CLUSTAL format seed alignment for MF_01472

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GTFA_STRGN            -MTVYNINLGIGWASSGVEYAQAYRAQILRRIQQPAKFIFMDMILADNIQHLTENIGFLD
A8AWV4_STRGC          -MTVYNINLGIGWASSGVEYAQAYRAQILRRIQQPAKFIFMDMILADNIQHLTENIGFLD
GTFA_STRPN            -MTIYNINLGIGWASSGVEYAQAYRAGVFRKLNLSSKFIFTDMILADNIQHLTANIGFDD
G5K929_9STRE          -MTLYNINMGIGWASSGVEYAQSYRAKLLRMIGAKGIFIFTDLILNENVQHLTKNIGFED
F9HIS9_9STRE          -MTIYNINLGIGWASSGVEYAQIYRAKLLRSVGLDAKFIFMDFISSDNIQHLTQNIGFYD
GTFA_STRPA            -MTIYNINLGIGWASSGVEYAQAYRAQILRSLGMPAKFIFTNMFQSENLEHFTKNIGFED
A0A3L8GMK1_STRIN      -MTIYNINLGIGWASSGVEYAQAYRASVLREQGIPAKFIFTDMFQSENLQHFTSNIGFKD
GTFA_STRAG            -MVVYNLNRGIGWASSGVEYAQAYRSEVFRKLGVEAKFIFTDMFQNENIEHLTRNIGFED
Q5M5Q0_STRT2          -MTVYNINLGIGWASSGVEYAQAYRSTIFKNIGIKAKFVFMDMFLQDNLSDLARNMGFSD
U2J2C1_9STRE          -MTVYNINLGIGWASSGVEYAQAYRSKVFKNLGLEAKFVFTDFFSQDNIIDMTRNVGFSD
Q8DYM8_STRA5          -MTVYNINHGIGWASSGVEYAQAYRGSVLRKLGIDAKFIFTDFFSADNIISLTRNIGFQD
Q2FUW7_STAA8          -MTIYNINFGIGWASSGVEYAQAYRAKLLRRTNQDTKFVFLDFIQSENIQTLTQNIGFKD
Q4A0Y1_STAS1          -MTIYNINFGIGWASSGVEYAQRYRAQLLRKCNETIKFVFLDFIKNENIQTLTENIGFKN
Q4LAH5_STAHJ          -MTIYNLNFGIGWASSGVEYAQLYRRNIFKLMKENFKFIYLDFIQKENIQTLTENLGFED
F2I914_AERUA          -MTIYNINLGIGWASSGVEYSQIYRSRIFDQLGETAKFVFVDLILNENIAHFTQNIGFRD
A0A1H8YUD3_9LACT      -MTVYNFNMGIGWASSGVEYAQYYRSLAFDYLDVDAKFIFTDLILNENIQTLTSNMGFKD
G9WHE3_9LACT          -MTVYSFNLGIGWASSGVEYAQAYRANIFRKLHQPAKFIFTDLILNENIAHLTENIGFQD
T2F4C1_LACLC          -MTIYNFNKGIGWASSGVEYAQAYRSNIFKKNKQIAKFIFTDMFQ-ENLQPMAQNIGFED
V8AQD2_9LACT          -MTIYNFNLGIGWASSGVEYAQAYRSNIFKKNKQEAKFIFTDIFH-ENLEAMTKNIGFED
A0A0R2H5J5_9FIRM      -MSIYNINLGIGWASSGVEYAQAYRAKVLRELGFKAKFIFMDMFQYENIEHMTKNIGFQD
A0A1H3YGF5_9FIRM      -MTIYNINRGIGWASSGVEYAQSYRAKIFRDMGIHAKFIFTDMFQNDNLEALTSAMGFTD
R5CDS8_9FIRM          --MIYNFNRGIGWASSGVEYAQAYRGTVLRNAGIPCRFIYTDMFRGDNIALMTENIGIPD
A0A2T4TCN1_9FIRM      MNTVYNVNRGIGWASSGVEYAQAYRSKIFSQLGVRTKFIFTDFFERDNIEYMTKNIGFAD
R5ZDK7_9FIRM          --MIYNFNLGIGWASSGVEYAQAYRAKMFRNIGADAKFVFTDFISSENIEHLTKNIGFLD
C4ZG32_AGARV          --MVYNFNLGIGWASSGVEYAQSYRANLLRRAHIPARFVFTDMFPTENIEHMTRNIGFLD
A0A1H6USQ0_9FIRM      --MVYNFNLGIGWASSGVEYAQSYRGIALRKAGIPAKFVFTDMFPRDPLEHMTKNLYFED
K0NV38_9LACO          -MTVYSINKGIGWASSGVEYAQGYRGQVFRELGIKAKFIFTDWIGYENIAHLTENLDFRD
GTFA_LACR5            -MTVYNINLGIGWASSGVEYAQSYRAQAFRNLNISAKFVFSDLILGNNIADLTANLGFNA
E3C8W4_9LACO          -MTVYNVNLGIGWASSGVEYAQAYRSQSLNQLGIPAKFIFSDLILGNNIQDLTSNLDFKD
Q74L36_LACJO          -MTVYNINLGIGWASSGVEYAQKYRDQSFDKVGIERKFIFSDLILGNNIGDLTANLGFDN
A0A0D4CJL6_LACMC      -MTVYNVNLGIGWASSGVEYAQAYRSKVFSRMQIPAKFIFSDLILADNIAELTRNLGFHD
                         :*..* ***********:* **   :        *:: : :  : :  ::  : :  

GTFA_STRGN            EEIIWLYNYFTDIKIAPTTVTLDQVL-------AQVAGQ--PERSEKEG-----KIVRYF
A8AWV4_STRGC          KEVIWLYNYFTDIKIAPTTVTLDQVL-------AQVAGQ--PGRSEKEG-----KIVRYF
GTFA_STRPN            NQVIWLYNHFTDIKIAPTSVTVDDVL-------AYFGGE--ESHREKNG-----KVLRVF
G5K929_9STRE          DEVIWMYHYFTDIKLAPTTYTLKDVL-------ESIPFH--IEKEEASG-----KIRRYF
F9HIS9_9STRE          SEIIWLYQYFTDIKVAPTTYTLTQVL-------ANLEKQPLEIIRNPEN-----KTIRLD
GTFA_STRPA            NEIIWLYGYFTDVKISGTTYKKDDLE-------ATFSQC--PTKKEASSDR---KLIRYY
