CLUSTAL format seed alignment for MF_01469

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RNM5_BORBU            ------------------------------------MEKIKEIIVVEGKDDLKRI-KESF
G9QWI5_9FIRM          ------------------------------------MKKIKEIVVVEGKTDTALL-KELF
B9E8V9_MACCJ          -------------------------------------MKINEIIVVEGKDDTTRV-KLAV
A0A059MYX8_ENTFL      ---------------------------------MKEKMKVAEIIVVEGKDDTRRI-QEVV
G0M3G6_LACPE          -------------------------MQRNFLR----LKKIKEVIVVEGKDDTKRL-ALAV
C7XXA9_9LACO          -------------------------MLIGYLKKESHMKKIKEVIVVEGKDDTKQV-QRAV
Q034Q7_LACP3          ------------------------------------MTTIKQVVVVEGRDDTKRL-KETF
Q38V21_LACSS          -----------------------------------MKKTIQEVIVVEGRDDTKRL-REVF
G2KU31_LACSM          ------------------------------------MKRIKEVIVVEGKDDTKRI-QRAV
F4BLG4_CARS1          ------------------------------------MEKIKEVIVVEGRDDTRRV-LESV
F2I732_AERUA          -----------------------------------MKKRLKEVIVVEGRDDSQRL-KQFY
G0UI87_9LACT          -------------------------------------MKIKEVIIVEGRADTEAL-RHAV
F8I1A6_WEIKK          -------------------------------------MRINEIIVVEGKSDTAKI-KRAV
Q03VR6_LEUMM          ---------------------------------MNELPKINEMIVVEGRSDTQNL-ARAV
F9VBX5_LACGL          -----------------------------------MKEKIEKVIVVEGRDDTRNL-KRFY
A0A5M9QBZ1_LACLH      ---------------------------------MVEKQKINEVIVVEGRDDTANL-KRYF
Q8DVW8_STRMU          ------------MKPKVCLRPCYLRQAVKKIEFMTEKIKIQEVLVVEGKDDTVNL-RRFY
Q04DR7_OENOB          --------------------------------MAQELK--KTIFIVEGKNDTARL-RLAF
Q5FMG4_LACAC          --------------------------------MVLNRKNFDAVIVVEGKDDTIRL-KQFF
D0BLR0_9LACT          ---------------------------------------MNPIIVVEGRDDTRRL-KEVF
RNM5_BACSU            -----------MK--------------------------IKEIIVVEGRDDTARI-KLAV
Q8EU41_OCEIH          -----------MR--------------------------IKEMIVVEGRDDTARI-QLAV
RNM5_LISMO            -----------MSGKPV----------------------IHEFIVVEGRDDTTAI-NRSV
E6TRN9_BACCJ          -----------MKPI------------------------IKEVIVVEGKSDTNVI-KRFL
F2F1A0_SOLSS          -----------MKLAQRKQSAIYGKIAKDYVGNEERFLDIQEIIVVEGKDDTTAI-KRAT
RNM5_CLOAB            --------------------------------------MIKEVIVVEGRDDITAV-KRAV
Q899D6_CLOTE          ----------------------------MYISLGDGFVMIKEVIVVEGRDDITAV-KRAV
F9VM64_ARTSS          ------------------------------------MIKIKEVIVVEGICDEIAV-KRGI
RNM5_FUSNN            -----------------------------------MKKKIKEVIVVEGKDDISAV-KNAV
A0A133NBL3_9FUSO      -----------------------------------MKPKIQEIIIVEGRDDISAV-KAAV
E3H7T4_ILYPC          -----------------------------------MRKKIKETIVVEGRDDITAV-KAAV
C7N9R2_LEPBD          --------------------------MKKEPSKQEEKLKIKEIIVVEGRDDITAI-KRVV
D1ANK4_SEBTE          -----------------------------------MKPKIKEIIVVEGKDDIAAV-KQAV
D7N825_9FIRM          ------------------------------MRIQRGSIMIKEVIVVEGKDDITAV-KSAV
C7REB8_ANAPD          --------------------------------------MIKETIVVEGKDDISNV-KRAV
B0S068_FINM2          --------------------------------------MIKEIIVVEGRDDEQRV-KRAL
F8IIZ7_ALIAT          -------------------------------MTD-SRPKLREVVVVEGLHDKQRV-DEAV
