CLUSTAL format seed alignment for MF_01471

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CAS2A_ARCFU      --------------------------------MLHLVVYDISDDGS-----RARLAKLLE
CAS2B_SACS2      --------------------------------MKLLVVYDVSDDSK-----RNKLANNLK
CAS2A_SACS2      ------------------------------MAMLYLIFYDITDDNL-----RNRVAEFLK
CAS2_DESAP       --------------------------------MKTLVSYDIVEDKV-----RRKVFEACK
CAS2_KORCO       ---------------------------MRGGNLKVLVVYDITDDSL-----RLKVAEILK
CAS2B_PYRAE      --------------------------------MYVVVAYDITEDEV-----RNKVADALK
CAS2B_CHLAA      --------------------------------MQCLVIYDIPNDRA-----RQRVADACL
CAS2_AERPE       -------------------------------MVYVLIAYDISNDSK-----RLKAAQKLL
CAS2_HYPBU       -------------------------------MPYVVVFYDVSDNKR-----RDLLAKTLQ
CAS2A_RHORT      -----------------------MGTRRSNAEHAYVVAYDIADPKR-----WRQVFKTMK
CAS2_GEOSL       ------------------------------MEHLYIVSYDIRNQRR-----WRRLFKTMH
CAS2A_NITEU      --------------------MPADHFLKRQAMSDFIICYDITDPRR-----LGRLYRYLI
CAS2B_THEYD      ------------------------------MRLPYLVCYDISDEGR-----LNRVYRFMK
CAS2B_NITEU      --------MLGTANLPSRNKYKAKATILHMNRNLYLVAYDICNPRR-----LRQVCRYLT
CAS2A_THEYD      ------------------------------MRVLYIIAYDITDARR-----LGQIRYFLK
CAS2_DESVH       --------------------------MYGNDAMLVLISYDVSFEDPGGQRRLRRIAKACQ
CAS2_CHLTE       --------------------------------MLVLVTYDVNTETPAGRRRLRRIAKTCQ
CAS2C_RHORT      ---------------------------------MILVTYDVNTVEPGGRRRLRQVAKACQ
CAS2C_NITEU      --------------------------------MLIIVTYDVSTETRAGRKRLRRVAKLCE
CASA1_MOOTA      --------------------------------MYILITYDVSTETEAGKKRLRKVAQVCK
CAS2_THEMA       --------------------------------MYVIMVYDVNEKRV------AKILKIAR
CAS2_DICTD       --------------------------------MYVIMVYDVNQRRI------NKVLNTAR
CAS2C_THEYD      -------------------------------MPYLIVTYDIAEERV------NKVRKILK
CAS2_THEKO       --------------------------------MYIIVVYDVSVERV------NRVKKFLR
CAS2_PYRFU       --------------------------------MYIVVVYDVGVERV------NKVKKFLR
CAS2_METJA       -----MLKKEWDYVNKILKKIKNIRNLLQDESMYVIIVYDVNVSRV------NKIKSFLR
CAS2_METTH       ----------------------------MVVTVYLLIVYDVGVERV------NRVKSYLR
CAS2B_ARCFU      ----------------------------MVVIVYVIVAYDVNVERV------NRVKKFLR
CAS2_METAC       --------------------------------MYVVIVYDVGVERV------NKVRSFLR
CAS2_NANEQ       --------------------------MQYKINMYAIVVYDVNVSRQ------NQIREFLR
CAS2_FRAAA       --------------------------------MFVVLVYDTAAERN------PNALRTCR
CAS2_FUSNN       ------------------MKRNINLFKCGGDKMYVVVVYDISLDEK-GSRNWRKIFGICK
CAS2B_MOOTA      ----------------------------------MILIYDINTEDNDGKRRLVKIMKTSR
CAS2B_METHJ      -------------------------------MVRLVITYDIRKDKI-----RNKLFRLLE
CAS2D_RHORT      MVWWDDPDDAFCEDPFDPEGDYGALQVGKQPMNRYVICYDIVDDKR-----RLKVAKCLD
CAS2C_SYNY3      -------------------------------MFLYVIAYDIPDDRR-----RKKMADLLE