A0A3L8GMK1_STRIN      HEIIWLYGFFTDIKVAPTTYSKAELE-------KSFPSP--ISKIENNG-----RLVRYY
GTFA_STRAG            NEIIWLYTFFTDLTIAATSYSLQQLK-------ESFSLP--IDRTEKNG-----KIISFF
Q5M5Q0_STRT2          EDIIWLYSYFTDLKIAPTTYTVKDLE-------KEIPYD--ITRREING-----KVVKLF
U2J2C1_9STRE          DQIIWMYNYFTDQTPAPTTLTESDLK-------AQFTRE--ITKVDRED-----KLVRFY
Q8DYM8_STRA5          KEIIWLYNFFSDIELAPTTFSIEDLQ-------KQYLGK--LVRKEDKG-----RVIKFF
Q2FUW7_STAA8          QEVIWLYQYFSDISLAPTTYTLDDIE-------RELGHD---ISFRER-NG---KIVRLY
Q4A0Y1_STAS1          EEIIWLYQYFTDIKIAPTSVTVDEII-------KPLYSE---ITKVEN-QG---KTRKIH
Q4LAH5_STAHJ          DEIIWIYQYFTDIKIAPTTYTIQNII-------DRLEDT---NVEIERVNN---KIKKII
F2I914_AERUA          EDIIWMYLYFTDIKIRATSYRLADVK-------ASLAHA---IEEEKKEGD---QIVRLY
A0A1H8YUD3_9LACT      QQVIWLYQAFSDLPIEASSYRLDQVL-------AQYVQQ--PIRFERAA-----NIIRYY
G9WHE3_9LACT          SEIIWLYTFFSDFEIAPSSYPLSQLE-------ASFPFA--ASSVERSE-----KQVRYI
T2F4C1_LACLC          DEIIWLYQSFTDVRISPTTFSVKDLE-------KEITFT----IKEKKTST---NSVTYI
V8AQD2_9LACT          HEIIWLYQYFTNIKISPTTFTLKQLE-------KSFASK----PQHIEKNE---NLVSYI
A0A0R2H5J5_9FIRM      DEIIWLYQYFTDMPIEPTTMSEERFE-------KTFTLP----FEKKEDGN---KIIYSF
A0A1H3YGF5_9FIRM      EEVVWLYQFFTDYGVCPCSVRPEEIE-----GMFSGSWN----IEEQGEGL---PRIYQF
R5CDS8_9FIRM          EEVIWLYQYFTDFAVAGPSVSIAQFEQKMLLGSAKGAEA----YQVQEGPG---RREYCF
A0A2T4TCN1_9FIRM      EDVIWLYLWFTDFSVAKTTFTPQDLE-------EKLDGE----FEKSTIND---TIVYNE
R5ZDK7_9FIRM          SEILWLYSYFTDFPIEPVTYTLQDLE------ATFDKEP----SSVSRQGK---IVRYIF
C4ZG32_AGARV          EEVIWLYTFFTDVRTSPVTFTLKQLE------ASMAEED----YTFSREGK---TCRYQF
A0A1H6USQ0_9FIRM      DEIIWLYTFFTDFKIAPVTYAKEDFE------RTFQDTD----YHYKREGN---VGTYTF
K0NV38_9LACO          NEVIWLYTFFTDFKIKPGSYTLKRLE-------KHLPKI-----VEKKKLT---KSVRYV
GTFA_LACR5            DQIIWLYNFFTDIKIAPSTFLLDTFV-------EQNHLEQRNFSLLPNNGT---KELQYK
E3C8W4_9LACO          DQIIWLYNFFTDVRIAPSTYTLNQLE-------RDLQLKQRQAEKKVNG-----KEVQYL
Q74L36_LACJO          DNIIWLYNFFTDVKSSTSNYSLDTLE-------NELNLKKLSSNVKTVG-----KEVFYQ
A0A0D4CJL6_LACMC      QDVIWLYNFFTDVKIAPTTYPLSEFK-------RAQHFAERNVEAAVQNFADGKQVVHYW
                       :::*:*  *::      .     .                                   

GTFA_STRGN            YPQDDQFITCYLRQE-DQDSVEHVEYVSRGRLIRKDYFSY--VRYASEYFAPHNDAATLY
A8AWV4_STRGC          YPQDDQFITCYLRHE-DQDFVEHVEYVSRGRLIRKDYFSY--VRYASEYFAPHNDAATLY
GTFA_STRPN            FFDQDKFVTCYLVDE-NKDLVQHAEYVFKGNLIRKDYFSY--TRYCSEYFAPKDNVAVLY
G5K929_9STRE          YDNNQQFVTCYLSKE-TADFVDRAEFVSKGCLIRKDYYNY--TRYCSEYFTPKNNKAHLY
F9HIS9_9STRE          YGNAD-FITCYACDM-DRELIERVEIVSRGCLIQKEYYSY--TKMFVEYYAPVNGRAKLH
GTFA_STRPA            FENQELYINASLYGE-NQEYVQRVEYVVKGKLIRKDYYSY--TKVFSEFYSPGENGVQLC
A0A3L8GMK1_STRIN      FENQDYYVNATLCGQ-ENKAVQRVEHVSKGKLIRKDYYSY--TKVFSEYYAPSNDKPHLY
GTFA_STRAG            FKGSSIVVTVMLNDE-SSNIVQRVEYLMGGKLVRKDYYSY--TKMFSEYYAPEDIGPCLY
Q5M5Q0_STRT2          CTKEDIFYAAYLRKE-GEDIVHRVEKVSRGCLIRKDFYSY--TKMFTEYYTPVDNKAHLY
U2J2C1_9STRE          FGNRD-FATAYYCRH-SKEIIHRIEFVSNGNLVRKDFYNNGKTLSFTEFYAPKDNAAKLY
Q8DYM8_STRA5          YEDENIYLTVYLDNF-NKDKVHRVEIVSNNNLIRKDYYSY--TRTFSEYYYPKDGVAHLY
Q2FUW7_STAA8          FNGKSSFVTCYLQNE-QKDIVDRAEFVINSMLVRKDFYSY--TRIFSEYYAPADNKAKLY
Q4A0Y1_STAS1          FNHNSNYLVCYLKNE-DSDVVDRVEYISRGKLLRRDYYSY--VRVLSEYFAPEDNSAKLY