D5WRH0_KYRT2          -------------------------------MADVTKPEVAEVVVVEGWRDKAAV-DRAV
F4EXM9_SELS3          --------------------------------------MLKEVLVVEGKMDVVAV-RKAI
G4Q6W6_ACIIR          --------------------------------------MLKEVLVVEGKMDTVAI-KKAL
G0VQN6_MEGEL          --------------------------------------MIKEVLVVEGRSDVARIRASHI
D1BLQ1_VEIPT          --------------------------------------MLKQVIVVEGKSDIQRI-AQAV
D6GSF8_FILAD          --------------------------------------MIKEVIVVEGKDDITAV-KRAV
E3PVN0_ACESD          --------------------------------------MIKEVIVVEGKDDISAV-KKAV
A6TJK8_ALKMQ          --------------------------------------MIKEIIVVEGKDDVSAI-KKAV
F0SW69_SYNGF          -------------------------------------MDIEELIVVEGKNDAHAIRRALG
B8FY37_DESHD          -----------------------------------MAKMIEELIVVEGKNDAHAVRRALG
B0TB83_HELMI          -------------------------------MNTLSREKIREVIVVEGRDDLLAV-RRAV
C0ZHC5_BREBN          -------------------------------------MKIKEVIVVEGRDDTATI-KRAV
D3E743_GEOS4          ------------------------MYRPALLGKEENERMIKEVIVVEGRDDTVAI-KRAV
Q5WLW3_BACSK          MINKEKSKLLAKHLLFFCVKTGYNNVMVFLENGVNDIFVINEMIVVEGRKDTVSI-KRAV
D6XV39_BACIE          -MERER---------------------------------IGPMIVVEGKNDSLTL-KRWF
B1YGN9_EXIS2          ----------------------------------MMRKRLKEVIVVEGRDDTTRL-QEVF
U5FAV8_9FIRM          -------------------------------------MKIKEIIVVEGKNDTNVL-QSCI
E7FWJ6_ERYRH          ----------------------------------MNKLKIQEVIVVEGKHDKEKI-LKCV
RNM5_MYCPN            -------------------------------MDKKTRLKLDGVIVCEGKTDQARL-QQLF
RNM5_MYCGE            -------------------------------MDQKARIKIDGVIVCEGKTDQAKL-QQIF
Q7NAR1_MYCGA          ------------------------MSKITKPKENSKRNRINEIIVVEGKTDTVKL-KSLF
Q9PQU9_UREPA          ----------------------------------MNKPIIKEVIIVEGKTDAQKI-DQLV
Q8EUI2_MYCPE          ------------------------------MWMLDSKKTISEVVIVEGKTDTAKL-KSIF
RNM5_MESFL            --------------------------------------MANEIIIVEGKSDSQKL-KKIY
Q14QK4_SPICI          ---------------------------------------MGVFIIVEGKTDSTKL-KSIF
A9NE78_ACHLI          --------------------------------------MKQKIYVVEGTHDETLL-KQID
                                                                  : **  *   :     

RNM5_BORBU            D--CTVIETKGF-ALKIETIKLLKKALKYKGIIILTDSDKSGNIIRQKIVKYLGE--NNK
G9QWI5_9FIRM          E--VDTIETHGL-ALDQQTLELIQEASKSRGIIVLTDPDFPGKKIRDQIQAVVPN--CQH
B9E8V9_MACCJ          --ECDTLETNGS-AINEETIEAIRHAAEARGVIVLTDPDYPGNKIRKTIESHVPA--VKH
A0A059MYX8_ENTFL      --AADTIETIGS-AINDEILTQIEHAQETRGVIIFTDPDYSGEKIRKTIMEVVPD--AKH
G0M3G6_LACPE          --DADTLETNGS-AISEATLAQIKTLQASRGVIVFTDPDFSGERIRKTISAAVPG--VKH
C7XXA9_9LACO          --DADTFETNGS-ALSLADIEQLKKLQVRRGLIVFTDPDFNGERLRKMISQAIPG--VKH
Q034Q7_LACP3          G-AIDTIETRGS-AIDEATLERIRQAQATRGVIVLTDPDFPGAKIRRTISRAVPG--VTH
Q38V21_LACSS          P-DVDTIETRGS-AINDEIVEKIALAQEKRGVIVFTDPDFHGEKIRKIISQNVPG--VEH
G2KU31_LACSM          --DADTIETRGS-AIDDETLDLIDRLAQTRGVIVFTDPDFSGEKIRRIISEEIPE--AKH
F4BLG4_CARS1          --EADTIETNGS-AIDEETLKLIGKAHETRGVIVFTDPDFPGEKIRKIISQAIPG--VKH
F2I732_AERUA          --HVKTIETNGS-AINQETMDKIKQAQDLYGVIVFTDPDVSGEKIRRTIMRDVPE--VQH
G0UI87_9LACT          --SADTIETNGS-ALGEQTIAAIKQAAATRGVIIFTDPDFNGERLRKLISEFVPE--AKH
