------------------------------------------------
C4XFZ5_MYCFP          IMISRIL-PK--------------------------------------------------
D4JDN6_9FIRM          LQIASFFP---T------------------------------------------------
E7FW44_ERYRH          VIVMSWIN---Q------------------------------------------------
SECY_MYCBO            HLITQLIRSGSGV----------------------------------------------V
A9WST8_RENSM          ALIAQFAR-GSDP----------------------------------------------A
A1A089_BIFAA          TLIAQFGN----------------------------------------------------
C7M2Z2_ACIFD          VLLSNIVR----------------------------------------------------
C7MP31_CRYCD          AQIAALFN----------------------------------------------------
Q1AU49_RUBXD          VVITQFAAG---------------------------------------------------
D3QZ81_MAGIU          NMLISFFF----------------------------------------------------
D1VTM8_9FIRM          STVAMFTKN--------------------------------------------------E
B0RZS9_FINM2          QTIALLFGK--------------------------------------------------D
Q18CH6_CLOD6          QTIAMFMGP--------------------------------------------------N
F4XGV5_9FIRM          ATIGAFAGW--------------------------------------------------T
E6UBM7_RUMA7          ATLKLFTG---------------------------------------------------D
A9KJH4_LACP7          IIIASFFGV--------------------------------------------------Q
D9QZP1_CLOSW          VVISQFFGA--------------------------------------------------K
F2JSH2_CELLD          QIIINLVGA--------------------------------------------------Q
C7H0Y9_9FIRM          LTFMHFWP---------------------------------------------------N
B8D0S8_HALOH          TVIAAVLP---------------------------------------------------Y
C9KPC7_9FIRM          VTVAQFI----------------------------------------------------D
C9LN14_9FIRM          VTLAQFV----------------------------------------------------H
A4XLR1_CALS8          TTIAQFFP---------------------------------------------------N
B0TC76_HELMI          TTIAAFFP---------------------------------------------------G
F0SY27_SYNGF          STIATWMPQ--------------------------------------------------T
SECY_THET8            IFLAAPFQ----------------------------------------------------
Q1IX92_DEIGD          NLIASATA----------------------------------------------------
SECY_THEMA            SAIASITN----------------------------------------------------
B9K8A6_THENN          SAIASITN----------------------------------------------------
C9M915_9BACT          YTILKFFD----------------------------------------------------
D5EE00_AMICL          YSIARFFT----------------------------------------------------
B5YDW2_DICT6          QTFIPVVK----------------------------------------------------
D9SX80_CLOC7          ATIGNFFPNS-------------------------------------------------T
A6LPT1_CLOB8          KTIATLFGGVGESQK--------------------------------------------E
B5Y968_COPPD          TVISGWFPQS-------------------------------------------------G
SECY_ECOLI            ATIASWFGG---------------------------------------------------
SECY_HAEIN            ATLTQWFGQ---------------------------------------------------
SECY_BUCBP            ATIASWFGN---------------------------------------------------
Q7WZR8_9GAMM          AS----------------------------------------------------------
A5EX98_DICNV          VSGLTLASSLP-------------------------------------------------
SECY_RICBR            ATLANFSSS---------------------------------------------------
B3CT25_ORITI          LTVLNLSQNK--------------------------------------------------
Q5GSW3_WOLTR          VSIANFYKG---------------------------------------------------
Q2GEC0_NEOSM          LTLANFSAE---------------------------------------------------
B2KEK2_ELUMP          LTIAGFN-----------------------------------------------------
E1X0K2_HALMS          ATMANFVSQG--------------------------------------------------
SECY_BORBU            LQILSGF-----------------------------------------------------
O83238_TREPA          LQIASSI-----------------------------------------------------
SECY_HELPJ            STILQQ------------------------------------------------------
D3UIH0_HELM1          STLLQ-------------------------------------------------------
SECY_AQUAE            STLLNFVQ----------------------------------------------------
D3DH80_HYDTT          STVIGFIN----------------------------------------------------
E8T4B5_THEA1          ATVVRFIH----------------------------------------------------
D4H3A7_DENA2          STLASFSE----------------------------------------------------
D3P918_DEFDS          STLSTFAN----------------------------------------------------
E4TEN9_CALNY          STLASFSG----------------------------------------------------
E6W730_DESIS          LTFGDMLER---------------------------------------------------
B8IYL1_DESDA          ATIGQFSS----------------------------------------------------
Q1MPP6_LAWIP          ATMASFDI----------------------------------------------------
C1A6S5_GEMAT          GALAQFSG----------------------------------------------------
C9RR14_FIBSS          AMVASWFPN---------------------------------------------------
Q1D755_MYXXD          ATLGTWFP----------------------------------------------------
C1F622_ACIC5          LLFSHAAF----------------------------------------------------
E8WZ43_GRATM          LLFAGMSFFGSAK-----------------------------------------------
Q1ISA2_KORVE          QTVGMLGS----------------------------------------------------
D5UB65_BRAM5          AQIASLTR----------------------------------------------------
E8R478_ISOPI          WILFNTLRGVTASWIDPDAT---------------------------------------T
D5SQ93_PLAL2          MFLFQILSQFFPT-----------------------------------------------
D2R6I9_PIRSD          AFIFGLIASSFAGSESDS------------------------------------------
Q1Q157_KUEST          AAIMQGIQIRFEP-----------------------------------------------
SECY_CHLTR            ATIGQFLSS---------------------------------------------------
B2UQN0_AKKM8          QVLFSQI-----------------------------------------------------
B3E0K3_METI4          STMIGFL-----------------------------------------------------
D5EJU0_CORAD          TQILYTLGK---------------------------------------------------
A6DRC9_9BACT          PMIINKI-----------------------------------------------------
D0JAT9_BLASB          LTFSDYVKNV--------------------------------------------------
C6X1Y0_FLAB3          GLLTKVDES---------------------------------------------------
F4KXT7_HALH1          TTAAQFSSTGG-------------------------------------------------
D1AVF8_STRM9          SAIIPLIKDQSK------------------------------------------------
C7NDL7_LEPBD          PFLVSMLKAGTL------------------------------------------------
E3H907_ILYPC          SLIVNSLPADMPG-----------------------------------------------
E0XPY0_9BACT          SVIASYFN----------------------------------------------------
A0A142V9H9_9CHLR      GLVASYFM----------------------------------------------------
B8G6Q5_CHLAD          GIVASWFYR---------------------------------------------------
E8N3P4_ANATU          SMLASYFIL---------------------------------------------------
C8WTV3_ALIAD          YTIASYFQS---------------------------------------------------
E3SG16_9MOLU          GTISLLLG----------------------------------------------------
B2LW75_9MOLU          PIFSVFFS----------------------------------------------------
B1VAC8_PHYAS          TTLADLIG----------------------------------------------------
A9NEF3_ACHLI          LSIVGFLE----------------------------------------------------
SECY_ARCFU            VALGQVL--------------------HARGVTIFGEFVNGKA----------------V
D2RE43_ARCPA          VSVGFML--------------------YNNGVKFLGEYAPGTAT--------------PI
A0B9U7_METTP          EMLGALLTAKLGTVTTAETTAEGVRIVYTGYQSWLGTFLSSAKFDAATGAPISATSPQPV