CAS2B_SYNY3      -------------------------------MDFWLVCYDVRDDKR-----RRKLAKLLE
CAS2A_CHLAA      --------------------------------MFYLISYDISVDQR-----RLKIAKLLE
CAS2C_CHLAA      ------------------------------MKMFTVISYDIVDDQR-----RTSVMKVLK
CAS2_THET8       -----------------------------MRELYLVIAYDTPDDRR-----RARLAKLLK
CAS2_METC4       -------------------------------MAVFLIAYDLVNERR-GTHDYQPLWDELK
CAS2_METED       -------------------------------MAVFLIAYDLVNERR-GTHDYQPLWDELK
CAS2_STRMN       ----------------------------------MILMFDMPTDTAEERKAYRKFRKFLL
CAS2_STRMU       --------------------------------MRMILMFDMPTDTAEERKAYRKFRKFLL
CAS2_STRG1       --------------------------------MRMILMFDMPTETAEERKAYRKFRKFLL
CAS2_STRTR       ---------------------------MSYRYMRMILMFDMPTDTAEERKAYRKFRKFLL
CAS2_TREDE       --------------------------------MRVIVFFDLPVITPENRHNYSVFRKYLI
CAS2_FILAD       --------------------------------MRIIVFFDLPTITLEDKRDYRDFRKFLI
CAS2_LACS1       --------------------------------MRLMIIFDLPVETSEERKEYRKFRKNLI
CAS2_LACRG       --------------------------------MRLMIMFDLPVATSKDRRNYRRFRRALI
CAS2_CAMJE       --------------------------MIEDKFMRVLLMFDVPTKSKKEQKLASKFRNNLI
CAS2_ACIET       --------------------------------MRMLVFFDLPVVSKADRRAYTVFRRFLL
CAS2_FLAPJ       ------------------MYDEHYTRLNQYRSLWILVFFDLPTETRKERKIASEFRKKLL
CAS2_CAPCC       --------------------------------MWVMVLYDLPTETKAMQKAANLFRKRLE
CAS2_PARL1       --------------------------------MWVIAMFDLPTDTPKARKAYARFRKDLL
CAS2_ACIAP       -------------------------MLTGYRLMWMVVMFDLPVITKAERKAATGFRNALL
CAS2B_RHORT      -------------------------MPDGWRKMGVLVFYDLPVVSPEQRLAAVRFHKFLL
CAS2A_SYNY3      --------------------------------MLYLIIYDVPATKAGNKR-RTRLFDLLS
CAS2_THEPD       --------------------------------MIVIVAYDISDEDR-----RGRLRRYLR
CAS2A_METHJ      -----------------------------MTVKHLIVCYDVEKTKD-----RNKVIKVLE
CAS2_LEPIN       ------------------------------MKHWRLVSYDIREPKR-----LRRVAKIME
CAS2_ALLVD       -----------------------------MSSRLAVFAYDIRDDRV-----RRHALKTLR
CAS2A_PYRAE      --------------------------------MIWLAVYDIEDDGE-----RAKASAILQ
CAS2_METRM       --------------------------------MKVLVSFEIKFKTN-----KEKIISILK
CAS2_METKA       -----------------------MGVLGGPSPRLRLYVYDFKEPGG--EAERRKLRELLE
                                                    :  ::                    

CAS2A_ARCFU      KFGLQRVQYSAFRGELNPNDREVL-ARQVGKFVR------DDRDCIFIIPLCQRC--SST
CAS2B_SACS2      KLGLERIQRSAFEGDIDSQRVKDL-VRVVKLIVD------TNTDIVHIIPLGIRD--WER
CAS2A_SACS2      KKGLDRIQYSVFMGDLNSSRLKDV-EAGLKIIGNRKKLQEDERFFILIVPITENQ--FRE
CAS2_DESAP       DYGLTNVQYSLFFGDMTHNRREEL-FQRLRRIIG------RQEGKVLICPVCDKD--LRL
CAS2_KORCO       DLGLFRIQKSAFIGEMTSQERENM-EEILRRQNL------GPSDRIDVFPICDRD--LKM
CAS2B_PYRAE      AYGLERIQRSVFVGRINPALLKDL-VERLKRITK------GANADITIFKVDRRA--IDT
CAS2B_CHLAA      DYGLQRIQYSAFAGNLSRTHQRAL-FGEITRRVK------GHTANVQLFVFDSKT--WSD