F8I1A6_WEIKK          --DADTIETNGS-ALDELTQKTIERAAKTRGVIVFTDPDFNGERIRKIVTQIAPN--AKH
Q03VR6_LEUMM          --IADTIETGGS-AVNEDAIERAKLAAKTRGIIILTDPDFNGQRIRHMVTEAVPT--AKQ
F9VBX5_LACGL          --DLDTYETGGS-SIDATDIERLKVLQEKRGLVVFTDPDFQGERIRKIIMQAIPE--AQH
A0A5M9QBZ1_LACLH      --DCETYETGGS-SIDDRDLERLKRLEDKRGIIVFTDPDFQGERIRKIIMQAVPN--AKH
Q8DVW8_STRMU          --DVDTYETRGS-AINDEDLERIEKLNNLRGVIVFTDPDYNGERIRKLIMTAVPT--AKH
Q04DR7_OENOB          GDSIETIETGGS-KIRSAVLDLIEQSARDHELILLTDPDFQGERIRKIVLERVPN--IKQ
Q5FMG4_LACAC          -PGIETVETNGS-AVSDAVLNQLKKLSKTRQIIVFTDPDFNGERIRRIVTNAVPS--AKQ
D0BLR0_9LACT          -PEIETIETNGS-AIDDETLALIKKASEIREVIVFTDPDYPGQRIRSIIQEAIPT--VSH
RNM5_BACSU            --DADTIETNGS-AIDDHVIDQIRLAQKTRGVIILTDPDFPGEKIRKTISEAVPG--CKH
Q8EU41_OCEIH          --DADTIETNGS-AINKQTLEKIRHAKEKRGVIIFTDPDYPGERIRNIINEHIPG--CKH
RNM5_LISMO            --IADTIETNGS-ALSQETIEKIRHAQELRGVIIFTDPDFPGEKIRKQIDSAVPG--CKH
E6TRN9_BACCJ          --ECDTIETNGS-AVEDHVIKRIKLANDRRGVIIFTDPDYPGEKIRHIINEKVPG--CKH
F2F1A0_SOLSS          --GADTIETNGS-AISDEVLRRIAHAQKKRGVIVFTDPDYPGRRIRAIIEERIPG--VKH
RNM5_CLOAB            D--AEMIAVGGFGINSK-IISKIKEAQKRRGVIVLTDPDFAGEKIRSIISKRVKG--IKH
Q899D6_CLOTE          D--AEVIAVGGFGINAK-VINRIKEAQKRQGVIVFTDPDFAGEKIRKIISKRVEG--VRH
F9VM64_ARTSS          N--AEVIYVSGFGISSR-TMNLIKNAQERCGVILLMDSDSAGERIRKKISDEVKG--VKH
RNM5_FUSNN            D--AEVFQVNGHAVRKNKSIEILKLAYENKGLIILTDPDYAGEEIRKYLCKHFPN--AKN
A0A133NBL3_9FUSO      D--AEIIQVNGFAIRKKGNIDKIKKAYEKKGIILLTDPDYAGNEIRSFLQKHFPK--AKN
E3H7T4_ILYPC          D--AELIEVNGFAVRKRSTLEKIKNAQERTGVIILTDPDFAGEKIRKTIENYVPG--VRH
C7N9R2_LEPBD          D--AHIIALNGFSALSEKTINKIVELSKNNDLILFTDPDFAGKKIRDTLKKYIPN--IKH
D1ANK4_SEBTE          D--AHVIAVHGYSSFKKKTIEKLKQISLTNDIIILTDPDFAGKKIRNLIKVHIPD--AKH
D7N825_9FIRM          D--AEIISTHGF-GYGMKLIKTLQEINKRRGIIIFTDPDYMGKKIRADLSKHLKG--AKH
C7REB8_ANAPD          D--CEMIATNGL-AFGKDLIERLKEVDKRCGIIILTDPDYAGKKIRSRIAKHIPN--AKH
B0S068_FINM2          D--CEVVCTGGI-YFSDKLLKRLKKIDQDRGIIILTDPDYAGNKIRKRINDFIPT--AKN
F8IIZ7_ALIAT          D--AEVLILGGD-RVSRRTVDLLRRAVEVRGAIVLTDPDGAGERLRRRLDQLVPG--LLH
D5WRH0_KYRT2          K--ADVVVTGGM-AVSRELIGFLRKVAAERGVIILTDPDAMGERIRTRIADRVPG--CKH
F4EXM9_SELS3          D--ADCIVTGGF-SLGRRALADIEAAYKRRGIIILTDPDSAGERIRRFLAKRFPE--AGH
G4Q6W6_ACIIR          D--ADTIETGGF-TLSPYTLKKIEAAYKKRGIIILTDPDGAGERIRRYLTERFPE--AGQ
G0VQN6_MEGEL          D--VDMITTDGF-NLKPHTLEQIRCAYEKRGIIILTDPDRAGEQIRKFLTDRFPK--AKH
D1BLQ1_VEIPT          D--ADCIATEGF-TLRRGVIDMIRVAYEKRGIIILTDPDTAGERIRRVLTKKFPN--AQH
D6GSF8_FILAD          S--AEVIATNGY-GFPHFVKERIRKASETKGIIILTDPDYAGKKIRSEVAAIARN--CKH
E3PVN0_ACESD          D--AEVIATNGY-GFPKGVVERIIKAHKERGIIVLTDPDYAGERIRDKITKLVGN--CKH
A6TJK8_ALKMQ          E--AETIITGGF-SLPERVMKQIETAAKRRGVIIFTDPDFAGDKIRKRIANRVPG--CKH
F0SW69_SYNGF          D--VDVLWTEGF-GLSQKKIAYLREMAVRRGVIVCTDPDFAGKTIRDRISKCVPG--VKH
B8FY37_DESHD          N--VDILWTEGY-GLTQEKLAYIAEAAKRCGVIVLTDPDSVGEQIRERIRRQVPE--AKH
B0TB83_HELMI          D--AQVIVTQGL-GISPETMAVIGRAQERCGVIVFTDPDGPGERIRRWVTEAVPG--AKH
C0ZHC5_BREBN          N--ADTIETGGS-AIHKRTIEKIRLAQQKRGVIIFTDPDYQGERIRKIISKSVPG--CKH
D3E743_GEOS4          E--ADTIETGGS-AINKQILKRIALAQERRGVIILTDPDHAGERIRKIVDQGVPG--CKH