D3SWN3_NATMM          QFMGQIMYS----------------QLGDDMPSVLGTFGPD---------------GQPV
D2RUE9_HALTV          QFIGQILAT----------------QGGANGEGPIQLFGQELAWLG------TYSNGQPV
Q2FSG8_METHJ          QMIGLFLNN----------------IGIT----IFGTFEGQ----------------TPT
Q2QAQ7_9EURY          NMFTLLFWSHPTMST----------VPILGSQ---GAWSIAPYLGS-----YDVGQTQAT
B5ICT8_ACIB4          AMWSILFWSNPTLSQ----------IPILGHNPWLGAYPTPQQAAE-----WGIKTTTPI
SECY_METVA            QLWG-MFLDRMGYP-----------------------ILGQYS------------NGTAV
A6UWW1_META3          QLVGLMVQSKLGYP-----------------------LLGSFV------------DGRAV
SECY_METJA            QLWG-LALYRMGIP-----------------------ILGHYE------------GGRAV
SECY_METTH            QLLA-NVFQKLGYP-----------------------ILGTVS------------NGQAV
SECY_PYRFU            QLWA-RVLDRLGHP-----------------------WLGRFDPT----------TGSPI
SECY_PYRAB            QLWA-RVLDRLGHP-----------------------WLGTFDPT----------TGNPV
B1L789_KORCO          DILAKIAWSRLGSETSGW-------------AKYLVDFLGRYEADP------VSGSVVPV
A0RUE4_CENSY          IFIGQMFWSNFNPRNDN-------------------IFLNVLAQFD------LTNPSTPI
SECY_SACS2            QLFASLASYVSPSA---------------------------------------SNILNTV
SECY_SULAC            QLFASLANSISNSA---------------------------------------SGILTDI
SECY_AERPE            LLVQRLLADYLGVE---------------------------------------SRAYQIY
                                                                                  

SECY_TRICV            -----NLGLLRILTPLITLPVFVK------------------SYKIIYWVSYFVLILLFS
C6KIV7_9STRA          -------GFLAIISRFNVSFSQSN------------------LFNTLYLLLYFFLTLFFS
D2ISB1_9CRYP          -----RSTNNRFMWLLTNFMPLVT------------------FQKIISIVVYFLLVVGFS
SECY_HETA2            -----KINSFNLFPFLIKFPEVVN--------------------QSLESIVEAGLICLFA
SECY_VAULI            -----QTNIFNIFFQYPILNSVISYW----------------FLKILFWIFYATLIFFFT
SECY_CYAPA            -----FTNFLLQQGNWGYQLIKSFPF----------------NSLFKDFCYLITIMLFSS
SECY_EMIHU            -----YPAQILLSSALLTNAAGLASK----------------LLTIYSFGINFVLVIFFS
SECY_DIALT            -------IKQLPNANIATRVILDSVN----------------LQQIFYFFTFLVLIIFFS
SECY_SYNY3            -----TGNEGLGGFGEIFVQISNALR----------------PGTWVYTVVYSVMIFFFS
SECY_ANTSP            -----NSK---------ITQFINLFL----------------PNQFLYLPLYLIFIITFS
SECY_CYACA            -----LSTLQ-------AVYFINDIL----------------PFKILFLLLYSAFIIFFN
SECY_CYAM1            --------------------------------------------TWSIWWLYVACIIFFS
SECY_LACLC            ---------NVGWLSTLQNALSYTT--------------------WTGMLFYALLIVLFT
Q04G66_OENOB          ---------DKPWYKIASNIFSLQT--------------------WEGTLAYGLMIVLFT
SECY2_LACKZ           ---------NSSWYRVVQTFFTLST--------------------TSGVIIYGLMIIFFE
SECY_STAEQ            ---------KAEWAQNIADTANPSS--------------------NIGMIIYVVLIIAFA
SECY_BACLD            ---------SNDVTNWIQKTFDYTH--------------------PVGMGVYAALIIAFT
B5ZB59_UREU1          ---------QSMGYYVIHNYFIVDS--------------------WTGLAIYVVLILLFT
Q8EUD2_MYCPE          ---------GSAGSEFINEYLSIER--------------------PVGLVIYTVLIVLFG
SECY_MYCGA            ---------QSEARWFVEDYLSLRT--------------------PVGISLYVILIIIFT
E8ZJY0_MYCHL          ---------YPSVSSFVKSYLSLGS--------------------PLGLAIYFWLIIFFS
F0QR54_MYCSL          ---------SPGFNAFIRDYVSFGS--------------------PTGLLIYFLLIVVFS
SECY_MYCCT            ---------DSGFVIFTRDYLSFNT--------------------WWGISIFGILIVLFT
B3PMM8_MYCA5          ---------TSYYYYWVNNNLQLTQ--------------------PLGFFLFIIITFGLS
D1J867_MYCHP          ---------TSKYYQWVYNNLQFTQ--------------------PLGFFLFILITFGLT
Q6KI36_MYCMO          ---------SNPFRIWVESNLRPNN--------------------TIGFILFISITFIFA
Q4A8J0_MYCH7          ---------TSAVRNWIDNNMQIYH--------------------PIGLIIFIVFNVSFS
C4XFZ5_MYCFP          ---------GNSGKLWIEANMQFTQ--------------------PLGLSLLILITFFFS
D4JDN6_9FIRM          ---------ND-IIRTMQDWLGLQT--------------------WYSLVIYVLLILFFT
E7FW44_ERYRH          ---------NSGFYKFMTTTMSLQQ--------------------PVGLIVYALLIIAFT
SECY_MYCBO            GNSWWDKFVGTYLSDPSNLVY---------------------------IGIYFGLIIFFT
A9WST8_RENSM          NVPAWATWITDNLTKGDHPIY---------------------------MVLYFLMILFFT
A1A089_BIFAA          SDQSWVKWINSNLANTTSVWY---------------------------IALYALMIVFFC
C7M2Z2_ACIFD          -WKPLVTFVNDHLLNATSGFY---------------------------IVTYGLLILVFT
C7MP31_CRYCD          --VDWLEVFANAIS--SGWLN---------------------------WIMTFGLIIFFA
Q1AU49_RUBXD          GDQSSWLFRLAQIFAPPSAPY---------------------------LILYALLIVMFT
D3QZ81_MAGIU          -SHSNNWLVNWFRNPGSSPFY---------------------------YVLQALLIIGFT
D1VTM8_9FIRM          ATRNWITKWLSPSGGPGVVIY---------------------------VLCSVILIIFFT
B0RZS9_FINM2          MP-GWLAHIFTVQTTSGLVIF---------------------------SIVNMLLIIIFA
Q18CH6_CLOD6          AQ-AFVQKYLSMATEQGFWTY---------------------------RSIEILLIIFFS
F4XGV5_9FIRM          TTSGGFGGGLMNLFDTTKPFY---------------------------SILYFLLIVGFS
E6UBM7_RUMA7          PKPGTFYDGLLRWFNYTHPFY---------------------------ACMYFVLIIAFN
A9KJH4_LACP7          PARAYFWPKVLHMLNSQSWFNIKNGE----------------FKYTVGVLIYMALIVFFA
D9QZP1_CLOSW          INYNSIGGHILMALNSSSWFKPERP------------------VYSIGLLVYVALIIVFA
F2JSH2_CELLD          VSENW-----QTVLNWLNWTN------------------------PVGSVIYIILIFAFA
C7H0Y9_9FIRM          SAFGQWAAKWMSPS-GSPGVW-------------------------VYAIADVILILFFT
B8D0S8_HALOH          -GWAQDIATALEP--GKP----------------------------VHLVLYAAMIFFFT
C9KPC7_9FIRM          VPWVKTVASYLE-----WGKP-------------------------LQTALYVGLIIFFT
C9LN14_9FIRM          IGWVQSVGNFFA-----WGSW-------------------------PNTICYGILIFIFT
A4XLR1_CALS8          SGFYKFVKAYFS-----SGSF-------------------------WYTFFYALFIIGFT
B0TC76_HELMI          SPVGQWFQQYFN-----FGSF-------------------------LHSAFYALLILFFT
F0SY27_SYNGF          SGFAVFVHKYMSIS-GSFTSI-------------------------PYMILYAGLIIFFT
SECY_THET8            DNP--VLQGIANFFNPTRPSG---------------------------LFIEVLLVILFT
Q1IX92_DEIGD          TRAPEVNAFIQTYLTPGSPWY---------------------------IALEALLIFGFT
SECY_THEMA            NET------LKNLFRAGGFLY---------------------------LLIYGLLVFFFT
B9K8A6_THENN          SET------LKSLFRAGGFLY---------------------------LLIYGLLVFFFT
C9M915_9BACT          SQS---VNRAAEALAPGSWLY---------------------------SVLYVILIVFFT
D5EE00_AMICL          GNI---ATMVQKMFEPGSVVY---------------------------IVLYISLIIFFA
B5YDW2_DICT6          IGW---LKAFLSIFSPSSVLY---------------------------PIIYFLLVLGFT
D9SX80_CLOC7          FAVWINSDKWFNIFKYNSGAY---------------------------NITYIVLIIFFT
A6LPT1_CLOB8          WAKWV-LNNPTSIFNNKSWMY---------------------------MVLYAVLTIFFN
B5Y968_COPPD          FTKWW-----GTYFNHMTIWY---------------------------NLAYFILVIFFA
SECY_ECOLI            -------GTGWNWLTTISLYLQPGQ--------------------PLYVLLYASAIIFFC
SECY_HAEIN            -------NDKFEWLNNLSMLLNPGQ--------------------PLYLLVYAVAIIFFS
SECY_BUCBP            -------RDHFKWLVDIVFYLQPTK--------------------PLYILTYITAIIFFC
Q7WZR8_9GAMM          --------VGQWINRSILPQLSPGQ--------------------PLYIMFFVLSVIFYS
A5EX98_DICNV          -------GAAGRYLSDLAAGFHQGA--------------------WLYIATFVLLIILFS
SECY_RICBR            ---------NSEIMNMLTYYLGHGK--------------------PIYILLYVALIMFFS
B3CT25_ORITI          ---------DSAILQAIVSYFSPGK--------------------LVFILCYGLLIIFFS
Q5GSW3_WOLTR          ----------HAFSDFILNYFMANK--------------------VVYIAAYLALIVFFN
Q2GEC0_NEOSM          ----------SHLGEFIIRYFSVGQ--------------------PLYFLLHSCLLVFFC
B2KEK2_ELUMP          --------PESTWAIKITEFMGRGH--------------------LAYFAIFASLIIFFC
E1X0K2_HALMS          -------HPLKPYLDTVIQSLYPGQ--------------------LLFNILFALLIVYMT
SECY_BORBU            -------AETSSIARQILSYLRPNG--------------------FYYTFLNVILIIGFT
O83238_TREPA          -------GPNVRFLHQLAQFLRPNS--------------------WWYNAFYVVLIVFFA
SECY_HELPJ            -------ATSNKTLQAIADFLSPQG--------------------YAYNILMFLLIIFFA