Q4LAH5_STAHJ          FGNDNNYIRCYLKNE-SENIVDRAEYVSKGKLIKKEFYNF--TIVFTEYYAPYEKKAKLY
F2I914_AERUA          YDQGKQYATCYLVEG-SDDLVNRVEFVVNGCLVRKDYYNY--TRFLSEYYAPQDNKAKLY
A0A1H8YUD3_9LACT      FNEQGDFLTCYLKKG-TKDIVDRAEFVSRNCLIRKDYYAS--QLYLSEYYVPKDNQAKVR
G9WHE3_9LACT          FQSNNTIVTAYLKQG-S-SFVERVEYVSRGKLIRKDYYSY--GRFLTEYYAPKDNRAHAY
T2F4C1_LACLC          SEENGIRLTAYLDKV-ATDKVYKTELLVNGKLIQRDYYTY--VKTFSEYFKPVDNSARLF
V8AQD2_9LACT          WE--GIRVTAFIDKTGASGAIYKTETVVNGNLIQRDYYNY--VKIFSEYFKPVNNQANLY
A0A0R2H5J5_9FIRM      PN--NSYMCAYLTRD--HRYIHRVECVSDGCLIRKDFFTS--QRAFTEYYVPYDNKANLY
A0A1H3YGF5_9FIRM      AEE-NAYVRMYIKYG-G--FVQKTETVIRGRLVRTDYYSS--GRIFSEYYAPKDGRAKLY
R5CDS8_9FIRM          ADG-IQKVYAYYVPG-DRRIIQKADFYCKGRLTHAEYYSY--GRIFTEYFADKNGKLTLF
A0A2T4TCN1_9FIRM      KDR-KHFVTAYLTKD-GK-AVQRVEDVFQGCLLTRDYYSY--GKYCTEYFTPENGRAKLR
R5ZDK7_9FIRM          SAD-NSFYTAYLVNE-SEDFVHRVEFVSKGYLVRKDFFTS--GRLFSEYYAPLDNKAHLY
C4ZG32_AGARV          KES-GRFYTCYMVDD-TSDLVHRVEIVSNGCLIRKDYYTY--CRTFSEYYAPLDGKAHLY
A0A1H6USQ0_9FIRM      VES-DTFYRAYFIDK-ESDYIHRVEYVSGGKLIRKDYFSY--AKMYSEYYAPVDKMARFF
K0NV38_9LACO          FDN-DFWATAYLKSD-GSDIVERIEYVSGANLVRKDYFNY--GRYCTEFYAPKDNRAKLY
GTFA_LACR5            SEEEKLTIVPRYNNR-EKQTIDQVTYIFNNRLIKRDFYSY--TKYATEYYSGEEKDNQVI
E3C8W4_9LACO          LNDEGLILVVRLHDE-QGQTLDQVSYVANGQMVMRDFYSY--VKYAREYYNGQKENNHVT
Q74L36_LACJO          LND-GLQLVARLSDA-EKRTIDQVSYVKNNTLLKRDFYSY--TKYACEYYLGADKDNRVT
A0A0D4CJL6_LACMC      LPDENLRINVRIYDL-ATQAIDYAEYVVDSQMVRREFYSY--IRYVTEYLSA---GNHVY
                                          :          :   :::         *:           

GTFA_STRGN            QRRFYHEDGSVAYDMLIEDG----QEKLYRFPDRI-FYSKAELVRYFLQCLQLQADDVVI
A8AWV4_STRGC          QRRFYNEDGSVGYDMLIEDG----QEALYRFSDRI-FHSKAELVRYFLQCLQLQANDVVI
GTFA_STRPN            QRTFYNEDGTPVYDILMNQG----KEEVYHFKDKI-FYGKQAFVRAFMKSLNLNKSDLVI
G5K929_9STRE          QRRFFNEDGSTAFDEILDE-----ESHLYRFKDHM-FLSTRELLTYFINSLQLTEKDIVI
F9HIS9_9STRE          QRSWLNEDGSVAYDEIIDDVDGKYDTCLYRFPKQV-FYSKQEFVAYFIRSLQLQSDDLVI
GTFA_STRPA            NRSFYNEDGSIAYEEILSNE-----KSTFVFSNKI-CYGLEELLEFMLEDLSLTKSDLIL
A0A3L8GMK1_STRIN      QRTFFNEDGSLAYEEIVMEN-----RSIFQFSDEI-CYSKDDLVAYMLKQLHLSHQDIIL
GTFA_STRAG            QRTFYNEDGSVAYEENVDGE-----NSIFKFKETI-LYSKEELVGYMLEKLQLTNSDLIL
Q5M5Q0_STRT2          QRRFFNEDGSIAYDEIVDGK-----DSVFRFPDKI-LSSKQEFIAYFMSQLGLTDQDIVI
U2J2C1_9STRE          KRSYYNLDGSLAYDEITDGD-----QPFYRFPNRI-LYSKEELVAYFMERLELTSEDLVL
Q8DYM8_STRA5          QRRFYNEDESTAFLEMVENS-----SSRFIINGRL-LPSKVAFFDYFLESMTFTSKDIIL
Q2FUW7_STAA8          MRQFYNQDGSIAYNEYIDGD-----SSIYVFEDAV-LYNKTEFIAYFLQRLNLTRDDIVI
Q4A0Y1_STAS1          MRSFYNEDGSIAYNEYVNDE-----ESMFVFEDNI-LYGKQALIACFLEKLHLTDKDMLI
Q4LAH5_STAHJ          LRTYFNEDGSIAYEEHISGK-----NSIFVFPNVI-LYSKLEFIAYFLRQLNLTREDILL
F2I914_AERUA          QRRYFNEDGSVAYEEIVDGD-----HSVFKMSDAI-LYNKEELFAYFIQKLDLSEKDIVI
A0A1H8YUD3_9LACT      CRQFYNQDGSISLTEIIDED-----KSIYRIDQEI-FYSKAELVGYFILNLSLTEQDILL
G9WHE3_9LACT          LRRFLNENGSVAFEEVTDDQG----QAFYRFPDRI-IDSKELLIQYFVSCLHLTADDSLI
T2F4C1_LACLC          QRRFFNVNGSVAYEELLNG-----KDSLFLFENRI-ISSKRVLLEEFIKNLQLTAQDILI
V8AQD2_9LACT          QRRFFNEDGSTAYDELLNG-----EQSLYVFEDRT-IYSKENLLIHFVESLGLSKKDILI
A0A0R2H5J5_9FIRM      RRCFYNRDGSIGLDEYING-----DDSIYRVNEHF-FYNKEDFIGYFLKQLHFTKDDVVI