CAS2_AERPE       QMGFARVQKSVYIAKGGRSLAKEA-YRALQRLAD------SGKDKIMVMVIPGDS--VRD
CAS2_HYPBU       SLGLVRVQRSVFMGRGGYTKAKEA-IRAASRIVD------ARTDSVVALVVPEDY--ARR
CAS2A_RHORT      GYG-QWVQLSVFQCRLDGGRRIAM-ASILESLID------RETDHVLMLDLGPAEDVDLA
CAS2_GEOSL       GFG-CWLQLSVFQCRLDRIRIIKM-EAAINEIVN------HAEDHVLILDLGPAENVKPK
CAS2A_NITEU      KRA-VPLQYSVFLFRGDDRQLERC-IQDAIELID------EKQDDLRVYPLPG----RGL
CAS2B_THEYD      GKG-FHIQYSVFYCILTDVELKEM-KAEILKLIH------SRYDDVRIYPLPN----NSL
CAS2B_NITEU      GYK-VSGQKSVFEIWVTPTELHTI-RTELDKLMD------TQADRLHILSLDP----RMK
CAS2A_THEYD      GYS-TGGQKSVYECFLEREELKFI-ISKIKRLIN------PNEDRVHIFRIDG----RSK
CAS2_DESVH       DYG-QRVQYSVFECVVDPAQWAKL-KHRLLSEMD------KEKDCLRFYYLGANW--RNK
CAS2_CHLTE       NYG-QRVQFSVFECNVDPAQWVKL-RSKLLNEMD------PKLDSLRFYFLGSNW--QGR
CAS2C_RHORT      DYG-QRVQNSVFEVEVDPARWVAL-KARLEAIID------PALDSLRYYDLGANW--QRR
CAS2C_NITEU      SIG-QRVQKSVFECRINLMQYEEL-ERRLLSEID------EQEDNLRLYRLTEPA--ELH
CASA1_MOOTA      DFG-QRVQKSVFECSVNEAQFEQL-KHRLLQCID------EKSDSLRIYRLREPA--KKY
CAS2_THEMA       KYL-KWVQNSVLEGELSPGKYEKL-KLEVSRLID------EKEDSVRFYVMDSQK--VFN
CAS2_DICTD       KYL-EWIQNSVLEGEITEAKFEML-KREIEIIIN------EEEDSVIFYIMRTTK--YSE
CAS2C_THEYD      KYF-MWVQNSVFEGEITEGKLLKC-KLELEKVID------KEVDSVYFYSLENRL--NYR
CAS2_THEKO       QHL-HWVQNSVFEGEVTLAEFERI-KAGIGELID------GDEDSVVIYK--LRS--MPK
CAS2_PYRFU       MHL-NWVQNSVFEGEVTLAEFERI-KEGLKKIID------ENSDSVIIYK--LRS--MPP
CAS2_METJA       KHL-NWVQNSVFEGEVTKAEFERI-KDGILRIID------EDEDSVIIYQFPLNF--MPK
CAS2_METTH       TEL-HWVQNSVFEGEVTESQFRRI-ETNLERIID------RERDSVIIYSFRSER--AMN
CAS2B_ARCFU      RYL-NWVQNSLFEGELSSADLEEV-KMGLREIIN------EDEDMVVIYRFRSAD--AFK
CAS2_METAC       EYM-NWVQNSVFEGELTKAEFLKI-KSRLKELIQ------ESSDHIIFYSSRDRK--YLG
CAS2_NANEQ       KYL-YHVQRSVFEGEISPSSLYYM-KKILQSYIG------ETDSLIIYVLRDKSC--LMD
CAS2_FRAAA       KYL-HWVQRSVFEGELSAAQYRAL-MTTLRDQLD------LTYDSIRVYRTRSPA--LVE
CAS2_FUSNN       RYL-HHIQNSVFEGELSEVDIQRL-KYEVSKYIR------DDLDSFIIFKSRNER--WME
CAS2B_MOOTA      KYL-SHVQKSVFEGDITEGQISLL-KKEIMAIVN------MKKDFVIIYSLRDGV--KLN
CAS2B_METHJ      RYG-AWKQYSVFELEINPVHKVEL-FHSIADLIE-------DTDRVRIYDLCERC--QGK
CAS2D_RHORT      SYG-SRVQFSVFEVLVSKPLMTRM-VRELGALIN------AKTDRISIYPQCATC--DAR
CAS2C_SYNY3      GYG-QRVQYSVFECTLSKSKFNEL-QKRLRKIYQ------SEEDSLRFYPLSGHT--LTQ
CAS2B_SYNY3      QRC-QRVQYSVFECPLPEKVLTDLLHRRWLKELN------LKEDSLRAYPLQRQS--RSQ
CAS2A_CHLAA      GYG-QRVLESVFECDLELPAYRQLRQKLNRLIKD------EEGDRLRIYRLCASC--REQ
CAS2C_CHLAA      GYG-VRVQYSVFEAILDAREFHDL-SNQLRKIID------PGQDSIRCYRLDQVA--AQR
CAS2_THET8       GFG-ERRQYSVFEARLTREQWAHL-KGKLEALVN------KEEDVLAVYFLPPEA--VGR
CAS2_METC4       RLGAHRTQFSLWLVSANNTT-AEV-RQHFQQFVD-------SNDRIWVTRLRKSQ--YDY
CAS2_METED       RLGAHRTQFSLWLVSANNTT-AEV-RQHFQQFVD-------SNDRIWVTRLRKSQ--YDY
CAS2_STRMN       SEGFIMHQFSVYSKLLLNNSANTAMIARLKENNP-------KKGNITLLTVTEKQF-ARM
CAS2_STRMU       SEGFIMHQFSVYSKLLLNNSANTAMIARLKENNP-------KKGNITLLTVTEKQF-ARM