D3UIH0_HELM1          -------ASSNVYLKSVADFLGPDK--------------------YAYNILMFVFVIFFA
SECY_AQUAE            ----------NPFIKVIADMFQPGA--------------------IFYNFLYVTFIVFFT
D3DH80_HYDTT          ----------HPIARLLHDAFNPTT--------------------LFYNFLYVLLIVFFT
E8T4B5_THEA1          ----------NPIAQSIYEALQPGT--------------------TLYLVVYGALIFFFT
D4H3A7_DENA2          ----------NLLVQKISFFLSPSS--------------------WVYYAVTLGFIIFFT
D3P918_DEFDS          ----------NPIIAKIGYYFSPSS--------------------FTYYIIYVALIVFFT
E4TEN9_CALNY          ----------SELIKRVGFYLSPSH--------------------FLYYLLYALLIVFFC
E6W730_DESIS          ----------TPNVEMFMQLFSPGG--------------------WLYTGLLAAFIIFFC
B8IYL1_DESDA          ----------NEYVKHAAELFSPQG--------------------VAYNVLYVALMFFFC
Q1MPP6_LAWIP          ----------SDWLKDIAVWFSPST--------------------ILYNCIFLVLIFFFC
C1A6S5_GEMAT          ----------NPKLQEIAEYFNPQGP-----------------NPWLYFVLSAILIMLFT
C9RR14_FIBSS          ----------VSAMQAFASAFIPGH--------------------ISYSVVDALLIIFFT
Q1D755_MYXXD          ------------FLQGFQRAIEGNL--------------------WIYNGLFVVMVIFFA
C1F622_ACIC5          -------VRNSSVLNSIATALAPGE--------------------PWYEFLYFASIIFFA
E8WZ43_GRATM          -------LQDTTFFGPILRAIAPGE--------------------PLYELLYIVAIIFFA
Q1ISA2_KORVE          -------VSKYHWVKNLMDQLKWGE--------------------PLYTMLYALGIVFFA
D5UB65_BRAM5          -------GVQWRWLDALLRFFSYGS--------------------WAYIILYCLLVIMFA
E8R478_ISOPI          LGARFASGLAQFFEAASDAFGQP--------------------SGFVYLFLNITLIYFFC
D5SQ93_PLAL2          ---------VGFFRLAEATMQNH--------------------GGFIYNILYIGLIYFFC
D2R6I9_PIRSD          -----GQTTAKFFYELQGMFASG--------------------TSFTYIVCYVILIYFFS
Q1Q157_KUEST          -------GSVGYWITSRLSGILQ--------------------EGVLYVMLYILLITFFC
SECY_CHLTR            ---------ESSWLKRIATMLSP--------------------GSVAYSIFYVLLIIFFT
B2UQN0_AKKM8          -------AHYNTTLQWIATKMNDWLN----------------PASSGYYIISGLMIFFFS
B3E0K3_METI4          -------VPNSVVAARIANSLS---------------------AGSLYYALSVVLIFFFS
D5EJU0_CORAD          -------ATNMNFLNEFADSLQR--------------------GEAAYYILFGLLIFVFS
A6DRC9_9BACT          ---------GGDFARTVAPYFDF--------------------GSTSYLIIQGVMILVFT
D0JAT9_BLASB          ---------------NIKNFFHLFQD----------------IYGLWYNLTISILVIVFT
C6X1Y0_FLAB3          -----------------NTFLAGFKD----------------VFSWQYNVLFAVLIIIFS
F4KXT7_HALH1          --------------TSTTGVLAALND----------------FTSVPYNVIYFLLIVVFT
D1AVF8_STRM9          -----------------QAYLLNLFG----------------PKGWAYLISTAVLIVLFS
C7NDL7_LEPBD          -----------------KNFLAAQFE----------------PKGAFYLLLFAILITVFS
E3H907_ILYPC          -----------------RIMLGRLFT----------------QTHPVYLITYAALIMFFS
E0XPY0_9BACT          ---DGSGG---FVSTVASFFQNSFG-----------------PTNTIYWVAIFLLVVVFT
A0A142V9H9_9CHLR      ---AGSTAEPNFWNSVYTIFSSSASM----------------PGGLVYWSLYFFMTIIFA
B8G6Q5_CHLAD          ---PGAEGIGNAIAGFFYNTFNPTGQ----------------GGGIVYMTLLFLLTVGFT
E8N3P4_ANATU          ---SKTEWVANAARDIQRLFSSQSA---------------------LYIIIYFLMVVLFT
C8WTV3_ALIAD          ----------HHWAEFILRYLSPQT--------------------GWFMGAEVILIILFT
E3SG16_9MOLU          ---------PENGFSQWVNRFQVSQS----------------HYLGLGFFVYLLLILLFS
B2LW75_9MOLU          ---------KESSFNKFAKIF-VESR----------------HYLGIGFFVYLLLIILFS
B1VAC8_PHYAS          ---------NQT-FKSVVDYL--TNA----------------RIFNFAFGLYILLIIIFS
A9NEF3_ACHLI          ---------GSLGAGTQSWIN-AIFN----------------YQEPLGFIIYLILIIAFS
SECY_ARCFU            SGLMFFLQPVSSPYDWIPSLVK-----SQGAAFAAIPDWMIYLHLLIDALILVVGGIIFA
D2RE43_ARCPA          SGIMYLLSPVNSPYDWVPAFVKDPSRNSLAPYFADMPDWMIILHLIIDATILIVGGILFA
A0B9U7_METTP          SGLMYYLSPIHGPSDWIPSMVSQSTPGLVELGINPIAGWQIWLHLLTDTAFLIIGGIIFA
D3SWN3_NATMM          GGFFYYTAPIYSPEDWMWWTGEVA-----------QQAWMVMIRIGVDLTFMVIGGAIFA
D2RUE9_HALTV          SGFFYYVAPIYSPQDWMWFMGGVT-----------QDAWQVLIRMSIDVTFMVVGGAVFA
Q2FSG8_METHJ          GGLMWYLAPINHPSDWMWWMPSYVG---------GHAPWEVLIRLGIDTTIMVVGGAIFA
Q2QAQ7_9EURY          DGFAWYASMVNGVGDWLLPLLNQSP---DPYG---HSLWQVVLHVITYVTVMTLGSMMFA
B5ICT8_ACIB4          GGIAYYLNRVRGLSYWLLPLINPQA---YHYVFTYQTYWMLVGNVVIFVSFMIGMSIIFA
SECY_METVA            SGIAYYFST----PYGISNIISDPL------------------HAIFYTLMMVIFCILFG
A6UWW1_META3          SGIAYYFAT----PYGLTSVLADPI------------------RAIIYTILMIIFCIIFG
SECY_METJA            DGIAYYLST----PYGLSSVISDPI------------------HAIVYMIAMIITCVMFG
SECY_METTH            DGLAYLLTA----PRSIDALILDPF------------------RVVFYAVVFIGLCVLFA
SECY_PYRFU            SGFVLYVIP----PRNIFSVIDNPV------------------RAIVYLILTVIFSLLFG
SECY_PYRAB            GGFVLYVIP----PRSIFTVIDNPV------------------RALVYLILTVISSLIFG
B1L789_KORCO          QGLAYYLAT----PHGPSVLVQDPI------------------RAIVYIVILIASCMAFA
A0RUE4_CENSY          GGIVYYITP----PRGLDIAALDPM------------------RAVGYVLFMIGIVVVFG
SECY_SACS2            SGVFFFPPPNSAIPHSIYAVVLDPL------------------GALEYAVVFIVLSILFG
SECY_SULAC            ANAFFFPP--QGVPHSVYALVVDPV------------------GAAIYAAVFIVLSIVFG
SECY_AERPE            SSIVYYLSP----PRGVVQSIADPV------------------KTAVFIASWTVLSIVFG
                                                                                  

SECY_TRICV            LFYS-TIVVNPKDLSDELQKMAVSIPGIR-PGVETTFYLKQVMKRVTLLGAIMLALLATL
C6KIV7_9STRA          YFYS-TIAINPIDLSKDLKRMAFTIPTIS-PGVATIKFLQETLNRLSLLSGLFLAIIVTL
D2ISB1_9CRYP          YSHG-LLIVKPDEISKNLQKMETSIQGVR-PGKDTTFFLRTKLQNFILLGSILLACIACM
SECY_HETA2            LFYS-GLIIDPKDVADELQKSGFFIFAIR-PGEKTRNYLEKIFKELSLIGALILAFNVVL
SECY_VAULI            YFYS-TIVLDPKDVAERFRKNSVVILGIS-PGSSTRSYLSKILRFIAKINAIFLIYNIIG
SECY_CYAPA            NYAL-TIMINPKTLAENLNSMNALIPGVR-PGSETKVYSEQLIHRLNFIGSFVLALVCIL
SECY_EMIHU            CFYV-SLVLKPKDMSENLGKMAYSIPGIR-QGKETTKYLEKVINRLAFIGGLFLAFLAFF
SECY_DIALT            FFYT-LIILSPSDIAKNLKKMSSVIQDTK-PGVATKVYIRKFILQASFVGSILLSALILI
SECY_SYNY3            YFYA-SLIVNPEDVSKNLKKMGSSIPGIR-PGKKTEQYLEGVLNRLTFLGAIFLSFVATL
SECY_ANTSP            YVYT-SLILNPEDIAKNLKKMGASIPNIR-PGSETIKYLNTRINRLTLIGACFLFTITLF
SECY_CYACA            YLYC-SLVLNCFELSNNLKKASVVIPSIR-PGKMTEKFFKDTLDNLTLFGSGFLAFIVLA
SECY_CYAM1            HFYN-LVIANPKELSENLNKMAVVIPSIR-PGAETQQYLNRTLNRMSWIGGIALSLIALL
SECY_LACLC            FFYS-FVQVNPEKMAENLQKQGSYIPSVR-PGKGTEKYVSRLLMRLATVGSLFLGLISII
Q04G66_OENOB          FFYA-FVQVNPEKVSENLQKQGSYIIGVR-PGEETKKFLSRLLNRLSGPGSIFLAVVAVV
SECY2_LACKZ           YLYS-IVQIEPDKFADNLEKQEAYIPNVY-PGDPTKEFIQNMLNYLSLPGSLFLMLVSII
SECY_STAEQ            YFYA-FVQVNPEKMADNLKKQGSYVPGIR-PGEQTKKYITKVLYRLTFVGSIFLAAIAIL
SECY_BACLD            YFYA-FVQVNPEQMADNLKKQGGYIPGVR-PGKMTQDRITSILYRLTFVGSIFLAVIAIL
B5ZB59_UREU1          FFFS-YVQLNPPKMAEDIKKAGRFIPGVQ-VGMDTEKHITKVIYRVNWIGAPILAFLACL
Q8EUD2_MYCPE          FFYS-HIQVNSEKLAENFQKSGKFIPGVK-MGEETQKYISKTLNRVNCIGVPFLACLAIV
SECY_MYCGA            FFYS-YIQINPEQLAENFNKSHKFIPGVR-PGLDTEKHITKVLMRINFIGAPFLAIVAVI
E8ZJY0_MYCHL          FVYS-HIQLNLEEMTRNFGKSGRFIPGIR-SGQHTYNHLKSVVNRINCFGAPFLAFVAVL
F0QR54_MYCSL          FLYC-QVQFNTEEMCRSFQKQAQFIPGVM-IGQETHNYLRMILNKINWFGAPFLGLVTIM
SECY_MYCCT            FLYS-QVQINPEKIAENFQKSGTFIPGIK-PGKDTTKYLTGIINRLSVVGSVFLAIIALL
B3PMM8_MYCA5          ILMG-IQQSKVDKISEDFAKSSTFIPGIR-PGEQTESYLLDSVIRLSFFASFYLIVLGAL
D1J867_MYCHP          ILMG-IQQSRIDKISEDFAKNSTFIPGVR-PGEQTEDYLLNVILRLSFFSSGYLLLLGAL
Q6KI36_MYCMO          IFFG-LQQSKVDKIAEDFAKNSTFIPGIK-PGQETETYLTGIVLRLCFFSAFYLIIIGGM
Q4A8J0_MYCH7          IIMS-LQQSRVDKIAQDFAKNSTFIPGIR-PGEQTEDYLISVVLRLSVFSAIYLTFLGIL
C4XFZ5_MYCFP          YIIG-LQQSRIDKISEDFAKNSTFIPGIR-PGEETEDYLIGVVLRLCTFSGFYLVFLASF
D4JDN6_9FIRM          FFYT-KMQINPEKISENLGKSGAYIPSVR-PGTETKNYVNKVLSRITVLGSICLALIAVL
E7FW44_ERYRH          FFYT-HLQVDPEKISEDFGKNGSYIPGVR-PGKDTKNYISTILNRITVLGSLFLTFVALL
SECY_MYCBO            YFYV-SITFNPDERADEMKKFGGFIPGIR-PGRPTADYLRYVLSRITLPGSIYLGVIAVL
A9WST8_RENSM          YFYV-AITFNPEEVSDNMKKYGGFIPGIR-AGKPTADYLQYVLSRITLPGAIYLGLVALI
A1A089_BIFAA          FFYT-EITFNPDETADNMKQYGGFIPGIR-AGSATSNYLSYVMNRLNTVGAVYLLFVALI