A0A1H3YGF5_9FIRM      LRRFYNRDGSEAYIQLIDG-----DKKIYRMKDAE-FFSKEEFIGYMLHELHMTSEDIVI
R5CDS8_9FIRM          LRRFYNEDGSIAYEEHMDG-----ERQIFRMKDKI-LYSKQELICEMVRSLPYKPGDVII
A0A2T4TCN1_9FIRM      LRRWFNTDGSTAYEEIIDG-----EDILYKMRDAL-LYSKEAFVGYFFKKLHLDKSDMLI
R5ZDK7_9FIRM          NRRFFNQDGSLAYEEIIDQ-----DKVMYKFKDKV-LCSKEDFVGYMVSCLNLTGKDTVI
C4ZG32_AGARV          GRTFFNEDGSVCYEEVIED-----DSTFYRIGAQV-LYTKADLVGYMVKRLNLTADDVVI
A0A1H6USQ0_9FIRM      LRRFFNSDGTIAYDEVLEEGT---DNATYHFKDRI-IDSKQELIGYMIDELHLTESDYVI
K0NV38_9LACO          QRRFYNEDGTTVYDEIIDGD----GESMFKFKDEI-LYSKHELLAKMLKELDFGKKDIIL
GTFA_LACR5            FREFYNENGTIAYTQHLDGDG----HELFEFPDQN-YYSKTDLYREMLRKFNFKADDIII
E3C8W4_9LACO          VREFYNEDGSVAYVQHLDGD-----KETFEMADGTVYYSKNDLYREMIRRLHFQKGDVVI
Q74L36_LACJO          FREFYNEDGTIAYTQHLNGD-----QETFEFANGEVIYSKDDLYLKMLKELNFTKKDVII
A0A0D4CJL6_LACMC      ARDFYNEDGSIAYHQYVNGT-----NEVFELKDQI-FYSKTALYAEMIRRLKLTAQDLVI
                       * : : : :                  : .           :   :.  :     * ::

GTFA_STRGN            LDRET-----GIGQVVFEESQKAKLGVVVHAEHFSENASSDDYILWNNFYDYQFTNADKV
A8AWV4_STRGC          LDRET-----GIGQVVFEESQKAKLGVVVHAEHFSENASSDDYILWNNFYDYQFTNADKV
GTFA_STRPN            LDRET-----GIGQVVFEEAQTAHLAVVVHAEHYSENATNEDYILWNNYYDYQFTNADKV
G5K929_9STRE          LDRSS-----EIGQAVMEGKGRAKTGCVVHAEHYSKNAKDNDYILWNNYYEYEFTHADQV
F9HIS9_9STRE          LDRET-----DIGQAIFENKGQAKLAVIVHADHFSENEEETQYILWNNYYEYQFEYAQDV
GTFA_STRPA            LDRAT-----GIGQVVFENIGAAKLAVVIHAEHFNEKNTDEHNILWNNYYEYQFTNADKV
A0A3L8GMK1_STRIN      LDRAT-----GIGQAVLQHRGAAKLAVVIHAEHFSVNGTDDDNILWNNYYDYQFTNADKI
GTFA_STRAG            LDRST-----GIGQAVLRNKGNAKVAVVVHAEHYNVSATDETTILWNNYYDYQFSNADSI
Q5M5Q0_STRT2          LDRAT-----GTGQAVFRNTKPAKLGVVVHAEHFSENAVTDKTILWNNFYEYQFSNADKV
U2J2C1_9STRE          LDRST-----GIGQSVFRHVKPAKLGVVVHAEHYSENGTNANSVLWNNYYDFQFTNADSV
Q8DYM8_STRA5          LDRGT-----DTAQSLLRHGKPAKLGTVVHAEHFSENAVTADTILWNNYYDYQFTNANRF
Q2FUW7_STAA8          LDRAS-----DIGQAVLQHKGDSKVGVVIHADHYSNNMMSEQHILWNNYYEYQFSKAKYI
Q4A0Y1_STAS1          VDRSK-----DIGQTVLQNKGPARLGVVIHAEHYNESTTNDTYILWNNHYEYVFMNAHEI
Q4LAH5_STAHJ          IDRSK-----NIGQVILENKNQARLGVVIHAEHFNHSNTNEDYILWNNNYEYMFNHVDYI
F2I914_AERUA          LDRAT-----GTGQAVFQYAPPAKIGVVIHAEHFSEGPTTNDYILWNNYYDYQFMHSEAV
A0A1H8YUD3_9LACT      IDRSA-----DIAEPIFRYHGPAKVGVIVHADHFSEPNTTDQRILWNNYYEYQFMNVEEV
G9WHE3_9LACT          IDRST-----GIGPSIMKAKGPAKVGVVIHADHFNAGSTNDDYVLWNNFYEFQFENAADT
T2F4C1_LACLC          IDRST-----DQGPEIIKCKGPAKVGSIVHAEHYNATLTTPEKILWNNFYEYSFTNVESF
V8AQD2_9LACT          IDRST-----GMGPEIIKAKGEAKVGVVIHAEHYNAPLTTEKKILWNNYYDYQFENARSI
A0A0R2H5J5_9FIRM      EDRNT-----GMESAIFKAIGDAKLGVVIHAEHYNKESTDEHNILWNNYYEYSFNHHKDV
A0A1H3YGF5_9FIRM      MDRST-----EIGQGLLMNRGGAKLGIVIHADHWNENLSDEQHILWNNYYEYDFAHAREV
R5CDS8_9FIRM          LDRST-----ELGQPVLRCSGNVPKLCVIHAEHYDGPATTETDILWNNFYEYPFDQADRF
A0A2T4TCN1_9FIRM      IDRST-----DIARGALANRGKAKVSVVVHAEHFSENNTTRDNILWNNFYEYTFRNADKI
R5ZDK7_9FIRM          IDRST-----QIGQPILMNCGKAKVGIIVHADHFSEKETNEDTILWNNYYEYDFNMSKHI
C4ZG32_AGARV          IDRTT-----GIGQAILENCGPARVGIVVHADHFSEGGTDDDYILWNNYYEYSFSQTEHI
A0A1H6USQ0_9FIRM      VDRTT-----LLGQPVFQHAKPAKIGVVIHADHYSKGSTNEQYILWNNYYDNAFRMHKYV