Q5WLW3_BACSK          E--ADTIETNGS-AVGESVLKQIELAAKRRGVIVFTDPDYAGNRIRQIVSKRVPG--CKH
D6XV39_BACIE          D--CDTIETNGS-AVPDAVLERIALALGRRGVIVFTDPDYPGDQIRKIIDREVPG--CSH
B1YGN9_EXIS2          D--VDTIETNGS-AVNEQTLQRIAKALERRGVIVFTDPDFPGDRIRARINERVPG--CKQ
U5FAV8_9FIRM          D--CDTIETHGT-HLSVETLRLIEQAAKTRGVIIFTDPDHPGETIRTAINQKIPG--CKN
E7FWJ6_ERYRH          D--ADVIMSSGT-HMSAEFLTLCKRMNEDRGIIVFTDPDGPGEMIRRRIIETVGS--CKH
RNM5_MYCPN            --DVSVITTNGS-ALNQRTINLIKAVAKKQPVILFLDPDVAGQKIRRQLEQHLDK--YES
RNM5_MYCGE            --DVDVITTNGS-ALKKETINLIKKISEKQTVILLLDPDQQGKKIRSKLEQHLTN--YYN
Q7NAR1_MYCGA          --DCETIETNGS-EISDQTISLIKELSLTRGVILFLDPDYQGKKIRAKLIKELKE--YRE
Q9PQU9_UREPA          --NAQIITTNGS-EINKKTLALIKQAQLSKGIILFLDPDYQGERIRKIITNYLKDGIIKQ
Q8EUI2_MYCPE          --NVSTIETNGL-SLSNKKINEIISISKKRGIILFLDPDLPGEKIRKKLMESLPE--AKQ
RNM5_MESFL            GENLITFETNGL-GIDDKKLNSIKELSKKNKIIIFTDPDGPGKKIRETIIEFLDVD-VFN
Q14QK4_SPICI          -PDIKTIETSGS-GITKEKLALIKKISLNNKIIIFTDPDYPGQKLRQIISDYLENN-CLH
A9NE78_ACHLI          -PNIRTVSVGGS-QIKEDVIQFLKTYEDKFQIILLLDPDYTGEQIRKRIAKHLTNP-THI
                                *                     ::  *.*  *  :*  :           

RNM5_BORBU            ---IKHAYLNT-----KDTEVESVNKTEIIKILKGVGTLSKDNQ----------------
G9QWI5_9FIRM          AFVAKKDARGK-----KKLGIAEANKEAVIEALENVVSFDVN------------------
B9E8V9_MACCJ          AFIDADIAVSKR----GKIGIEHAPVEAIQDALMHVSTPF-------DYTSETVS-----
A0A059MYX8_ENTFL      AFLSRKVAVPKKNG--GSLGVEHASDEAIIEALKKVVTPVQA-----DEDYQEIP-----
G0M3G6_LACPE          AFLPRQAGVPTKAG--GSLGVEHASPAAIQAALAHLYTEQVDEA------QPLIT-----
C7XXA9_9LACO          AFIQRRQGVPTEAH--GSLGVEHASQQVIREALSNLYTEEEVD-------QPEFT-----
Q034Q7_LACP3          AFLPRREGVPD-HK--GSLGIEHAKPAALRAALQHLFTDMPDA-------PQVIS-----
Q38V21_LACSS          AFLPRSEAKPEKMG--GSLGIEHAKPAAIKQALENLLTQDEDA-------VEQIS-----
G2KU31_LACSM          AFLKKKDAVPDNPR--GSLGVEHASPETIREALSLVYTESHDN-------PEVIS-----
F4BLG4_CARS1          AFLTKDEARAK-GK--GSLGIEHASPEAIRAALSKCYTETIAK-------ESLIS-----
F2I732_AERUA          AFLERQDAKPK-HK--GSLGVEHASFAAIDQALSAIYTVTTSGES-----QPPFT-----
G0UI87_9LACT          AFLTKDEAGRQIR--HHSLGIEYATPSVLRDALQSVYTA----------ETVTAKSD---
F8I1A6_WEIKK          AFLTKDQAGANIK--HHSLGIEYATLNNIQTILAQVAGN----------DIVEISSN---
Q03VR6_LEUMM          AYLTQAEARATKDNPHKSLGVEHATPDTLRNALANVITPV---------HAIGITSD---
F9VBX5_LACGL          AFLKREEARPKGKG---SLGVEHAKYEDLQKALGHLTGG----------KNIEPT-----
A0A5M9QBZ1_LACLH      AFLNRDEARPKGKG---SLGVEHANFEALNQALAEVFGGEKVTDEFGSAKTQEPSSDRSS
Q8DVW8_STRMU          AFLNRGEAVPKSKTKGRSLGVEHASFEDLQKALSGVLGN----------YDDENHFD---
Q04DR7_OENOB          LFLNKIDG-KPNHK--GSLGVEHADPKLLKKLLGKYVKEFSP--------TLEIQ-----
Q5FMG4_LACAC          AFITRKEG-EPHKK--GSLGVEHASKEAIERALKDLHEVDPQ--------KSDLT-----
D0BLR0_9LACT          AFIEREEAVRKTNH--KSLGVEHASDESIQKALEHVYKPVADL-------QEEIS-----
RNM5_BACSU            AFLPKHLAKPK---NKRGIGVEHASVESIRACLENVHEEM----------EAQPSD----
Q8EU41_OCEIH          AFLPKEEAKNNKS-DRASLGIEHASVAAIQKALEHVYELA----------EMKTSD----
RNM5_LISMO            AFINRQDALPK---AGRGLGVEHASSANIREALENFHTSG----------APTEKQF---
E6TRN9_BACCJ          AFISKESAIDY---QKKKVGVEHANKESILSAIEKAKPSS----------SYEVVSE---
F2F1A0_SOLSS          AFLAKAKTIAK---NGKGLGIEHANDEDIREALSNVYTLA----------DSQIEEK---