C7M2Z2_ACIFD          FFYV-TVSFDPYQQADIIRQQNGYIPGVR-PGEETRRYLSRILNRITLPGAVFLAAVAVI
C7MP31_CRYCD          YFYT-SMVFNPEELSDNLRKQGGFIPGIR-PGSATVTYIKNVIRHVTLPGAMFIGAVAVV
Q1AU49_RUBXD          YFYT-AVQFNPIEHADNLKKSGGYIPGIR-PGQPTALYLNSVLTRITLFGAVFLAVIAVL
D3QZ81_MAGIU          FFYT-AIQFNPLEIANNLQKNGGYIPGIR-PGRPTCDYIGRTSQRICWFDGLFQTIVVLV
D1VTM8_9FIRM          FFYT-TIQFNTVEYSKNMQQNGGFIPGIR-PGKPTSEYLQRSLNRLVLPGAIALAILSVL
B0RZS9_FINM2          FFYS-AIQFNTVEYAKNLQQYGGFIMGIR-PGKPTGMYLKKISDRVTFIGAIILAIVASA
Q18CH6_CLOD6          YFYT-TVSFNTEDISKNMKNNGGFIPGIR-PGEPTMDYLNRILTRLTLAGATFLAIIAMV
F4XGV5_9FIRM          YFYA-TMQFNPIEVANNLKKNGGFIPGFR-PGKPTADFIMKVLNKITMFGALYLSVVAIA
E6UBM7_RUMA7          YFYV-SMSYNPIEIANNLRQNNGGVPGIR-PGKPTSDYFQRILSKITLVGAVFLGIIAIF
A9KJH4_LACP7          YFYT-SITFNPMEVANNMKKQGGFIPGIR-PGKPTTEYLTKVLNYIIFIGAIGLMIVAII
D9QZP1_CLOSW          YFYT-SITFNPLEVANNMKKSGGFIPGIR-PGKPTSDYLNSILNYIVFIGACGLTIICII
F2JSH2_CELLD          FFYS-TIAFNPMEIASNMKKSGGFVPGIR-PGKPTSDYLAALGTRITLLGAIFLVILAIM
C7H0Y9_9FIRM          YFYT-AVSFNPLEIAQNMKANGGFVPGIR-PGKTTVEYLNRVMTRITFVGAVFLAAISIL
B8D0S8_HALOH          YFWT-AFTFNPEEVADNMRKSGAFIPGIR-PGKATENFLTRILVRVTLAGAIFLTVIAIM
C9KPC7_9FIRM          YFYT-AVTVKIPDMADNLKKYGGFIPGIR-PGKPTADYLDHVLTRITLAGSVFLAFIAVL
C9LN14_9FIRM          YFYT-AISLNIKELADNMKKYGGFIPGIR-PGEPTMIYIDKVMSRITLAGALFLAFIAIL
A4XLR1_CALS8          YFYT-AIVFNPVEIANNLKNNGGFIPGIR-PGKPTVDFITRVLSKVTFAGALFLAFIAIL
B0TC76_HELMI          YFYT-AITFNPVDVADNMKKYGGFIPGLR-PGKPTADYITRVMSRITLVGALFLAVISLL
F0SY27_SYNGF          YFYT-GITFNPVDLADNLKKNGGFVPGIR-PGRPTSEYFMRILNRVTLAGGVFLAIIAVL
SECY_THET8            YVYT-AVQFDPKRIAESLREYGGFIPGIR-PGEPTVKFLEHIVSRLTLWGALFLGLVTLL
Q1IX92_DEIGD          YLYN-SVQFDPRRISEQLREAGGFIPGVR-PGTPTAEFLGGISGRLSLWGAIFLVVLTVV
SECY_THEMA            YFYS-VVIFDPREISENIRKYGGYIPGLR-PGRSTEQYLHRVLNRVTFIGAVFLVVIALL
B9K8A6_THENN          YFYS-VVIFDPREISSNIQKYGGYVPGLR-PGRPTEQYLHRVLNRVTFIGAIFLVAIALL
C9M915_9BACT          YFYT-AMVFNPAEVAENMKKNGGFILGIR-PGKPTADYIERVATRITMVGAAMLVVIALV
D5EE00_AMICL          YFYT-AVVFNPADIANNMKKYGGFILGIR-PGRPTSEFIEKVMSRITLGGAVFLAIIALL
B5YDW2_DICT6          YFYS-SIVFDPADLAENFKKYGGFIPGVR-PGKPTEEYLQRTLNRLNFFGGVFLGIIALL
D9SX80_CLOC7          WFYT-QIIYKADEMAENIHKSAGFIPGVR-PGEDTRLHIEKVLSRVSIIAGTFAALIAIF
A6LPT1_CLOB8          WFYT-QITFKPDEMSENLHKSAGFVPGVR-PGEETTTYFERVLNRLSFIGGILAAVLAVT
B5Y968_COPPD          YFYN-TIAYDPDEIAKNIQKQGGFIPGIR-PGKPTADYIAGVIYRLTLPASIFLGLVAVL
SECY_ECOLI            FFYT-ALVFNPRETADNLKKSGAFVPGIR-PGEQTAKYIDKVMTRLTLVGALYITFICLI
SECY_HAEIN            FFYT-AMQYNPRDTADNLKKSGAFIPGIR-PGEQTSRYIDKVMTRLTLIGGLYVTFVCLV
SECY_BUCBP            FFYT-GLAFNPRETADNLKKSGAFILGIR-PGEKTAQYINKIMLRLTFLGSMYMAFICLV
Q7WZR8_9GAMM          FFYT-AIVLNAKEVSINFKKSGAFIHGMR-PGKQTAGFISKVSSRLNWFGAIYIVFFSLI
A5EX98_DICNV          FFYT-SIMFENRELADSLKKSSAFIQGFR-PGRQTADYIDTVQERLTFVGAFYVAFVCVL
SECY_RICBR            FFYT-AIVFNSEETANNLRKYGAYIPGKR-PGKNTSEYFDYILTRLTVVGGIYLSVICII
B3CT25_ORITI          IFYT-AIVFNSEETAENLRKYNAYIQGRR-PGKSTAEYFDYLLSRISILGALYLCIVCLV
Q5GSW3_WOLTR          FFYT-NFIFNPEENADFLKKNGGFIPGRR-PGKHTSDYLQDIVFKLTFIGSAYLVVICTV
Q2GEC0_NEOSM          FFYS-DFVFNTTEISDSLKKGEAIVAGRR-PGISTKRHLDYVLRRITVVGAAYLVCICVV
B2KEK2_ELUMP          YFYN-SMTINPSDLAENMKKNGGFIPGIR-PGEPTKNYLEWVLNRITLSGAIFVCLIAIM
E1X0K2_HALMS          YFYA-PIQFKTKKVAEMLQKNNAFVPGVR-PGAKTKEYLDFILNRMTFFGALFLVVICIL
SECY_BORBU            YFYS-KIQLSPKDISNNIRKNGGTIPGIK-SDE-MEKYLDEIMNKTLFSGSIFLSIIAII
O83238_TREPA          YFYT-QVTLNPTEIAKQIRENGGTIPGIR-ADK-TEEYLQGILNRLVLPGSLYLGMIAVL
SECY_HELPJ            YFYS-SIVFNSKDIADNLRRNGGYIPGLR-PGEGTSSFLNAVASKLTLWGSLYLALISTV
D3UIH0_HELM1          YFYA-SIAFNSKDIAENLKRQGGYIPGMR-PGEGTVHFLNAVAGRLTLFGSLYLAIISTL
SECY_AQUAE            YFYT-AVLINPVELAENLHKAGAFIPGVR-PGQDTVKYLERIINRLIFFGALFLSVIALI
D3DH80_HYDTT          YFYT-AVLINPVDVADNLKKGGAFVPGVR-PGQDTQKLLETIVNRLAFIGSIFLSVVAII
E8T4B5_THEA1          YFYT-AIVFNPEEIAENLNKAGGFIPGVR-AGTDTAKYLDRIVSRLTFAGAVFLTLVALI
D4H3A7_DENA2          YFYT-SIIFNPDDIAENINKSGGVIPGKR-PGVETAKFIDFTLSRLTFVGALYLGAVAIL
D3P918_DEFDS          YFYT-SIIFNPDDIADNIEKSHGVIPGKR-PGKPTAEFIDYVLSRLTFVGALYLAVVAIL
E4TEN9_CALNY          YFYT-SIIFNPTDIAENIQRSGGVIPGKR-PGSNTAEFIDYTLSRLTFAGAIYLTIVAIM
E6W730_DESIS          YFYT-AIIFNTKDVAENLRKNGGYIPSIR-PGAETSMYLDNVLSRLTFGGSLYLTLVAVS
B8IYL1_DESDA          YFYT-AIIFDPKDMAENLKKNGGFIPGIR-PGEKTQEYIDTVLTRLTLSGATYISIVCLL
Q1MPP6_LAWIP          YFYT-AIIFDSKDISENLKKAGGFIPGIR-PGEKTCEYLDGVLSRLTLWGGVYISIISIL
C1A6S5_GEMAT          YFYT-SIIFNPVDLAENLKKQGGFVPGIK-PGAKTAEYIEQVVERITLPGAIFLTFIALM
C9RR14_FIBSS          YFYT-AIQYNPNDIAENLKRSGGFIPGVR-PGKQTAEYIDHVLTRISLPGSLYLALISVV
Q1D755_MYXXD          YFYT-ALTFRPDDVADNIKKQGGYIPGIR-PGRQTAEFIERVLNRLTFGGAIYLSIVCVI
C1F622_ACIC5          YFYI-SIVFRPDDIADNMRKYGGFIPGIR-PGKRTSDFVNDILTRITLIGAIYLCIVAII
E8WZ43_GRATM          YFYI-SIVFRPDDIADNMRKYGGFIPGIR-PGRRTSDFINDVLTRITLVGAVYLIIISII
Q1ISA2_KORVE          YFYV-SIVFNPNDVADNMRKYGGFIPGIR-PGARTATYINDILTRITLVGALYLIIISFI
D5UB65_BRAM5          YVYT-SVQFNPDDIAENLKKSGGFIPGYR-PGTQTAEYLKTVLSRITIGGSIFLAAIAVF
E8R478_ISOPI          YLWT-AITFNPKDMAENLKDYGSFIPGYR-PGKRTADYLEKVMLRITYVGAAFLSLVAII
D5SQ93_PLAL2          YFWT-AITFNPKDMANNLKDYGSFIPGYR-PGGRTAAYLEAVMVRVTFVGAAFLSLISII
D2R6I9_PIRSD          YFWT-AITFNPKEMADNLKDFGTFIPGYR-PGRRTAEHLEKVMVRITYVGAAFLSLVAIV
Q1Q157_KUEST          YFWT-AIQFNPREMSNNMKDYGSFIPGIR-PGHRTAEYLESIMGKITLAGAAFLSLIAIL
SECY_CHLTR            YFWT-ATQFRPEQIASEMKKNGAFIPGIR-QGKPTQTYLEYTMNRVTLLGAVFLAVVAIL
B2UQN0_AKKM8          YFWV-ATMFQPSQIAEDLKRNGGYIPGIR-PGPPTALFLDQTMQRLTFAGSAFLTLIYFL
B3E0K3_METI4          YFWV-ATQFNPVQIADDLKKHGGFIPGIR-PGAPTSEFLDYSMTRLTLAGAVFLSILAVL
D5EJU0_CORAD          YFWV-SLMFKPVQIADDLKKNGGYIPGVR-PGEPTAKFLDHVMTRLTLFGALSLTVIALF
A6DRC9_9BACT          FFWV-ATQFNPIQIADDLNRSGAFVPGHR-PGEPTSTFLNDTMTRITVAGAIFLVILALL
D0JAT9_BLASB          FFYT-AITIPVNQMADDLKRNGGHIPRIK-PGKETAEYIDHVLSKITLPGAILLAIIAIF
C6X1Y0_FLAB3          FFYT-AITIPVNQMADDLKRNGGLIPKVR-PGKETADYLDDILSKITLPGSIFLAIFAVL
F4KXT7_HALH1          YVYT-ALIVNPQNYAEYLKRNNAFIPSVK-PGQPTADYIDAITSRITLPGAVFLGLIAIL
D1AVF8_STRM9          FFYT-AIVFDPEKIADSLKQSGGSIPLKR-AGKETSDFLEYVATRITFGTAIFLAILGIL
C7NDL7_LEPBD          FFYTLTIAFDPDKVADDLKQSGGTIPTVR-AGKETADYLEKVATRVTFGSAIFLSLLGIM
E3H907_ILYPC          FFYT-AIMFDPEKVADNLKQGGGTIPGIR-PGEETVVYLENVVTKITWGGAAFLATVSVL
E0XPY0_9BACT          FFYT-LVVHNQQNLAENLQKNGGFVPGIR-PGPPTKVYLMRVVLRITWGGALFLGFVAIM
A0A142V9H9_9CHLR      FFYT-MVTFEQQDIPGTLQRQGGFVPGIR-PGKMTDQYLSGVIGRITWAGALFLGFVAIM
B8G6Q5_CHLAD          YFYT-IVIFTQQDLAENLQRNGGFIPGIR-PGKKTEEYLMKVLNRITLAGALFLGLIAVL
E8N3P4_ANATU          FFYT-DVLFQQQNYGENLKKQGAQIQGVL-RGEATQKYLSKVQRRITLPGALFLGLVAVL
C8WTV3_ALIAD          FFYT-HVQINPQQLAEQLQKHAGFIPGVR-PGHETEMYIVKVINRVTVFGSVFLGVISVL
E3SG16_9MOLU          VFST-FITINPADIAEHLSKQDAYLEGVK-PGEETVYKITQKLFKVTVIGAFALTILAAL
B2LW75_9MOLU          FFSV-FMIIQPNEISESLSKQDAFLESVK-PGTETVYKITYELFRVTIVGTILLTLLAAS
B1VAC8_PHYAS          FFST-FMNVNPEEISEHLSKQDAYIAGLR-PGEQTTNYLSSVLFKVTVIGVLFMITLVTT
A9NEF3_ACHLI          FFYT-FMVTNPHKIADNLSKSNAYVPGVR-PGDDTKNYIARILFKVTVIGTVYLVVLAAL
SECY_ARCFU            WFWVETSGMDARTVASQIAKSGMQVPGFRKSPQVLERVLSRYIPKVTILGGAIIGILTLV
D2RE43_ARCPA          KFWVETSGMDAKTVANQIARSGLQIPGFRKSPQVLERILSRYIPKVTILGGAIIGVLTLI
A0B9U7_METTP          IFWIETTGMGAKSIAAKIHASGLQIPGYRRSPVSIERLMERYIPKVTVIGGAIIGLLTVI
D3SWN3_NATMM          IFWVETTNMGPEATAQQIQNSGMQIPGFRQNVGVIEKVMERYIPQVTVIGGALVGLLAVW
D2RUE9_HALTV          IFWVETTNMGPEATAKQIQNSGMQIPGFRQNVGVIEKVMERYIPQVTVIGGALVGLLAVW
Q2FSG8_METHJ          LFWVKTAGLDSKAVARQIQLSGMSIPGYRRNPAVLEKVLDRYIPRVTVIGGVFIGIMSVV
Q2QAQ7_9EURY          KFWIETTNMGAKDVAKQIENTGMQIPGFRKNPKVLERILMRYIPPVTLFSGAFVGLLAAG
B5ICT8_ACIB4          KFWIETANMNAKAIAKQIQSSGMQIPGFRRSPAVLEKILNKYIPAVTIFSGAAVGALAAF
SECY_METVA            LFWVETSGLDAKSMAKKLGNLDMAIKGFRKSQKSIEQRLKRYIKPITVMGSAFVGFLAAA