K0NV38_9LACO          IDRAE-----DQGQEILENRGKARVGTIVHADHFSEAETNDDTILWNNYYEYEFQHSKQI
GTFA_LACR5            LDRMDEDKQLVNGQLIFEHHLPAKLVIPVHADHYDKHYTNDHQVLWNNFYEYQFMHYQDV
E3C8W4_9LACO          LDRMNEDKQLVNGQIIFEEHQPAKLVVVVHADHYDKHYTNNQNVLWNNFYEYQFTHPEDV
Q74L36_LACJO          LDREDEDKNLINGQLVFENHGPAKLVVVVHADHFDKHYTTDQNILWNNFYEYQFQHAKYV
A0A0D4CJL6_LACMC      LDRED-GRGLVSGQLWYQMHSPARLGVVVHAEHYDEHYTNQTNILWNNYYEYQFTHADQT
                       **                         :**:*:.        :**** *:  *      

GTFA_STRGN            DFFIVATEAQKRILEQQFQHYSDKQPQ-IATIPVGSLDQLTYPK-EPRKPYSMITASRLA
A8AWV4_STRGC          DFFIVATEAQKRILEQQFQHYSDKQPK-IVTIPVGSLDQLTYPK-EPRKPFSMITASRLA
GTFA_STRPN            DFFIVSTDRQNEVLQEQFAKYTQHQPK-IVTIPVGSIDSLTDSS-QGRKPFSLITASRLA
G5K929_9STRE          DFFICSTEAQSETLRYHFKKYQGISPR-VVTIPVGSLEQLKRPA-QERNPFSLVTASRLA
F9HIS9_9STRE          DYIINSTDAQTELLKEQFAQYTDITPRDILTIPVGSLDELRYPE-GPRKPYALMTASRLA
GTFA_STRPA            NAFITSTERQKILLEEQFTQYTSLHPK-IVAIPVGSLDQLKFPE-QSRKSFSMMTGSRLA
A0A3L8GMK1_STRIN      DAFIASTEKQKTVLEQQFKKYNHMEPR-VYAIPVGSLDELKYPS-QARKPFSLLTGSRLA
GTFA_STRAG            DAFITSTETQTKTLIDQFKKYLNIEPV-VYTIPVGSLSKLQRKEWHERKAFSLLTCSRLA
Q5M5Q0_STRT2          DFFITATECQRSIMLDQFNKYTPFKPH-IVTIPVGSVDKLREPE-GERKPFSIITASRLA
U2J2C1_9STRE          DVFIVATERQKEILSQQFLIYKHQEPK-IATIPVGSIDQIKEPK-SPRIPFSVMTASRLA
Q8DYM8_STRA5          DFFITSTDKQTELLEQQFKQFTNHNPR-IITIPVGSIDNLKMPM-DNRRPYSILTASRLA
Q2FUW7_STAA8          DFFITATDIQNHMVCRQFEQYQGYRPR-VYTIPVGSIDALSYPTLS-RKPYAMISASRLA
Q4A0Y1_STAS1          DFFITATDIQNQLLAQQFEKNYHRKPK-IYTIPVGSLSTLVKPNR--RKPYSIITASRLA
Q4LAH5_STAHJ          DFFITATDAQKQLIVNQFNQYKNKNPK-VYTIPVGSLKELKYTHE--RASNSIMTASRLA
F2I914_AERUA          DFFIASTQAQKEVLDQQFAHYYGKEAK-VYAIPVGSISDLKYPQPGERQVFSLMTASRLA
A0A1H8YUD3_9LACT      DFIVCATRPQSQLLANQFWHYYQKKPL-IYTIPVGNLLTIKSNH-NTRQPYALITASRLA
G9WHE3_9LACT          DFFITATAQQKKLLAKQFDQYMHTQPR-IADIPVGSIDHLSYPT-EARRPYSLMTASRIA
T2F4C1_LACLC          DFYVTATEKQKNILAQQFNDYKKADPL-VEAIPVGSLDRLR-KK-AGRKKNGLITASRLA
V8AQD2_9LACT          DFFVTATEIQKQVLEQQFLKYGKGPIT-VYAIPVGSIDELM-VN-KKRKANTLITASRLA
A0A0R2H5J5_9FIRM      SFFLSSTKRQEETLRAQFKKYYDATPR-IETIPVGSLKELK-VG-E-RKPYHLMTASRLA
A0A1H3YGF5_9FIRM      SFFITSTKRQQEVMERQFRRYRGFVPR-IVTIPVGALPELRYSD-SRRR-HSFITASRLA
R5CDS8_9FIRM          AAFVASTEKQAQLLRAQFRKYRKSVPG-IEAIPVGSLKELRRPK-KQRRPHSLCTASRLA
A0A2T4TCN1_9FIRM      DYYICSTEVQTKLLKKHFRRYQRMHPK-VVTIPVGSVDTLLKPT-KERKRYSLMTASRLA
R5ZDK7_9FIRM          DFYVCATEAQSKLLKAQFKKYRNEEIQ-VYTIPVGSLKELKYPA-KKRKPYSLITASRLA
C4ZG32_AGARV          DFYITATDAQNELMRQQFKKYCGKEPQ-VVTIPVGSLDELKYPD-EPRKRHSLITASRLA
A0A1H6USQ0_9FIRM      DFYIVSTDEQKHTLEAQFEKYCGAHPN-IVTIPVGCLDTLRYPK-ERRKPYSMMTASRLA
K0NV38_9LACO          DFYVAATELQKELMEKQFLKYQGRKPV-VYAIPVGSLEKLHKVPFAQRKKCSLVTASRLA
GTFA_LACR5            AAYVVATDRQRDLLASQQKHFNHAKPQ-INTIPVGSLEHLVK-PKGTRKKHSLITASRLA
E3C8W4_9LACO          ASFIVATDAQKQLFAKQEQHFQHATPR-VDTIPVGNLARLVK-PSSDRKLHSLITASRLA
Q74L36_LACJO          DSFIVATNEQKKILKNQFKKYYNIEPR-IDCIPVGSLNELEH-PTQGRMKHSLITASRLA
A0A0D4CJL6_LACMC      DCFIVSTPAQKRVLAAQMKKYQHQVPQ-IAAIPVGSLTKLMPMPYEKRRRHSLITASRLA
                         : :*  *   .  :           :  **** :  :       *    . : **:*

GTFA_STRGN            TEKHIDWLVAATVQAHAQLPELTLDIYGKGSEEDKLRRRIEEAGAQDYIRLKGHADLSQI