RNM5_CLOAB            ARISQSEGT-----KNGDIGVENASPESIIRALNNAKCETQKKT----------------
Q899D6_CLOTE          AYISKGEGY-----KDGDIGVENASPKAIISALNSAKCNVKIKR----------------
F9VM64_ARTSS          AYIPKNKSI-----KNGDIGVENAHPKDIILAIKNAKCELSYRR----------------
RNM5_FUSNN            AYISRVSGT-----KDGDIGVENASPEDIITALEKARFSLDNSV----------------
A0A133NBL3_9FUSO      AYISRSEGK-----KGDDIGVENAKPEAILRALELAKCNIEKQE----------------
E3H7T4_ILYPC          AYIGRKEGTRL---KDGNVGVENASPSVIIRALNDAKCKLIERN----------------
C7N9R2_LEPBD          AFVSQKDAT-----RNDNIGVENANDKAILEALKNVVTANQDGK----------------
D1ANK4_SEBTE          AFISRKEGT-----KNNNIGVENADTAAIIEALKKTKIIFHDTKE---------------
D7N825_9FIRM          AFLPQGKAK-----KKDNIGVENASAYDIKIAIENAKPEYEDSI----------------
C7REB8_ANAPD          AYIDRKKAI-----KKNDLGVENAEPEVIIEALRRAKAETKERV----------------
B0S068_FINM2          AFIAQDLCI-----KDEDIGIENAKEEDIKIAIENAHPSMIDSK----------------
F8IIZ7_ALIAT          AHVRRASAA-----SSRGIGIEHASAEDVRQALIEARGRETPPAEQ-------------S
D5WRH0_KYRT2          AFIPPEEAT-----DGSDIGIEHASPSAIDRAL--ARVRAEVPAK---------------
F4EXM9_SELS3          AFIPKEEAT-----AKGDIGVEQASPDSIRRALAKVRTCTIAPRE---------------
G4Q6W6_ACIIR          AFVPKCEAL-----AHHDVGIEQAQPEAILKALSKVRHTTMTPQE---------------
G0VQN6_MEGEL          AFIPRKDAI-----ANNDLGVEQASPEAIRLALSKVRCATYEPQE---------------
D1BLQ1_VEIPT          AFVPRDEAF-----ANDDIGIEQASPESIRKALSTLHVESLESSN---------------
D6GSF8_FILAD          AFITQEEGM-----KNGDIGVENASPDAIRKALNCARCETETESF---------------
E3PVN0_ACESD          AFISKEAGL-----KNDDVGVENASPESIIQALEKARYEEVDKRN---------------
A6TJK8_ALKMQ          AFLPKEEAM-----KDGDIGIENATPKSICAALAKARSESMEKRE---------------
F0SW69_SYNGF          VYLPRKEAYDP---LRKDIGIENASLEDIRKAFLKNVGEKTRVSIH-------------Q
B8FY37_DESHD          VYLSKKDARSP---KDDDIGVENASPEDIQKAFQKIRTDTLYSEPK-------------N
B0TB83_HELMI          AFLPVALAK-----KDGKVGIEHASPQAIREALAKVRSPGTQREL---------------
C0ZHC5_BREBN          AFITQEDGT-----KKGDIGVENATPDVIIRALSEVRTEMAETAG---------------
D3E743_GEOS4          AFIPEADAT-----RKGDIGVENASPEAIRRALERVHTSFEGGES---------------
Q5WLW3_BACSK          AFIKKADANPKQ--RGKSVGVEHASPDAIREALLAVR----TEQLE-------------P
D6XV39_BACIE          AFLPKADAIDVR--KGK-VGIEHAGYRALQEALASVRRPGDDAQED-------------P
B1YGN9_EXIS2          AYLPRADAKD----KRGKIGVEHASPEAIERALGAVYETEEQHDA---------------
U5FAV8_9FIRM          AYIEKHKAKTA-----KKVGVEHASKKDLLDALSHVFTYKEQLVE---------------
E7FWJ6_ERYRH          ASLHVLQTKKK-----QKVGIEHADCDDIVEVLSTCSTFALNNES---------------
RNM5_MYCPN            CFIARKDMKPN----STKIGVAEATDAALIQALQQRQ---VFTKTTQ-------------
RNM5_MYCGE            CYVDMNARLKN----AKKAGIAEMETSALIAALNNRV---AITKNAN-------------
Q7NAR1_MYCGA          AFIDLSELK-D----SKKKGIAEASNEAVLSAFNNLV---SSEHDSY-------------
Q9PQU9_UREPA          CFISKDNMKNN----SKKIGIAEANNDALLKALKSQG---TFVINSI-------------
Q8EUI2_MYCPE          CFIEKSDIK-K----GKKIGVAEASVKSIIKAFENIT---EFKKEN--------------
RNM5_MESFL            AFVSKQDIDKN----SKKIGLAEASEEAIKKALDNLI---TYNKKNI-------------
Q14QK4_SPICI          AFISKNDAIK-----GKKVGVAEASEIAIKNSINNLI---SFSNQPV-------------
A9NE78_ACHLI          FVQKHKAISKN----KKKIGVEHLSLEDLKTMLLHEVQELPKVESIT-------------