A6UWW1_META3          MFWVETSGLDAKSMAKKMGSMNMAIKGFRKSNKSIENRLKRYILPITVMSSAFVGLLASG
SECY_METJA            IFWVETTGLDPKSMAKRIGSLGMAIKGFRKSEKAIEHRLKRYIPPLTVMSSAFVGFLATI
SECY_METTH            WLWVEISNIGPRHVARQLYQMGMQIPGFRSSRGQFEKILKRYIPTITILGGAFVGLLAFV
SECY_PYRFU            YLWVELTGLDARSIARQLQRAGLQIPGFRRDPRTLEKVLQRYIPYVTFWGSLTVALIAVL
SECY_PYRAB            FLWVELTGLDARTIARQLQRAGLQIPGFRRDPRTLERVLQKYIPYVTFWGSLTVALIAVL
B1L789_KORCO          KIWVMTAGMDPRTISEQLVRQGIVVPGRRASAKVVARTIEKYIEAVTYLGGILVGLLAAL
A0RUE4_CENSY          KLWVELGGLSPKSAAKNLLDADVQIPGFRRSNQPIEVLLNKYIPSVTIIGSMILGALAGA
SECY_SACS2            ILWVDVAGLDPATQAQQLVEAGIEIPGVRNNPKIIEGILARYIYPLAFFSSIIVGLIAVF
SECY_SULAC            MLWIDVAGLDPKTQAEQMIRSGIEIPGMRTNPRIIEGILSKYIYALGFFSSLIVGLIAVV
SECY_AERPE            YMWVEIAGLNPREQAERLIKGGLAIPGMRSDPRVLERVLRRYIYPLTFLSSLIVAALVIV
                                       :      :                                   

SECY_TRICV            PNIIQAI-----------------------LSLSGFTNLGTTSLLILVGVILDLTREMRS
C6KIV7_9STRA          PSLLFYIN----------------------PSFSGLRNIGTTSLFILVGVTIDLSRQIQT
D2ISB1_9CRYP          PLIIEIT-----------------------LETTMFRTFGPASLLISTGIILQTREQIRA
SECY_HETA2            LNLVGFVFN---------------------LSIF--KGFSIGSQIILLGVVTEILQKVQA
SECY_VAULI            LQILESILN---------------------LNIINIRGLGFTSQLILVNVLIDTIKRIRS
SECY_CYAPA            PSIVERS-----------------------LGLPKLQILSPVSISIALGVAVDTTRRITS
SECY_EMIHU            PLFVGNF-----------------------IQFGLFKNLT--SLLILIGVITDTTSQITG
SECY_DIALT            PSILAAA-----------------------LGVHPLSISGITSLILSFSIINDTVRQVLA
SECY_SYNY3            PIFVEQA-----------------------TGVTTFQGLGATSLLILVGVAIDTAKQIQT
SECY_ANTSP            PTITYYI-----------------------FKINTLKGLGATSLLILVGVAIDTAKQIQT
SECY_CYACA            PNFLEFV-----------------------FHIRVFKGLAVSSLLIVVGVAIDLIKQSKT
SECY_CYAM1            PWLFS--------------------------SLKIFSGFGATSLLIVIGVSIDTMRQIRT
SECY_LACLC            PIAAQN-----VWGLPK------------------IVALGGTSLLILIQVAIQAVKQLEG
Q04G66_OENOB          PLLAQNFG---ILDANS------------------KIGLGGTSLLIVIGVAVDLMHQIEG
SECY2_LACKZ           PLLVAN-----SVSSSL------------------QIGLSGSSILIITGVLIEIGRQIKG
SECY_STAEQ            PIIATK-----FMGLPQ------------------SIQIGGTSLLIVIGVAIETMKTLEA
SECY_BACLD            PVLFVN-----IAGLPS------------------SAQIGGTSLLIVIGVALETMKQLES
B5ZB59_UREU1          PHLVALVAKTINHGIPVIQ---------------PSTIFGGTSIIIMVTATLELWNAIKS
Q8EUD2_MYCPE          PYLI-----TMTTGIP------------------NGIAIGGTGVIIMVTGSLDFWSSLKS
SECY_MYCGA            PYII-----SLVLNVP------------------TTLSLGGTGIIIMVSASMELYRSLRS
E8ZJY0_MYCHL          PNLM-----NMFTGMP------------------GNMALGGTGIIILVSGSIQVLDSIKS
F0QR54_MYCSL          PNLL-----NLWTGIP------------------SQIAFGGTGILLLVSTALNIYEELLS
SECY_MYCCT            PYVI-----SKLTQLP------------------SNLAIGGTGLIICISVAIQTVQQLKG
B3PMM8_MYCA5          QYIQQM------FGMPA------------------SIAFGGTSIMILVSTAYETVQQVKA
D1J867_MYCHP          QFIQQM------LGMPA------------------SIAFGGTSIMILVSTAYETVQQIKA
Q6KI36_MYCMO          QFAQQL------AGVPE------------------NISFGGTSVIILVTASYETITQIQA
Q4A8J0_MYCH7          QPVEIM------LGLPS------------------AITISGTSIIILATTTLETISQIKA
C4XFZ5_MYCFP          QYIMILW-----LQIPA------------------IVSFGGTGMMILVSVALETIQQFMA
D4JDN6_9FIRM          PHIMPLI----WTDMPT------------------SMALGGTGMIIVVGVAIETVRQVQG
E7FW44_ERYRH          PHVLPMIT---RGAIPA------------------STAIGGTGIIIVVGVALETVKELEG
SECY_MYCBO            PNLFLQIGAGGTV---------------------QNLPFGGTAVLIMIGVGLDTVKQIES
A9WST8_RENSM          PLIALVLIQAN-----------------------QNFPFGGTSLLIMVGVGLETVKQIDA
A1A089_BIFAA          PTVLIMALNLN-----------------------TKLPFGGTTILIIAGVGLDTLRQAKA
C7M2Z2_ACIFD          PSILLAAWHVT------------------------SFPYAGTTILIAVGVGLETVKQVNS
C7MP31_CRYCD          PSILFVFTNNQ-----------------------LIQTFGGTSILIMIGVALDTMSKIES
Q1AU49_RUBXD          PYLITGALNLP-----------------------NSIYLGGTSMLIVVGVSLDTVRQLES
D3QZ81_MAGIU          PLLLGSATNTS------------------------ALWFGGTSILILVGVNIDLMTRIES
D1VTM8_9FIRM          PTILTKISN-------------------------LQFNYGGTSIIIVVGVVLETTRVLEQ
B0RZS9_FINM2          PMLISKAIG-------------------------IQILFGGTSIIIVVGVVLDTVKQMES
Q18CH6_CLOD6          PALTTHYMK-------------------------VNMSLAGTSLLIVVGVALELKRQLES
F4XGV5_9FIRM          PIITGNLVSY------------------------NSLAIGGTSVIIVVGVALETVKQMEA
E6UBM7_RUMA7          PIIFG-VITK------------------------LPIAMGGTSILIVVSVALETARTMES
A9KJH4_LACP7          PIFFSGMFD-------------------------AHVSFSGTSLIIVVSVVLETMKQVES
D9QZP1_CLOSW          PIMVSGLFSV------------------------SHLSFGGTSLIIIVSVVLETLKAIES
F2JSH2_CELLD          PLAFNYLFK-------------------------VDVAFSGTSLLIVVGVVLETLKQIES
C7H0Y9_9FIRM          PTIL--SQSMG-----------------------LSIHFGGTSLLIAVGVALDTMKQIEN
B8D0S8_HALOH          PYFI--SDITR-----------------------VRISFGGTSLLIMTGVALQTMQQIES
C9KPC7_9FIRM          PNMI-AAATHI-----------------------EGVYFGGTALLIVVGVALQTMKQIES
C9LN14_9FIRM          PNFI-GNITGI-----------------------QGVYFGGTSLLIVVGVALDTMRQAQS
A4XLR1_CALS8          PTLVGLMFRHQ-----------------------LNIYFGGTSLLIVVGVALETIRQMEA
B0TC76_HELMI          PTFV-IMLTGI-----------------------TNIYFGGTALLICVGVALDTMKQLES
F0SY27_SYNGF          PALI-MGTTGI-----------------------PNLALGGTSLLIVVSVALETMKQVEA
SECY_THET8            PQIIQNLTGI------------------------HSIAFSGIGLLIVVGVALDTLRQVES
Q1IX92_DEIGD          PQVVQRVTGI------------------------TTFQFSGTGLLIIVGVGLETLKQLEA
SECY_THEMA            PYLVQGAIKV------------------------NVW-IGGTSALIAVGVALDIIQQMET
B9K8A6_THENN          PYLVQGAIKV------------------------NVW-IGGTSALIAVGVALDIIQQMET
C9M915_9BACT          PNVLTNVFGM------------------------TSFYFGGTAVLIVVGVALEIVQQVES
D5EE00_AMICL          PTLMTNLMGI------------------------TSFYFGGTAVLIVVGVALDTVHQIEG
B5YDW2_DICT6          PTFIERITGV------------------------TEFQLGGTSILIMVGVILETIKALEA
D9SX80_CLOC7          P-LVLESSTSF-----------------------RDLSLGSTGLLILVSVSIETVKTLES
A6LPT1_CLOB8          P-VMIQNYTQF-----------------------QNIAFSGTGLLIVINVALDFTRKVES
B5Y968_COPPD          PDLFMQLFGMG-----------------------RLFLFGGTSLLIVIGVALEIFRQLEA
SECY_ECOLI            PEFM-------------------------RDAMKVPFYFGGTSLLIVVVVIMDFMAQVQT
SECY_HAEIN            PYIM-------------------------TSAWDVKFYFGGTSLLIVVVVIMDFIVQVQS
SECY_BUCBP            PELM-------------------------RFFMDVPFYFGGTSLLIIVVVIIDFISQVQT
Q7WZR8_9GAMM          PQLI-------------------------MVYCKIPFCGGGISILIMVVVVLDFLSQIQS
A5EX98_DICNV          PSLVNMG----------------------SASGQVLFLFGGTSLLIAVVVAMDLMSQIQS
SECY_RICBR            PELL-------------------------MNKYVISLSLGGTSFLIVVNVVLDTLTQIQT
B3CT25_ORITI          PEVL-------------------------GNIMPSLFTSSGTSLLIVVNVVLDTLSQIQT
Q5GSW3_WOLTR          PEVM-------------------------RYYYDMPFIFGGTSLLIIVNVTTDTIMQIQS
Q2GEC0_NEOSM          PEIF-------------------------RNYFGFDAIISGTSLLIIVNVITDLLSQIQV
B2KEK2_ELUMP          PDIARI-------------------------KFNVPFYFGGTSLLIVVGVALDTAGQIQA
E1X0K2_HALMS          PTIIT----------------------------GANTRFGGTSLLILVSVCVRVMMNVQA
SECY_BORBU            PFLVQNIF---------------------RFPHDVSRIMGGSSLLIMVGVALDTLIHIDA
O83238_TREPA          PTLIQAAF---------------------GFPSSISLLMGGTSLLILVGVDLDTMSQIEA
SECY_HELPJ            PWILVKAM---------------------GVP----FYFGGTAVLIVVQVAIDTMKKIEA
D3UIH0_HELM1          PWILVKSM---------------------GVP----FYFGGTAVLIVVQVAIDTMRKIEA
SECY_AQUAE            PILI-------------------------SVWFNIPFYFGGTTALIVVGVALDTFRQIET
D3DH80_HYDTT          PIFI-------------------------SLWLKVPFYFGGTTALIVVGVALDTLNKLEA
E8T4B5_THEA1          PMII-------------------------VQKMNLPFYFGGTAILIVVGVALDTLKRMEA
D4H3A7_DENA2          PQLI-------------------------IRGFNVPFYFGGTSILIVIGVGMDVISKIEA
D3P918_DEFDS          PQII-------------------------IRQFNMPFYFGGTSLLIVIGVGLDVMQKIES