CAS2_STRG1       SEGFIMHQFSVYSKLLLNNSANKAMIDRLQANNP-------KKGSITLLTVTEKQF-ARM
CAS2_STRTR       SEGFIMHQFSVYSKLLLNHTANTAMVGRLKANNP-------KKGNITILTVTEKQF-ARM
CAS2_TREDE       KSGFIMQQKSVYSKLVLNLTNRDSIVKSIEKNKP-------PEGLVEVLTVTEKQY-AKM
CAS2_FILAD       KKGFLMMQESVYCKLVLNQTVASSVLSSIRKHKP-------KSGLVQMIMVTEKQF-AKM
CAS2_LACS1       NEGFIMIQYSVYVRVCVNKKSAEFTEKRIESFLP-------SKGVVQSLILTEKQY-NDM
CAS2_LACRG       DEGFLMIQYSVYVRVCKTKKSAAYMEQRIATVKP-------PTGIVQTLMVTEAQY-QSM
CAS2_CAMJE       KLGYFMLQFSVYMRICKGLSSAKSSIENVKKILP-------PYGNVRALIITEKQF-DKM
CAS2_ACIET       NDGYDMIQFSVYGRILNGTDAAQKHMQRLLANLP-------SEGSVRVLTVTEKQF-ASM
CAS2_FLAPJ       DDGFSMFQFSIYIRFCASRENAEVHTKRIRNSLP-------EHGKIGVMQITDKQF-GMM
CAS2_CAPCC       DDGFSLFQFSIYLRHCPSRENAEVHKKRVKMMLP-------KYGKVAVMTITDKQF-GDM
CAS2_PARL1       EDGFTMMQYSVYSRHCASIENAEVHVKRMGAVVP-------AQGEVRFLTITDNQF-GRI
CAS2_ACIAP       DVGFQMSQFSVYLRFCTSQAQVDTLCRQVEQALP-------AGGKVHIFQFTDKQY-ERA
CAS2B_RHORT      ADGFERMHYSIYARYCGSMERAATYERRVEQALP-------AVGHVNLLKLTDRQM-VGM
CAS2A_SYNY3      GYG-KWRQFSVFECFLSVKQFAKL-QTAMEKLIK------LDEDAVCIYVLDENT--VQR
CAS2_THEPD       RLGLARVNRSVYAGP-GTATTAELVAERAKEIVE-------EGDSVFVIVVREDE--YQR
CAS2A_METHJ      YYGLIRVQYSVFMGSLTETRLHQM-NARIKREFT------KPSIKILVIEVCNAC--MER
CAS2_LEPIN       GFG-ERIQYSVFRIYSTDKELEKL-RWKLAKVTE-------EEDNIFYLTLCTKC--ASG
CAS2_ALLVD       EWR-LDGQLSVHECQVDAIQARRL-FEQLGDELD-------PATDAWLFTWVEGH---RA
CAS2A_PYRAE      AWGFVRVQRSFYVGRMPRGKAADL-LKILQRHVK--------SGHIALIPITDEL--LAK
CAS2_METRM       HFGFRRMQENLYFGDVEYDELYAM-QSDIMENIR-------EYDSILTIPICKSC--YLK
CAS2_METKA       SHGAFRLQYSTYALLAEPEVHARV-LRRVVARVD-----FEEGDSLIVVPMCRRC--LRV
                          .                                                  

CAS2A_ARCFU      AIVISN---------------TGVELVKEKGVEFV-------------------------
CAS2B_SACS2      RIVIGR---------------EGLEEWLV-------------------------------
CAS2A_SACS2      RIVIGY---------------SGSEREEKSNVVW--------------------------
CAS2_DESAP       SKAIEVSAGMPEEAAEAAVSYPGRSRKKARAG----------------------------
CAS2_KORCO       HSQIG----------------RGKFGRGPP------------------------------
CAS2B_PYRAE      AIRIGP---------------PPPARKNVDLY----------------------------
CAS2B_CHLAA      RRILE-----------------QQYDDA--------------------------------
CAS2_AERPE       AYGLGGSLE------------DGKR---VVVV----------------------------
CAS2_HYPBU       MLVYGGIMS------------DPKQKQAVRVV----------------------------
CAS2A_RHORT      VESLGK---------------AFETLERQAMII---------------------------
CAS2_GEOSL       VSSIGK---------------TFDPILRQAVIV---------------------------
CAS2A_NITEU      KARIG----------------RPTLPEGIQWSGLPAKW----------------------
CAS2B_THEYD      VAVLGV---------------GDRIPDGVEVFY---------------------------
CAS2B_NITEU      PRCYGN---------------A-STFTVQHFCIV--------------------------
CAS2A_THEYD      VITLGI---------------AVPPIDPEYFYIG--------------------------