                                          :       :   :                           

RNM5_BORBU            ------KDLLKLSDLLELGIIGEN-SKENRQKIQKHFCLGDGNS-KKLLERLNYFKIKKT
G9QWI5_9FIRM          ------RESITWSEFVALDIIG---NKQRRLMVYEAFNLGYGNV-KTLFKRLNMVGITKE
B9E8V9_MACCJ          -----------KAFLVDNGLIIGPYAKEKRKQLCKYLRIGYCNG-KQLFHRLNAFGITEQ
A0A059MYX8_ENTFL      -----------RQTLVEYGLIAGANAKKYRELLGDDLRIGYTNS-KQLVKRLSMFRITEA
G0M3G6_LACPE          -----------QHDLIQAGLLAGPTARKRREQLGERLGIGYVNG-KQLPKRLQLFQIQPA
C7XXA9_9LACO          -----------RTDMAKANLVGGATARYRRERLGQILGIGYGNG-KQMLKRLNVFRVSRT
Q034Q7_LACP3          -----------QQDLLAADLVGGVGARQRREQLGELLHIGYTNG-KQLLRRLAEFQISRA
Q38V21_LACSS          -----------QSDLLVAGLIAGPSAKARRERLGEVLHIGYTNS-KQLYKRLKMFQVSQD
G2KU31_LACSM          -----------QQELMDSNLMGSHDAKERRLELGEILHLGYVNA-KQLQRRLRMFGITKA
F4BLG4_CARS1          -----------QELLMDAGLIMGPFARKRRTKLGEKLSIGYTNG-KQLQKRLQMFQISPE
F2I732_AERUA          -----------AAELMALGLLGGEDAAARRDYLTKRLKIGHSNG-KQLAKRLALFQISPA
G0UI87_9LACT          ---------ITLADLRRLGLIAGHDAAKRREHVAEVMGLGYVNG-KQLMNRLTMFGIKKQ
F8I1A6_WEIKK          ---------ITKQDLLEWGLINGPQAGARRTYLSERLNLGYVNG-KQFMKRIQMFGIQKE
Q03VR6_LEUMM          ---------IDRSFLLDLGLLSGPEARVKRAFVGEQLHIGYANG-KQLLKRLQAFGIRRA
F9VBX5_LACGL          ---------VAQTDLIVFGLILRSDSRQRREYLCGELRIGYANG-KQILKRLNMFGIEVQ
A0A5M9QBZ1_LACLH      VSKKELLTELTQTDLMSFGLVMAADSRKRREFLCEQLRIGYANG-KQIKKRLNMFKITKE
Q8DVW8_STRMU          ---------ISKSDLMRFGLLMGADSRKRREYIGEKLRIGYSNG-KQLLKRLELFGITKA
Q04DR7_OENOB          -----------RSDLVDFGLIDGAGSAVLRKKISDQLHLGNTNG-KQFLKRLQMFGITKK
Q5FMG4_LACAC          -----------MEEYNKLGLAGGSGSRKLREQVGIRLSVGYGNS-KQFYNRLHTFGISLD
D0BLR0_9LACT          -----------QSVILELELIGYPHSSYLRKEVSKELRIGHTNG-KQLTKRLKLFGISEQ
RNM5_BACSU            ---------ISAEDLIHAGLIGGPAAKCRRERLGDLLKIGYTNG-KQLQKRLQMFQIKKS
Q8EU41_OCEIH          ---------ILKADLIEYGLIGGKKASERREWLGKRLKIGHTNG-KQLLKRLTQFQISKK
RNM5_LISMO            ---------ISKDILVHLGLLGGVGAKERREKIGNILKIGYTNG-KQLQTRLESFAISEE
E6TRN9_BACCJ          ---------ITKEDLLHAKLIGGSGSRERREALGTKLNIGYTNG-KQLLKRLQQFQISKN
F2F1A0_SOLSS          ---------ITLEDLMTAKLIGHPQSKKRRDQLGEILNIGMTNG-KQLHKRLMMFQITLE
RNM5_CLOAB            -------YEFTIEDMLFFKLVGNSEAKKRRDLVGNELGIGYSNG-AQFLSRLNNFGISKE
Q899D6_CLOTE          -------EEFSIQDMMVYGLSGATDSKERRDKLAKVLRIGYCNT-SQFLTRLNNYGITRE
F9VM64_ARTSS          -------EEFTQKDLFNNKLVGNRDSLKRREILGNILGIGTANG-KKFLSRLNSFNISRE
RNM5_FUSNN            -------NIFNLDLMMDYNLIGKDNSADLRSLLGAELGIGYSNG-KQFMAKLNRYGISLE
A0A133NBL3_9FUSO      -------NAYSIQFLYDLELVGHPRSTKYREIFTSILGIGYSNG-KQLLSKLNRYGFSEE
E3H7T4_ILYPC          -------DIFTSMDMLEYGLTGGDDSKNKRQIVGVKLGIGYGNG-KQFLAKLNHFGITKD
C7N9R2_LEPBD          -------NRFNISDLIDNRFVSGSNAKERRIMLGDMLKIGYYNA-KQLLKALNSFNISRE
D1ANK4_SEBTE          ------PNSYTFDDLINNNLCYGKDSKLRREKLGDILHIGYYNS-KQLLQSLNSFNIPRR
D7N825_9FIRM          -------IMFNERDLIMHGLSGSIGASEKREKVSEILKIGHGNS-KQFLSRLNRFKITRE
C7REB8_ANAPD          -------ETFTMADLIKNDLSFGKGSKERREKLGDILGIGYYNS-KQLLSKLNSFGISRE
B0S068_FINM2          -------NEYTMDDMIYYGLVGEE-SKALRIKVGKILNIGYGNA-KSFLRMLNNYNISRE
F8IIZ7_ALIAT          SGE---TPEFTLDDLVRHRLVHHPDAASRRERLGEWLAIGYGNA-KAFLHKLNAYGVTRE
D5WRH0_KYRT2          ------VWRITWSDMMEAGLVGAPGASVRRAKVARDLGVGYGNA-KSFWKRLNVLGVDPE