E4TEN9_CALNY          PQVI-------------------------LKFFNVPFYFGGTSVLIVIGVSMDVVNKIES
E6W730_DESIS          PTFL-------------------------IKYLSVPFYFGGTALLIVVSVGMDTMNQIEA
B8IYL1_DESDA          PMLL-------------------------ISNFNVPFFFGGTSLLILVGVAMDFMNQVES
Q1MPP6_LAWIP          PMML-------------------------ISQFNVPFYFGGTSILILVGVAMDFMSQIES
C1A6S5_GEMAT          PIVI-------------------------ARIVNVPFAFGGTSLLIVVGVALDTMAQMQQ
C9RR14_FIBSS          PLHL-------------------------KDALNMSFYIGGTSVLIVVGVALDTLRQLEA
Q1D755_MYXXD          PSVI-------------------------SGLLGVRFTFGGTALLIVVGVALDTVQQIEG
C1F622_ACIC5          PQFLITGIHLNHLPLI--GSWFEHAPLWVTNGLGFSFYFGGTSLLIVVGVAMDTVNQIES
E8WZ43_GRATM          PTLLISGIHFNHIPLI--GAAFEHLPVWVTHGLGVNFYFGGTSLLIVVGVAMDTVQQIES
Q1ISA2_KORVE          PEWMMVGLHLNHLPLWLGGGLFEKLPTWMTTGLGVTFYFGGTSLLIVVGVAMDTVQQIES
D5UB65_BRAM5          PDLM------SKIPIF---------APFRGTNNSLVYLMGGTSVMISVSVAVELLKQIES
E8R478_ISOPI          PTLVQDSLD---------------------VSPIVASFLGGTGLLIVVSVCLDLVHRIDS
D5SQ93_PLAL2          PTVISNALG---------------------IDPLVASFYGGTGLLICVSVALDLVQKIDS
D2R6I9_PIRSD          PTFVSSALN---------------------VAPNVASFYGGTGLLIAVSVAFDLIQKIDS
Q1Q157_KUEST          PKLVAGGFE---------------------LNRAIAGFYGGTGLLIIVGVALDMVQRIES
SECY_CHLTR            PSILGRILR---------------------VDANVSYFLGGTAMLIVVGVILDTMKQIDA
B2UQN0_AKKM8          PSLLNIGGN---------------------IPYLVTQFFGGTSLLILVGVLLDMMRQVET
B3E0K3_METI4          PMVVQNLLG---------------------IPAITAQFFGGTSLLIVVGVILDTMRQTET
D5EJU0_CORAD          PDILLFTYR---------------------IPGNVAIFFGGTGMLITVGVLLDTMRQIET
A6DRC9_9BACT          PYVLMNAMGSGS------------------TDFIITQFFGGTSLLIMVGVVLQTMQQIEV
D0JAT9_BLASB          PSIVFRMGI----------------------TQNFALFYGGTSLLIVVGVILDISQQVNI
C6X1Y0_FLAB3          PAIVHGAFVQ---------------------TDRFALFFGGTSLLIMVGVILDTVQQINT
F4KXT7_HALH1          PAFAAAIGI----------------------NRNFAVFFGGTSLLIMISVILDTLQQIES
D1AVF8_STRM9          PNI---WFGY---------------------VLNIPVMLGGTSLLILVGVAVELIQNIDS
C7NDL7_LEPBD          PNI---WFGY---------------------VLKLPVMLGGTSLLILVGTAVELLLQIDS
E3H907_ILYPC          PIA---IFS----------------------SMGLPVFFGGTGIIIVVGVALDTVQQINA
E0XPY0_9BACT          PFLAQLVTNLPS----------------------ATTLIQSTSLLIMVGVALDTMRQLES
A0A142V9H9_9CHLR      PFLAREVTGI------------------------QVIQLSSFGMLIVVGVALDTMKQLEA
B8G6Q5_CHLAD          PFITQSITGV-------------------------QIGLGSTALLIVVGVAVDTMRQLEA
E8N3P4_ANATU          PYIVHALLPANAG--------------------AGLLLISAAGLLIVVGVVRDTFTIIDT
C8WTV3_ALIAD          PFILLGAMNL------------------------TDYNIQGTSLIILVGVALQTMQQMEG
E3SG16_9MOLU          PELIKFFVWANDSDN------------------TSQVQLGGTSLLIVVGVAVEVMQRITA
B2LW75_9MOLU          PDLIGYFFSI-----------------------PKNFKFGGTSLLIIVGVVFDFIQKITS
B1VAC8_PHYAS          PLLMQRFFKL------------------------THMKLGGTSLLIIVSVAIETIQRIMA
A9NEF3_ACHLI          PIITAWVFGFVGAE-------------------AASITLGGTGLLIVVGVAADTTQQLEA
SECY_ARCFU            ANMLGTIGNV-----------------------------SGTGLLLAVSIAYRFYEDLAK
D2RE43_ARCPA          ANMLGTVGNV-----------------------------SGTGLLLAVSIAYRFYEDLTR
A0B9U7_METTP          ASLLGTLGGA-----------------------------GGTGLLLAVSIMYRLYEQIAS
D3SWN3_NATMM          ANMLGTIGAV-----------------------------TGTGLLLAVSITYKLYEEIAE
D2RUE9_HALTV          ANMLGTIGGV-----------------------------SGTGLLLAVSITYKLYEEIAE
Q2FSG8_METHJ          ANLFGVIGAV-----------------------------SGTGLLLTVSITYRLYEQIAS
Q2QAQ7_9EURY          ADLLGTVGNA-----------------------------TGTGLLLAVGIILRTYEQIQK
B5ICT8_ACIB4          ADLIGTVGNT-----------------------------SGTGVLLTVGILIQLYEAMGK
SECY_METVA            ADFTGALG-------------------------------GGTGVLLTVSIVYRLYEQLVQ
A6UWW1_META3          ADFMGALG-------------------------------GGTGVLLTVSIVYRMYEQLVQ
SECY_METJA            ANFIGALG-------------------------------GGTGVLLTVSIVYRMYEQLLR
SECY_METTH            ADLTGSLG-------------------------------GGTGVLLTVGIVYRLYEEIAQ
SECY_PYRFU            ADFLGALG-------------------------------TGTGILLTVGILYRFYEEIAR
SECY_PYRAB            ADFLGALG-------------------------------TGTGILLTVGILYRFYEEIAR
B1L789_KORCO          ANFTGAFG-------------------------------TGSGILLAVTIIAGLYERLAQ
A0RUE4_CENSY          SDVLGVFG-------------------------------SGIGILLMVDILINYYNQLVR
SECY_SACS2            ATLLGAYG-------------------------------TGIGILLAVTIAIQYYSLLAY
SECY_SULAC            ATFLGTYG-------------------------------TGVGLLLAITIAMQYYNLLAY
SECY_AERPE            ADIFGAYG-------------------------------TGTGLLLAVGIINQYYAMITR
                                                                   :              

SECY_TRICV            IILSN--------IYYDMFD----------------------------------------
C6KIV7_9STRA          YRIVE--------SYDNIEV----------------------------------------
D2ISB1_9CRYP          LLHSK--------NYSELMN----------------------------------------
SECY_HETA2            LVLND--------VYKRIRDRNK-------------------------------------
SECY_VAULI            FLNEE--------ENYF-------------------------------------------
SECY_CYAPA            YLGSSSPFKRDSSKREPLKRDFSKRRSAN-------------------------------
SECY_EMIHU            YLVST--------RYEGLK-----------------------------------------
SECY_DIALT            YRDTR---------KFLLSS----------------------------------------
SECY_SYNY3            YVISQRY--------EGMIKQP--------------------------------------
SECY_ANTSP            Y-LYHTY--------DNMME----------------------------------------
SECY_CYACA            YVIAKNY--------ENMVH----------------------------------------
SECY_CYAM1            YFIANAY--------EKMI-----------------------------------------
SECY_LACLC            YLLKRKYAGFM-DNPLETK-----------------------------------------
Q04G66_OENOB          LTEKKNYIGLIRSHPYYDKELSEGKI----------------------------------
SECY2_LACKZ           LKLKREYGTFLSTDFSLDD-----------------------------------------
SECY_STAEQ            QVTQKEYKGFGGR-----------------------------------------------
SECY_BACLD            QLVKRNYRGFMKH-----------------------------------------------
B5ZB59_UREU1          TSTSTSYAYQRKELETAIT----------------------------------ISVESDK
Q8EUD2_MYCPE          AQTNYTYSNLTKGLKKSNEGQL-------------------------------LGSKAET
SECY_MYCGA            AATTTSYQRLRKDIANRIEAELSLNDYMNKPNLEHDQYGLLGQHKKVEPTQDKKKNPSDP
E8ZJY0_MYCHL          NTIASRYKSKNVILGTQIKQNL--------------------------------DANLAE
F0QR54_MYCSL          THIISKYKAEQELELSTLENKL--------------------------------HLSTSS
SECY_MYCCT            RIIQQNFIEKKKEK---------------------------------------FTNNINK
B3PMM8_MYCA5          RYKSQELARKRRQIRDLKEI---------------------------------YGEE---
D1J867_MYCHP          RYKSQELSRKRKMIRELKEM---------------------------------YGEE---
Q6KI36_MYCMO          RKKSQSLSQKHKKILEVTSK---------------------------------NNND---
Q4A8J0_MYCH7          RYDAQKVLKQSKKIRKNLQV---------------------------------RKNSPSI
C4XFZ5_MYCFP          RRKSQHLAKQKRLSKEAADV---------------------------------LNFQNKY
D4JDN6_9FIRM          LITQKSYKKYFED-----------------------------------------------
E7FW44_ERYRH          RMTQRSYKGLFNK-----------------------------------------------
SECY_MYCBO            QLMQRNYEGFLK------------------------------------------------
A9WST8_RENSM          QLQQRHYEGLLR------------------------------------------------
A1A089_BIFAA          QTEQFQYAGFLFEDTDHKEGK---------------------------------------
C7M2Z2_ACIFD          QLTMRNYEGFLR------------------------------------------------
C7MP31_CRYCD          QLKMYNYDGFFK------------------------------------------------
Q1AU49_RUBXD          QLMMRNYEGFLRRQYR--------------------------------------------
D3QZ81_MAGIU          QMMTSNYAGFLDR-----------------------------------------------
D1VTM8_9FIRM          QLLMRNYRGFLRK-----------------------------------------------
B0RZS9_FINM2          MLTMKHYKGFLK------------------------------------------------