A8AWV4_STRGC          TEKHIDWLVAATVQAHAQLPELTLDIYGKGGEEEKLRRKIEEAGAQDYIRLKGHADLSQI
GTFA_STRPN            KEKHIDWLVKAVIEAHKELPELTFDIYGSGGEDSLLREIIANHQAEDYIQLKGHAELSQI
G5K929_9STRE          SEKHIDWLILAVIEAKKVLPELTFDIYGKGSEENKLQELIKEHAAQDYIRLMGHVDLETI
F9HIS9_9STRE          SEKHIDWLIRSVVKAHAQLPQLTFDIYGTGGEELMLTKLIAELQAEDYIRLMGHHHMAEV
GTFA_STRPA            IEKHIDWLIEGVALAQKRLPELTFDIYGEGGERRKLTELLTKLHAGEFIELKGHKQLDEI
A0A3L8GMK1_STRIN      GEKHIDWLVSAVILAHDKLPGLTFDIYGEGGERSKLGELIQKGSAQNYISLKGHQDLRDI
GTFA_STRAG            SEKHIDWLINAVVEANKVIPELTFDIYGEGGERQKLQEIIAKNKANNYIRLMGHKNLSSV
Q5M5Q0_STRT2          NEKHVDWLVKAVVKAKESLPQVNFDIFGTGAEESKLKAIIEENQAQDYIHLKGHQDLIEV
U2J2C1_9STRE          TEKHIDWLIEAVVEAHEVVPDINFDIYGSGSEEAKLRQIIEEKGAKDYIQLLGHQDLSHT
Q8DYM8_STRA5          SEKHVDWLVRAVIRIREILPEVTFDIYGSGGEEEKIRNIINAANATEYIRLMGHKNLSNV
Q2FUW7_STAA8          NEKHIDWLVKAVIVAKRQVPELTFDIYGEGSEKTRLRKIIDTHRAQDYIRLLGHVKLDEI
Q4A0Y1_STAS1          TEKHVDWLVKAVLKAKASVPEITFDIYGEGGQRQLLSKLIQENHAEDYITLKGHVNLNQV
Q4LAH5_STAHJ          KEKHVDWLIESVVQAHKTRPSIKFDIYGEGAEKNNLQKLINEKEANEYIKLRGHKNLEEI
F2I914_AERUA          AEKHVDWLVEAVARAKAEIPQITFDIYGKGTKETSLRELIKELGAEDYIQLKGHQDLAQV
A0A1H8YUD3_9LACT      KEKHIDLIIEAVVQARRQIPQLRLDIYGEGGERSSLEELIKAKHGQDYIHLKGHQDLNDI
G9WHE3_9LACT          GEKHIDWAVIAVSQAHEKIPQLTFDIYGKGGEEQRINKLIQKLGASDYIHLKGHVDLTNV
T2F4C1_LACLC          GEKHIDWLIKAVVEAKKTVQDLTLDIYGRGTEESKLRQLISELEADSYITLKGQHKLDDV
V8AQD2_9LACT          SEKHLDWLIRATVQARKQIKNLSLDIYGRGGDEPILRKLIEELEASDYIHLMGQHNLKNI
A0A0R2H5J5_9FIRM      TEKNIDHLIHAVVKAHEKIPQLVFDIYGQGGEKDRLTKLITDYNANSYIRLKGHQNLDEV
A0A1H3YGF5_9FIRM      EEKHIDWLVRAAALAHGKVQDLTLDIYGKGGEEDKLTQLIRDLNAEDFIHLCGHQDLEDI
R5CDS8_9FIRM          AEKHIDLLVRAVALARRNVRDLTLDIYGKGGLEQELRELIADEKAESYIRLMGQQDMTHV
A0A2T4TCN1_9FIRM      PEKHIDWLVTAAVKAKKSVPDLTLDIYGSGKDAIELEKLIDENGAKDYIRLMGHYDLITV
R5ZDK7_9FIRM          AEKHIDWIIQAVIAAKKTIPELTLDIYGVGGEQKKCQDLINQHQANDYITLKGQQDLTEV
C4ZG32_AGARV          TEKHCDWLVEAVVKAKESVPDISLDIYGKGGDEAKLKGLIGRLGCADYVHLMGQQKLDDV
A0A1H6USQ0_9FIRM      SEKHCDYDIKACAKIHEVLPEITLDIYGEGIEKPNLRELIKDLHAESYIRLMGQHNLTDV
K0NV38_9LACO          SEKHLDWAIRAVAKAKQGLPDLTLDIYGSGSEEASLRAVINECGAGGYIRLMGHQKMDEI
GTFA_LACR5            NEKHIDWVIEATVAAHKIVSDLTLDIYGEGGERSRLQNLITKNNADSYIKLMGQHDLKDV
E3C8W4_9LACO          KEKHVDWLVKATVAARQQVPDISLDIYGQGGEYGRLQQLIKDNHAEDYIRLMGQQDLADV
Q74L36_LACJO          KEKHIDWIVNAVVAAKNSVPDLSLDIYGTGGEAGMLTNLINQNQAQDYIHIMGQRDLTKV
A0A0D4CJL6_LACMC      SEKHVDWLIKAVVQAKRAIQDVSLDIYGQGAQNTSLQRLIDELQANEYVHLKGQQNLTAI
                       **: *  : .    .     : :**:* *         :       :: : *: .:   

GTFA_STRGN            YAGYELYLTASTSEGFGLTLMEAVGSGLPLIGFDVRYGNQTFIDDGKNGYLLPVSSN-HV
A8AWV4_STRGC          YAGYELYLTASTSEGFGLTLMEAVGSGLPLIGFDVRYGNQTFIDDGKNGYLLPVSSN-HV
GTFA_STRPN            YSQYEVYLTASTSEGFGLTLMEAIGSGLPLIGFDVPYGNQTFIEDGQNGYLIPSSSD-HV
G5K929_9STRE          YPEYEAYLAGSTSEGFGLTLMEAVGSGLPIIGFDVPYGNVTFVEHEKNGLLIPKEES-DQ
F9HIS9_9STRE          YKDYAAYLSASTSEGFGLTLLEAVGSGLPLIGFDVRYGNPTFIRHGENGYLIPEARP-DD
GTFA_STRPA            YQNYELYLTASTSEGFGLTLMEAVGSGLPIIGFDVPYGNQTFVCSGENGLLIERPKG-DD
A0A3L8GMK1_STRIN      YQNYQVYLTASTSEGFGLTLMEAVGSGLPLIGLDVPYGNQTFVEDGKNGYLIPRQEP-DD
GTFA_STRAG            YKDYQVYLSGSTSEGFGLTLMEAIGSGLPIIGLDVPYGNQTFIENNLNGYLIPRETP-DN