F4EXM9_SELS3          --------VFTSRDLILAGLSGGEDASRRRARLGARLGVGWANA-RTFCKRLNSYGVTRE
G4Q6W6_ACIIR          --------EFTAMDLYHNGMSGSQSAAEKRDALGAELGIGYGNV-KKMVERLNHYGVTRD
G0VQN6_MEGEL          --------TFTMQDIAAAGLNGTPDAADRRAEVGAILGIGYGNA-KQFLKRLNHYGVTRD
D1BLQ1_VEIPT          --------EFTMVDLVRHGLSGMPDSAARRAVIGAKLGIGYGNG-KQFLYRLNHYGITRD
D6GSF8_FILAD          --------EFTMNDLVQNNLIMGSGAKERRIAVGEALGIGYTNA-KQFLSRLNHYGITRK
E3PVN0_ACESD          --------EFTQADMLRYDLVGMENASFRRDVLGKKLGIGYCNA-KQFLNRLNNYGIERE
A6TJK8_ALKMQ          --------VFTRVDLIGNGLMGDNQASYRRDEIGKTLGIGYGNA-KQFLNRLNHYGVTRE
F0SW69_SYNGF          PEY-------IMEDLLEARLAGCEGARERRNRVGAMLGLGDTNA-KQFLFRLNRFRVNRA
B8FY37_DESHD          NEYPTAGTSFTMKDLLEAGLAGLSHSAERRLAVGKILGIGDANA-KQFLRRLNRFGITHE
B0TB83_HELMI          ---------YNRDDLRQWGVDGVPGAGQRREALGERLGIGRANA-KQFLQRVNHFGLSRS
C0ZHC5_BREBN          --------EITSDDLLANGLTSGVDAKERRIKLGEALGIGYANA-KQMLQRLNAFQISRA
D3E743_GEOS4          --------LISLEDMLEAGLSAHPEAAARRMAMGNLLGIGYCNS-KQFHKRLAMFQISRE
Q5WLW3_BACSK          F-----AAQMTVADLMEAGLLSGKGARSRRERLGEHLSIGYANG-KQLLKRLHIFRITPE
D6XV39_BACIE          S-----FETVPLRRLTEAGLLDGPDARSRRRILGELLGIGYNNS-KQLPKRLHQFRISLR
B1YGN9_EXIS2          --------EVTREMILAADLIGGAAASKRRKRLGQLLAIGEPNA-KQLVKRVASIRITKQ
U5FAV8_9FIRM          --------SISWEEYLSLGLHGGKAAAHQREKVAQALYLGRPNA-KTLFKRLNMMQLTLH
E7FWJ6_ERYRH          ---------LTLHEFQSLGLSGASDSALRRDLLSEAFRFPKSNA-KSCLKYLNMLNITKA
RNM5_MYCPN            -----------PTLSWEQYLELNLNSKSKRLALCNKLHLSYFNH-KQLFRKLNLLQLTFD
RNM5_MYCGE            -----------QSILWDQYLSLKLNDKKKRLLLCNNLNLPYFNH-KQLFKKLNLLNLTFQ
Q7NAR1_MYCGA          -----------QSLTWKEYLALNLNTKNKRIELCKKLNIPYGNN-KSLFRYLNLLKKNFD
Q9PQU9_UREPA          -----------ESITWLEYLSLNLNNKKIRLMLCDYLNISYCNH-KQLFKRLNMMQKTFK
Q8EUI2_MYCPE          -----------KSLEWNDYIDLDLNSKNKRIFLCKKLNISYCNH-KQLYKRLNMLNLTYT
RNM5_MESFL            ------------SISWDEYVKNDFYIKANRIIIANHFNLSEDMSSKSLFKWLNWMNLKVK
Q14QK4_SPICI          -----------DNLLWSDYI-NLVDSKLKREKIIKYYNLMPTNN-KTTFKWLNYMNVKKQ
A9NE78_ACHLI          -----------LDSLYKLGLSGQTDSKAKRDYLTSKLNLTYSNS-KTLIQRLNWLGLSYK
                                         .         *  .     .            :        

RNM5_BORBU            DLKNQLALTNSPRRT-----------------------------
G9QWI5_9FIRM          QVLGRLNDGSR---------------------------------
B9E8V9_MACCJ          DIKQALYDKGEE--------------------------------
A0A059MYX8_ENTFL      ELKESMTRILKELANEE---------------------------
G0M3G6_LACPE          DFWAAVDQLTTEE-------------------------------
C7XXA9_9LACO          QFQKAMVQVNQEDEDGHK--------------------------
Q034Q7_LACP3          AFLAAVAQVDGGQHDKT---------------------------
Q38V21_LACSS          EFGAALRQINEELGD-----------------------------
G2KU31_LACSM          EFEAALKQID----------------------------------
F4BLG4_CARS1          EVVTVMQQILEEENDNT---------------------------
F2I732_AERUA          AVLKVVAEYNQKEKKENSYD------------------------
G0UI87_9LACT          ALLEVLQELDEEK-------------------------------
F8I1A6_WEIKK          ELLKILTELD----------------------------------
Q03VR6_LEUMM          QVEDVLKGKY----------------------------------
F9VBX5_LACGL          QIEEIMKGYK----------------------------------