Q18CH6_CLOD6          NLVMRSYQGFLK------------------------------------------------
F4XGV5_9FIRM          QMLMRHYKGFLE------------------------------------------------
E6UBM7_RUMA7          QMMMRHHSGFLK------------------------------------------------
A9KJH4_LACP7          QMLVRHYKGFLND-----------------------------------------------
D9QZP1_CLOSW          QMLVRYYKGFLND-----------------------------------------------
F2JSH2_CELLD          QMLMRHYKGFL-------------------------------------------------
C7H0Y9_9FIRM          QMLMRDYQGFLR------------------------------------------------
B8D0S8_HALOH          QLLMRHYEGFMK------------------------------------------------
C9KPC7_9FIRM          MVVMRHYEGFMK------------------------------------------------
C9LN14_9FIRM          LMVTRNYQGFIK------------------------------------------------
A4XLR1_CALS8          QMLMRHYKGFLS------------------------------------------------
B0TC76_HELMI          NMLMRHYQGFMK------------------------------------------------
F0SY27_SYNGF          QLLQRHYQGFLK------------------------------------------------
SECY_THET8            QLMLRSYEGFLSRGRLRGRNR---------------------------------------
Q1IX92_DEIGD          QLTVRRYDGFISKGRIRSRLNG--------------------------------------
SECY_THEMA            HMVMRHYEGFIKKGKIRGRR----------------------------------------
B9K8A6_THENN          HMVMRHYEGFLKKGRIRGRR----------------------------------------
C9M915_9BACT          QLLMRHYEGILKRGGGASGAGLLRF-----------------------------------
D5EE00_AMICL          QLLMRHYEGILKRRD-SKGGGFLRF-----------------------------------
B5YDW2_DICT6          QMIMKSYEGFLR------------------------------------------------
D9SX80_CLOC7          QLVMRHYGGFLKR-----------------------------------------------
A6LPT1_CLOB8          QMVVRHYKGFLK------------------------------------------------
B5Y968_COPPD          YVQLRHYKGFLEL-----------------------------------------------
SECY_ECOLI            LMMSSQ-YESALKKANLKGYGR--------------------------------------
SECY_HAEIN            HLMSSQ-YESALKKANLKGFGQ--------------------------------------
SECY_BUCBP            YIMSTQ-YESVLKKNKFRF-----------------------------------------
Q7WZR8_9GAMM          YLMAN-------------------------------------------------------
A5EX98_DICNV          HIESNEGYESLMRKANLSGFGGGKYH----------------------------------
SECY_RICBR            YLFSSK-YESLMKKVKLKN-----------------------------------------
B3CT25_ORITI          YIFTSR-YDSLVKKMKYKDK----------------------------------------
Q5GSW3_WOLTR          YIFSNR-YDSWIKKYESKTKKLR-------------------------------------
Q2GEC0_NEOSM          LLFSSH-YSSFLKKGGMVFNKR--------------------------------------
B2KEK2_ELUMP          HLMARDYEPLMKAGKKLS--NRRWFNVGE-------------------------------
E1X0K2_HALMS          FMFSDRYETAYKSRGKYNGQNRRF------------------------------------
SECY_BORBU            YLKT---QGFSHGN----KKNYAFLQKI--------------------------------
O83238_TREPA          QLKMRQREGLGGRGKVLPRICSGYLRKDVYEE----------------------------
SECY_HELPJ            QIYMSKYKTLSAVGF---------------------------------------------
D3UIH0_HELM1          QVYMSKYKTLSAVGF---------------------------------------------
SECY_AQUAE            YLIQKKYKSYVRR-----------------------------------------------
D3DH80_HYDTT          QMIQKKYAGYMRRRVR--------------------------------------------
E8T4B5_THEA1          FALMLSYEGFLGRRRRKMRLGAGGSR----------------------------------
D4H3A7_DENA2          HLVTHNYDGFLKKGRIQGRSMI--------------------------------------
D3P918_DEFDS          HLISHNYDGFIKSGKIKGRGYV--------------------------------------
E4TEN9_CALNY          HLITHNYDGFLSKGRIKPRGAAW-------------------------------------
E6W730_DESIS          HLLSRSYDGFLTN-RSGGR-----------------------------------------
B8IYL1_DESDA          HMISSQYQGLMAKARKSGRL----------------------------------------
Q1MPP6_LAWIP          HFISKQYEGLMNKKTK-GRG----------------------------------------
C1A6S5_GEMAT          HLLLRKYDGFMKKGRVRFRGRQATQGF---------------------------------
C9RR14_FIBSS          QLHTKNYEGFLKRGRIRGRMAS--------------------------------------
Q1D755_MYXXD          HLISRNYEGFAGPRGPRIRGRVRVAA----------------------------------
C1F622_ACIC5          QLIMRHYEGFSPRS-RTRGRRAW-------------------------------------
E8WZ43_GRATM          QLIMRHYDGFSPKSGRIRGRRSW-------------------------------------
Q1ISA2_KORVE          QLIMRHYEGFTPRSGRIKGRR-W-------------------------------------
D5UB65_BRAM5          YLQMHNYDGILKKS---KVRR---------------------------------------
E8R478_ISOPI          HLVMRNYPTLLNKR----------------------------------------------
D5SQ93_PLAL2          HLVMRNYRGLLESDNAA-------------------------------------------
D2R6I9_PIRSD          HLVMRDYRGLLEP-----------------------------------------------
Q1Q157_KUEST          HMIMRQYSGFLSGGTRIRGRMG--------------------------------------
SECY_CHLTR            FLLVRRYDGVLKKDRPKGRP----------------------------------------
B2UQN0_AKKM8          TLLSRNYDGFLKKGKLKGKYGH----IQGTGAAAGSRTVTVMWIVIALLVLAGAIAYNAM
B3E0K3_METI4          YLLQRNYDGFLKKRKVGKTAGA----AIATNAVK-ERTLVWIYTFIGILVIAGITVSLFK
D5EJU0_CORAD          FLLQRHYDGFLKKGKIRGRSATRSKQLVDTAGLQDFWTAWRPLLVLAIALFVLGLVSWFL
A6DRC9_9BACT          QLVQNNYDGFITGGRLRSRKG---------------------------------------
D0JAT9_BLASB          HLLNYHYDELMMVKNRSGRYTRL-------------------------------------
C6X1Y0_FLAB3          YLLNHHYDGLMQSKLSRTTNPNS-------------------------------------
F4KXT7_HALH1          HLLMRKYEGLAKSGRIQGRSSQSRLQGIGDSI----------------------------
D1AVF8_STRM9          HMATQKYKGFNNIRRRR-------------------------------------------
C7NDL7_LEPBD          YLAVKQMKSFVNRRNR--------------------------------------------
E3H907_ILYPC          HLVMKEYKGFL-------------------------------------------------
E0XPY0_9BACT          QLLMRNYEGFVR------------------------------------------------
A0A142V9H9_9CHLR      QLVMRRYEGFIK------------------------------------------------
B8G6Q5_CHLAD          QLIMRDYEGFLTR-----------------------------------------------
E8N3P4_ANATU          ELKLHGYQESLIKG----------------------------------------------
C8WTV3_ALIAD          QLLQRQYRGFIRE-----------------------------------------------
E3SG16_9MOLU          QTNVKKLYKKLF------------------------------------------------
B2LW75_9MOLU          KTNIQQMYDKLF------------------------------------------------
B1VAC8_PHYAS          TAQ-KKEYAKIF------------------------------------------------
A9NEF3_ACHLI          QAN-QETYQGLF------------------------------------------------
SECY_ARCFU            EQLTEMHPLIRRMLGEEA------------------------------------------
D2RE43_ARCPA          EQLTEMHPMLRKFLGEE-------------------------------------------
A0B9U7_METTP          EQIQEMYPMMQRIFGESA------------------------------------------
D3SWN3_NATMM          EQMMEMHPMMRQMFGKE-------------------------------------------
D2RUE9_HALTV          EQMMEMHPMMREMFGGGD------------------------------------------
Q2FSG8_METHJ          EQIMEMYPFMRTFFGKE-------------------------------------------
Q2QAQ7_9EURY          EQAMEMHPVLREFFGAE-------------------------------------------
B5ICT8_ACIB4          EQLMEMHPVIRQFFE---------------------------------------------
SECY_METVA            EQLSELHPAVAKFVGKR-------------------------------------------
A6UWW1_META3          EQVSELHPALGKFLKK--------------------------------------------
SECY_METJA            EKVSELHPAIAKLLNK--------------------------------------------
SECY_METTH            EQLMDMHPILRSFLGD--------------------------------------------
SECY_PYRFU            EQITEMFPALRKLFGA--------------------------------------------
SECY_PYRAB            EQISEMFPALRRFFAT--------------------------------------------
B1L789_KORCO          ERTLEMYPRLKRFIG---------------------------------------------