Q5M5Q0_STRT2          YKDYELYLSGSKSEGFGLTLLEAVGSGLGMIGFDVRYGNQTFIKDNENGYLIPRFEK-DD
U2J2C1_9STRE          YMHHEVYLSGSKSEGFGLTLMEAIGSGLPLIGFDVRYGNQNFIKDEENGYLIPISEL-DT
Q8DYM8_STRA5          YQNYELYLTASKSEGFGLTLLEAIGAGLPLIGFDVRYGNQTFIKDGENGYLIPRFDM-DD
Q2FUW7_STAA8          YNDYELFLSASTSEGFGLTLMEAVGSGLGMIGLNVNYGNPTFIRDGENGYLVPFDTDEDS
Q4A0Y1_STAS1          YQDYELFLSGSTSEGFGLTLMEAIGSGLGMIGFDVNYGNPTFIKHQKNGYLIPIDLNEDK
Q4LAH5_STAHJ          YKKYQLYLSGSTSEGFGLTLMEAIGSGLGIIGFDVNYGNTTFIKDRYNGYRIPESIKNQG
F2I914_AERUA          YQKYDLYFAGSTSEGFGLTLLEAIAAGLPIIGFEVNYGNVTFVEDGSNGYLVPYQPGCYA
A0A1H8YUD3_9LACT      YQYYQAYVSASMSEGFGLTLMEAIGSGLAMIGFDVRYGNQNFIRPQENGYLLALG-D-KS
G9WHE3_9LACT          YQHYGAYLSASTSEGFGLTLLEAIGSGLPIIGFDVRYGNQTFIKDQQNGYLIPSDRS-EE
T2F4C1_LACLC          YKQYATYISASTSEGFGLTLMEAVGSGLGMVGFDVPYGNQTFIEDDKNGYLIPYI-K-NE
V8AQD2_9LACT          YKNYTTYVSTSTSEGFGLTLLEAVGSGLGMIGYDVPYGNQTFIQSEVNGLLVSYS-K-NE
A0A0R2H5J5_9FIRM      FKQYDCYISASGSEGFGLTLLEAVGSGCALIGYDVPYGNQTFIKN--NGYLVDYD-A-YD
A0A1H3YGF5_9FIRM      YCRYETYAAASTSEGFGLTLMEAVGSGLAMIGFDVPYGNVTFIEDGKNGYLIPYSRE-QR
R5CDS8_9FIRM          YAEYSGYIAASFSEGFGLSLMEATGSGLAMIGFDVPYGNPTFIANEENGYLLPFSRE-DQ
A0A2T4TCN1_9FIRM      YPKYEAYITASTSEGFGLTLLEAISAGLPMIGIDVRYGNTTFIHNEINGFLIPLQ-E-DG
R5ZDK7_9FIRM          YQNYEVYIAGSTSEGFGLTLMEAVGAGCPIIGFDVRYGNPTFIRNGKNGYCMPLPEE-TE
C4ZG32_AGARV          YKHYDAYVAASQSEGFGLTLMEAIGSGLPIVGFDVRYGNQTFIDDGQNGYKIPITDE-MD
A0A1H6USQ0_9FIRM      YEKYELYLSASTSEGFGLSLLEAVGSGLPIVGFDVPYGNPTFVDEGQNGHLYKYDEK-TS
K0NV38_9LACO          YQNYQGYLSCSTSEGFGLTLLEAVGSGLSMIGFDVRYGNPTFIHDGQNGYLLPYDRL-ET
GTFA_LACR5            YQKYETYIAGSTSEGFGLSLMEAVGSGLSMIGFDVPYGNQTFIVDQQNGYLLPYTED-WS
E3C8W4_9LACO          YVKYAAYAAASTSEGFGLSLLEAVGSGLPMIGFDVPYGNQTFIDDGQNGYRIPYEED-WS
Q74L36_LACJO          YRNYPAYIAASTSEGFGLSLLEAVGSGLAMIGFDVPYGNPTFIENEKNGMLLPYNEE-WT
A0A0D4CJL6_LACMC      YQHYAGYIAASTSEGFGLSLMEAVGSGLPMIGFDVPYGNQTFIDPDQNGYRLPYQAD-WS
                      :  :  : : * ******:*:** .:*  ::* :* *** .*:    **           

GTFA_STRGN            EDQIIAAFVEKIIALFS----QGRQQEMSQHSYQVAENYLTSRVEAAWTQLLKEVRDDSA
A8AWV4_STRGC          EDKIITAFVEKIVVLFS----QGRQQEMSQHSYRVAENYLTSRVEAAWSQLLKEVRDDSA
GTFA_STRPN            EDQIKQAYAAKICQLYQ----ENRLEAMRAYSYQIAEGFLTKEILEKWKKTVEEVLHD--
G5K929_9STRE          LDLIVSQFSEAIIAMYQ----DYQIEEWQEHSYTIAEKFLSQTVANDWKEFLKEFDNA--
F9HIS9_9STRE          IEKMTDEYAQYIVKLFT----EHTQEELSAVSYQIAESYLDEHIAQKWYQLAQSVQDKER
GTFA_STRPA            RSRIVQAFADSIYEYFT----KFKMADAQQYSYNIAENYKHEKLVERWKDFIEEMLND--
A0A3L8GMK1_STRIN      SKQMAKAFAEKIIQYFQ----DMDKEKAQEYSYSKAENFLYDHLAKLWKSFMEEMTHDNS
GTFA_STRAG            PQQISTAFAQYIVALFN----SKDICKKHEYSYRIASRFLNDKIIENWSFFLRRLLNDYT
Q5M5Q0_STRT2          EPAIVAALAEKIVAFFN----RSDLDHIHQVSYDIAKGFLTEEIEQKWLNLVREMTDHD-
U2J2C1_9STRE          DQEIVESLSTKIVQIFT----LANLDSMHRVSYEMAKDYLTDKVEAKWKQLITDLTNQNP
Q8DYM8_STRA5          EEAIVEAFKEKVLQLFQ----Q-DQKALREASYAIAEGFLTNEVEGKWYNLVKELVQDD-
Q2FUW7_STAA8          VDDVIAKLAHAIVMYFN-----NGPQTPHDISYEVAQQFMTQDIILKWETLVQEVLHD--
Q4A0Y1_STAS1          ESEIIDHLAEGIVNYFD-----NDTSRFNQASYEIAENFTQPVVVQKWNNLISEVLYD--
Q4LAH5_STAHJ          TKEIATKFAEKIDEYFVS---SNKIDQMSHESYLIADDFLLNNCKEKWLSLVNEVQDD--
F2I914_AERUA          EDYIAALTTKLLKYYRE-----ADRQAMQEASYQRAQDFLDEKIIAAWRKLLEEVQS---