CAS2_DESVH       VEHVGA---------------KPAYDPEGPLIL---------------------------
CAS2_CHLTE       VEHEGA---------------KEPRDLEGTLIL---------------------------
CAS2C_RHORT      VDHVGA---------------KPAVDLHGPLIL---------------------------
CAS2C_NITEU      VKEYGN---------------FKAIDFEGPLTI---------------------------
CASA1_MOOTA      IQEYGV---------------NLTIDFDAPLVL---------------------------
CAS2_THEMA       LETLGV---------------EKGE--DGFIF----------------------------
CAS2_DICTD       RQILGI---------------EKNK--REQIL----------------------------
CAS2C_THEYD      KTVLGI---------------EKEI--TGNIL----------------------------
CAS2_THEKO       REVMGV---------------EKNP--IEDII----------------------------
CAS2_PYRFU       RETLGI---------------EKNP--IEEII----------------------------
CAS2_METJA       REILGL---------------EKNP--IDDII----------------------------
CAS2_METTH       RNVLGL---------------EKSP--LDVIL----------------------------
CAS2B_ARCFU      REVMGI---------------EKGLG-GEEVI----------------------------
CAS2_METAC       IEDLGT---------------PKAD--TSNII----------------------------
CAS2_NANEQ       KIVLGE---------------DKDL----QIY----------------------------
CAS2_FRAAA       TEWLGV---------------PLGN--QDSVL----------------------------
CAS2_FUSNN       KEMLGL---------------QEDK--TDNFL----------------------------
CAS2B_MOOTA      REILTD---------------TPDP--TDNFL----------------------------
CAS2B_METHJ      ITELGE---------------VSPDKMQ---VVI--------------------------
CAS2D_RHORT      RTDLGA---------------TVEKPVHEPWIIV--------------------------
CAS2C_SYNY3      VDIWGE----------------PPLTKPPGSVIV--------------------------
CAS2B_SYNY3      AKIFGS----------------PDLYEPPDFLIL--------------------------
CAS2A_CHLAA      IEIIGD---------------GPPPETSQDIYII--------------------------
CAS2C_CHLAA      TVIYGI---------------GLTTTDPTHYMV---------------------------
CAS2_THET8       TWRIGH---------------EGLKRLEDPDFV---------------------------
CAS2_METC4       ANAIGG---------------TNNWLSNNPPEA---------------------------
CAS2_METED       ANAIGG---------------TNNWLSNNPPEA---------------------------
CAS2_STRMN       IYLNGERDT---------SIANSD---SRLVFLGEAFPDET-------------------
CAS2_STRMU       IYLNGERDT---------SIANSD---SRLVFLGEAFPDET-------------------
CAS2_STRG1       IYLNGERNT---------SVANSD---RRLVFLGEDYSDEN-------------------
CAS2_STRTR       IYLYGDKNT---------SIANSE---ERLVFLGDNYCDED-------------------
CAS2_TREDE       EIIIGESKT---------EYLNTD---ERLVVL---------------------------
CAS2_FILAD       EYLCGEKRS---------NVVDSD---DRLVIL---------------------------
CAS2_LACS1       HFLLGKKIK---------EVRNSA---ERTIIL---------------------------
CAS2_LACRG       HFMVGTEKQ---------DIRNSA---DRTVMI---------------------------
CAS2_CAMJE       ELLLGGIVF---------NEKVNN---ETNLTLFDIDSHGEFKYKNSNNEEIQINKKQEK
CAS2_ACIET       KLLVGLPLF---------QEKKVN---AAQIALF--------------------------