A0RUE4_CENSY          EQVEVVMPRLGALLGRK-------------------------------------------
SECY_SACS2            ERSLEMYPLLKRLIGE--------------------------------------------
SECY_SULAC            ERTLEMYPLLKRIVGE--------------------------------------------
SECY_AERPE            ERALETYPLLRRILGEEVV-----------------------------------------
                                                                                  

SECY_TRICV            -------------------------------
C6KIV7_9STRA          -------------------------------
D2ISB1_9CRYP          -------------------------------
SECY_HETA2            -------------------------------
SECY_VAULI            -------------------------------
SECY_CYAPA            -------------------------------
SECY_EMIHU            -------------------------------
SECY_DIALT            -------------------------------
SECY_SYNY3            -------------------------------
SECY_ANTSP            -------------------------------
SECY_CYACA            -------------------------------
SECY_CYAM1            -------------------------------
SECY_LACLC            -------------------------------
Q04G66_OENOB          -------------------------------
SECY2_LACKZ           -------------------------------
SECY_STAEQ            -------------------------------
SECY_BACLD            -------------------------------
B5ZB59_UREU1          SSKS------------------------QIW
Q8EUD2_MYCPE          DDVK------------------------RLW
SECY_MYCGA            LEVS------------------------QLW
E8ZJY0_MYCHL          EKQF------------------------YLW
F0QR54_MYCSL          KSPY------------------------LLW
SECY_MYCCT            NKTS------------------------HIW
B3PMM8_MYCA5          EED-------------------------LIW
D1J867_MYCHP          EED-------------------------LIW
Q6KI36_MYCMO          EKSK-----------------------GLLW
Q4A8J0_MYCH7          DSNQ-----------------------DLLW
C4XFZ5_MYCFP          QENDPFATNDQKSEDVSKEYDKYKNGDGLLW
D4JDN6_9FIRM          -------------------------------
E7FW44_ERYRH          -------------------------------
SECY_MYCBO            -------------------------------
A9WST8_RENSM          -------------------------------
A1A089_BIFAA          -------------------------------
C7M2Z2_ACIFD          -------------------------------
C7MP31_CRYCD          -------------------------------
Q1AU49_RUBXD          -------------------------------
D3QZ81_MAGIU          -------------------------------
D1VTM8_9FIRM          -------------------------------
B0RZS9_FINM2          -------------------------------
Q18CH6_CLOD6          -------------------------------
F4XGV5_9FIRM          -------------------------------
E6UBM7_RUMA7          -------------------------------
A9KJH4_LACP7          -------------------------------
D9QZP1_CLOSW          -------------------------------
F2JSH2_CELLD          -------------------------------
C7H0Y9_9FIRM          -------------------------------
B8D0S8_HALOH          -------------------------------
C9KPC7_9FIRM          -------------------------------
C9LN14_9FIRM          -------------------------------
A4XLR1_CALS8          -------------------------------
B0TC76_HELMI          -------------------------------
F0SY27_SYNGF          -------------------------------
SECY_THET8            -------------------------------
Q1IX92_DEIGD          -------------------------------
SECY_THEMA            -------------------------------
B9K8A6_THENN          -------------------------------
C9M915_9BACT          -------------------------------
D5EE00_AMICL          -------------------------------
B5YDW2_DICT6          -------------------------------
D9SX80_CLOC7          -------------------------------
A6LPT1_CLOB8          -------------------------------
B5Y968_COPPD          -------------------------------
SECY_ECOLI            -------------------------------
SECY_HAEIN            -------------------------------
SECY_BUCBP            -------------------------------
Q7WZR8_9GAMM          -------------------------------
A5EX98_DICNV          -------------------------------
SECY_RICBR            -------------------------------
B3CT25_ORITI          -------------------------------
Q5GSW3_WOLTR          -------------------------------
Q2GEC0_NEOSM          -------------------------------
B2KEK2_ELUMP          -------------------------------
E1X0K2_HALMS          -------------------------------
SECY_BORBU            -------------------------------
O83238_TREPA          -------------------------------
SECY_HELPJ            -------------------------------
D3UIH0_HELM1          -------------------------------
SECY_AQUAE            -------------------------------
D3DH80_HYDTT          -------------------------------
E8T4B5_THEA1          -------------------------------
D4H3A7_DENA2          -------------------------------
D3P918_DEFDS          -------------------------------
E4TEN9_CALNY          -------------------------------
E6W730_DESIS          -------------------------------
B8IYL1_DESDA          -------------------------------
Q1MPP6_LAWIP          -------------------------------
C1A6S5_GEMAT          -------------------------------
C9RR14_FIBSS          -------------------------------
Q1D755_MYXXD          -------------------------------
C1F622_ACIC5          -------------------------------
E8WZ43_GRATM          -------------------------------
Q1ISA2_KORVE          -------------------------------
D5UB65_BRAM5          -------------------------------
E8R478_ISOPI          -------------------------------
D5SQ93_PLAL2          -------------------------------
D2R6I9_PIRSD          -------------------------------
Q1Q157_KUEST          -------------------------------
SECY_CHLTR            -------------------------------
B2UQN0_AKKM8          Q------------------------------
B3E0K3_METI4          K------------------------------
D5EJU0_CORAD          N------------------------------
A6DRC9_9BACT          -------------------------------
D0JAT9_BLASB          -------------------------------
C6X1Y0_FLAB3          -------------------------------
F4KXT7_HALH1          -------------------------------
D1AVF8_STRM9          -------------------------------
C7NDL7_LEPBD          -------------------------------
E3H907_ILYPC          -------------------------------
E0XPY0_9BACT          -------------------------------
A0A142V9H9_9CHLR      -------------------------------
B8G6Q5_CHLAD          -------------------------------
E8N3P4_ANATU          -------------------------------
C8WTV3_ALIAD          -------------------------------
E3SG16_9MOLU          -------------------------------
B2LW75_9MOLU          -------------------------------
B1VAC8_PHYAS          -------------------------------
A9NEF3_ACHLI          -------------------------------
SECY_ARCFU            -------------------------------
D2RE43_ARCPA          -------------------------------
A0B9U7_METTP          -------------------------------
D3SWN3_NATMM          -------------------------------
D2RUE9_HALTV          -------------------------------
Q2FSG8_METHJ          -------------------------------
Q2QAQ7_9EURY          -------------------------------
B5ICT8_ACIB4          -------------------------------
SECY_METVA            -------------------------------
A6UWW1_META3          -------------------------------
SECY_METJA            -------------------------------
SECY_METTH            -------------------------------
SECY_PYRFU            -------------------------------
SECY_PYRAB            -------------------------------
B1L789_KORCO          -------------------------------
A0RUE4_CENSY          -------------------------------
SECY_SACS2            -------------------------------
SECY_SULAC            -------------------------------
SECY_AERPE            -------------------------------