A0A5M9QBZ1_LACLH      QIENVMKNY-----------------------------------
Q8DVW8_STRMU          EVEEVMEKYQKR--------------------------------
Q04DR7_OENOB          ELKEAIKNLE----------------------------------
Q5FMG4_LACAC          ELKTAVDELKTAVEEVKNGK------------------------
D0BLR0_9LACT          QLRNAVQIVQERS-------------------------------
RNM5_BACSU            DFMSALDTVMREEQNE----------------------------
Q8EU41_OCEIH          QLDEAMELMDQEVQHDDEQIHRNSF-------------------
RNM5_LISMO            QLVAACQKIMQEEENE----------------------------
E6TRN9_BACCJ          EFADALRHIERGEDDDR---------------------------
F2F1A0_SOLSS          QFAEAISQLDQ-EDTHV---------------------------
RNM5_CLOAB            ELINAVNTVNRRYYDEGI--------------------------
Q899D6_CLOTE          EFLNGIRKIDEESSYGKK--------------------------
F9VM64_ARTSS          VFLSSLKKLEELIDDEC---------------------------
RNM5_FUSNN            EFKKAYEKINMK--------------------------------
A0A133NBL3_9FUSO      EILKAHQKMKEEYEK-----------------------------
E3H7T4_ILYPC          EFLKAMEK------------------------------------
C7N9R2_LEPBD          QFNAAVKKINK----NDI--------------------------
D1ANK4_SEBTE          SFDEALIQINKLIQEGDFS-------------------------
D7N825_9FIRM          EFENAVKVVENGKTI-----------------------------
C7REB8_ANAPD          EFERAVDNL-----------------------------------
B0S068_FINM2          KLEEAINR------------------------------------
F8IIZ7_ALIAT          AFEEAVRRLDG---------------------------------
D5WRH0_KYRT2          EFRAAVRAAGGGRSHD----------------------------
F4EXM9_SELS3          EFEAALTSLEDGNETAAVRNAEDGAETAAVRNDEPKAAAKGGAL
G4Q6W6_ACIIR          EFNKALQIIE-------TRHA-----------------------
G0VQN6_MEGEL          EWDAALRQIHEVK-------------------------------
D1BLQ1_VEIPT          AYEEAVNC------------------------------------
D6GSF8_FILAD          EFDDEIEKVNQNLR------------------------------
E3PVN0_ACESD          EFEAALKELEIDNE------------------------------
A6TJK8_ALKMQ          EYIEALKNLDEVGMKNG---------------------------
F0SW69_SYNGF          DFQEALMPEQINHE------------------------------
B8FY37_DESHD          EFNKAV-REAIHGERSELYPAHP---------------------
B0TB83_HELMI          EIEQALKAIEEQ--------------------------------
C0ZHC5_BREBN          EFEAAIAAINKERE------------------------------
D3E743_GEOS4          EFLAALAQLEEGGV------------------------------
Q5WLW3_BACSK          EFNEAVRWINKQEESELE--------------------------
D6XV39_BACIE          EFEEAQAAMIKEMEQFER--------------------------
B1YGN9_EXIS2          EWEDALKQIEEEQD------------------------------
U5FAV8_9FIRM          DVEELLRK------------------------------------
E7FWJ6_ERYRH          DCLMVLKESNYENNR-----------------------------
RNM5_MYCPN            QVCQLLK-------------------------------------
RNM5_MYCGE            DVWKHLK-------------------------------------
Q7NAR1_MYCGA          ELKKLISEI-----------------------------------
Q9PQU9_UREPA          EIKIIIEGF-----------------------------------
Q8EUI2_MYCPE          EVFNILNSNNKKNTF-----------------------------
RNM5_MESFL            DIEKIIGE------------------------------------
Q14QK4_SPICI          DLIDILKEKQWRNKTKKCVPKG----------------------
A9NE78_ACHLI          DLEDILYASS----------------------------------