A0A1H8YUD3_9LACT      RPYFIDQLSQAIIQLFS----VD-LPQMQARSYQLAEEFTLERVAGMWQDLIKEVIHA--
G9WHE3_9LACT          LHFNLDEMSDKIVQLFT----KDDLKAFQQQSYDIAENFLTTKVEKKWQQLLEAIHD---
T2F4C1_LACLC          DEINIKELSNAIVKIQEKEMGNGGLAQVQKASYEIAEPFLTTQIRKKWLALEKEVCHD--
V8AQD2_9LACT          ISKNISAIAEAIVKHQKQ--SQTALEKVREASYHIARPFLTSHIQKKWAQLEAEVTHA--
A0A0R2H5J5_9FIRM      THACISSLSEAIVKYYEE-----DHPDFHQASYDIAKEYLDEEIAKKWKNLLEDQL----
A0A1H3YGF5_9FIRM      IQERIDALADRMMRVCNG----DEAERFAEESYRIAGRYLQTRIEGDWADLLGEECDDTA
R5CDS8_9FIRM          VDARVQALARAIIRLFTE----ADLEAFHQKSYAIASEFLEEKVALRWKKLFEKLAAEGE
A0A2T4TCN1_9FIRM      NNEMIDGLAKAMVRLFTE----VDIKTFSRASYMFAKPYMTEELVDTWRRFLVDACGENV
R5ZDK7_9FIRM          --DRILALQHGIEKCFSQ----D-LKSFHEVSYQVAEDFLTRKVEKRWKKVVM-------
C4ZG32_AGARV          QKEKIKLLSERIVRMFTE----DDMDAFSGHSYEKAKEYLTKEVVHRWIELLK-------
A0A1H6USQ0_9FIRM      EADKVQALSDMILKYFTE----DQKEEFHKHSYEVASTFLEEEVRDQWIRLFQ-------
K0NV38_9LACO          VNQHIDLMASAIGKLFN-----SDLPSFSEASYQVAEKYKSKKVAKLWKKAIESELCHD-
GTFA_LACR5            NSRKEQLLADAIVKNFT---EAD-LTSFHEKSYSLAESYLTKNVAKQWQQLIGELQHA--
E3C8W4_9LACO          DEQKVARLRDAMVKLFT---EAD-LAAYSQHSYEVAEPYLTDNVAQRWGKVLEELAND--
Q74L36_LACJO          DFRKEEVLTKAIIEMFT---KSD-VDSFNKKSYQIAEPYLTANVAKQWKKLVGGIGQ---
A0A0D4CJL6_LACMC      EERKVRELANAIVSLFS---DDQRAAGFSQHSYELAQPYLDEKIAQKWRVLVNEVAK---
                                 :                   **  *  :        *            

GTFA_STRGN            L-----------------------------------
A8AWV4_STRGC          L-----------------------------------
GTFA_STRPN            ------------------------------------
G5K929_9STRE          ------------------------------------
F9HIS9_9STRE          VK----------------------------------
GTFA_STRPA            ------------------------------------
A0A3L8GMK1_STRIN      I-----------------------------------
GTFA_STRAG            I-----------------------------------
Q5M5Q0_STRT2          ------------------------------------
U2J2C1_9STRE          ASQEKNQTAEQAPVQVRDQSTDANLTNDNDKELSHD
Q8DYM8_STRA5          ------------------------------------
Q2FUW7_STAA8          ------------------------------------
Q4A0Y1_STAS1          ------------------------------------
Q4LAH5_STAHJ          ------------------------------------
F2I914_AERUA          ------------------------------------
A0A1H8YUD3_9LACT      ------------------------------------
G9WHE3_9LACT          ------------------------------------
T2F4C1_LACLC          ------------------------------------
V8AQD2_9LACT          ------------------------------------
A0A0R2H5J5_9FIRM      ------------------------------------
A0A1H3YGF5_9FIRM      DR----------------------------------
R5CDS8_9FIRM          NRPDSSRG----------------------------
A0A2T4TCN1_9FIRM      FKKEAEQ-----------------------------
R5ZDK7_9FIRM          ------------------------------------
C4ZG32_AGARV          ------------------------------------
A0A1H6USQ0_9FIRM      ------------------------------------
K0NV38_9LACO          ------------------------------------
GTFA_LACR5            ------------------------------------
E3C8W4_9LACO          ------------------------------------
Q74L36_LACJO          ------------------------------------
A0A0D4CJL6_LACMC      ------------------------------------