CAS2_FLAPJ       ELFYGKKPV---------ETDKP----SQQLELF--------------------------
CAS2_CAPCC       EIFHSKVRE---------DPPPT----YQQLELF--------------------------
CAS2_PARL1       KVYVGKKRQ---------PTTQS----PSQLQLF--------------------------
CAS2_ACIAP       ISFHGRSRQ---------PAQKA----PDQFDLF--------------------------
CAS2B_RHORT      RKWIRGNYR---------APENAEFVPPAQYQLF--------------------------
CAS2A_SYNY3      TITYGT----------------PQPEKPGSIII---------------------------
CAS2_THEPD       AHVFDGR--------------DYYIVSERKYEVY--------------------------
CAS2A_METHJ      ALLVHE----------------ELPKVNRQFEVI--------------------------
CAS2_LEPIN       AHTQEKK--------------SAWPEAPKTLKIL--------------------------
CAS2_ALLVD       VLARGK---------------GRTTALQDGLLLAA-------------------------
CAS2A_PYRAE      ALELGRPP-----------YAPLKPPKYAQIYVV--------------------------
CAS2_METRM       LNVFGR----------------NLSFKDELYKIF--------------------------
CAS2_METKA       ARWVDA-------------------EGVRGLRF---------------------------
                                                                             

CAS2A_ARCFU      ---------
CAS2B_SACS2      ---------
CAS2A_SACS2      ---------
CAS2_DESAP       ---------
CAS2_KORCO       ---------
CAS2B_PYRAE      ---------
CAS2B_CHLAA      ---------
CAS2_AERPE       ---------
CAS2_HYPBU       ---------
CAS2A_RHORT      ---------
CAS2_GEOSL       ---------
CAS2A_NITEU      ---------
CAS2B_THEYD      ---------
CAS2B_NITEU      ---------
CAS2A_THEYD      ---------
CAS2_DESVH       ---------
CAS2_CHLTE       ---------
CAS2C_RHORT      ---------
CAS2C_NITEU      ---------
CASA1_MOOTA      ---------
CAS2_THEMA       ---------
CAS2_DICTD       ---------
CAS2C_THEYD      ---------
CAS2_THEKO       ---------
CAS2_PYRFU       ---------
CAS2_METJA       ---------
CAS2_METTH       ---------
CAS2B_ARCFU      ---------
CAS2_METAC       ---------
CAS2_NANEQ       ---------
CAS2_FRAAA       ---------
CAS2_FUSNN       ---------
CAS2B_MOOTA      ---------
CAS2B_METHJ      ---------
CAS2D_RHORT      ---------
CAS2C_SYNY3      ---------
CAS2B_SYNY3      ---------
CAS2A_CHLAA      ---------
CAS2C_CHLAA      ---------
CAS2_THET8       ---------
CAS2_METC4       ---------
CAS2_METED       ---------
CAS2_STRMN       ---------
CAS2_STRMU       ---------
CAS2_STRG1       ---------
CAS2_STRTR       ---------
CAS2_TREDE       ---------
CAS2_FILAD       ---------
CAS2_LACS1       ---------
CAS2_LACRG       ---------
CAS2_CAMJE       YHQQNLFEF
CAS2_ACIET       ---------
CAS2_FLAPJ       ---------
CAS2_CAPCC       ---------
CAS2_PARL1       ---------
CAS2_ACIAP       ---------
CAS2B_RHORT      ---------
CAS2A_SYNY3      ---------
CAS2_THEPD       ---------
CAS2A_METHJ      ---------
CAS2_LEPIN       ---------
CAS2_ALLVD       ---------
CAS2A_PYRAE      ---------
CAS2_METRM       ---------
CAS2_METKA       ---------