CLUSTAL format seed alignment for MF_01473

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

F8HXU6_WEIKK      ------------MKINIFDYYDGKTQRLLNSLRTAGISRN-NLFVHYAGDLPENAISPFS
R5C9V4_9FIRM      -------------MVFLMDHPSREAALLYGSLKKAGYSFR-TVAFEDDGFLPEGVESPYR
Q74L35_LACJO      -------------MINLFENLDVESTDFLRSQLFANLKIP-SVVINDDGFLPIEVDSPFK
Q4LAH4_STAHJ      -------------MINIYEKFDDKTILLYRSFENSSINNI-NIVLEDDGFLPFNIFSPYR
C4ZG31_AGARV      MDRAVEVTHTADGITLLFDTFSGESKNLLESFKNAGAAFH-AAAIEDDGFLPDDVMSVYG
R5Z4P3_9FIRM      ----MEKSSHVDKNVLLLDGFDEDSQMLAESIRASGFDGC-ILTLSDTGFLPEGIESIYT
R7R9C3_9FIRM      ----MEELDLKNNAMILFDSYLEDGRKLLESLRKIGVDCP-AAAIDDDGFLPDGVESVYG
F2I915_AERUA      -------------MINLFENYNEASRDLHHSLIQAGYQWP-TIVLKDEGFLPQEVQSPYQ
T0TYR9_9STRE      -------------------------------MKESGFDHP-TVVLEPNGFLPDGVESPFI
A8AWV5_STRGC      -------------MIQLFDYYNQETQDLHDSLLAAGYDCP-TIVIEANGFLPDEMISPYT
T0UYH5_9STRE      -------------MIFLCDNYHQASKDLAYTLQVAGCDAT-TVVINPDGFLPKGTLSPFT
S5QZV0_9STRE      -------------MILLLENITLKGLDLYYTLQQSHLTVQ-PIVLNDDGNLPTDFTSPYQ
GTFB_STRAG        -------------MIILFDFFDKKSKDLYYSLITSGLHGN-AVVINDDGFLPQNINSPYS
GTFB_STRPA        -------------MIRLFEWLTQESLDLHYSLEESGIHGT-SIVLNDDGFLPEGIISPYT
G9WHE2_9LACT      -------------MINLFDNFNQASQDLYASLQLSGFHQP-TIVINDNGFLPDQVQSPYA
Q8DYM9_STRA5      -------------MINLFDSYTQSSWDLHFSLIKSGYINP-TIALNDDGFLPDDVTSPYL
Q5M5P9_STRT2      -------------MINLFEYYSQGSWDLHYSLIVAGYVNT-TVCLSDNGFLPSDVTSPYL
T0UYY0_9STRE      -------------MINLFESYSQGSWDLHYSLIVAGYANT-TVCLSDDGFLPSDVTSPYL
Q4A0Y0_STAS1      -------------MINLFDVFDKKAIILYKSFKHAGKQRK-TIVIEENGFLPDDILTPYA
B9DJS3_STACT      -------------MINLFERFNQPTETLYFSMMEAGLDHL-TVVLNDDGFLPEAVTSPYR
Q2FUW8_STAA8      -------------MIKLFDYFNDHSRKLYESFKASKLEEDLTIVLNDNGFLPDDVISPYQ
Q4L9N3_STAHJ      --------MMRCYMINLFEIFDEASQKLQQSLQFAGFKHE-TIVMDDDGFLPDNVMTPYQ
                                                              .   * **    : : 

F8HXU6_WEIKK      FFMEIDHQ-K---REGLFFDQVEVPEFYDIRHVNGSNANIENMGHVVGSVNYSK--KGYR
R5C9V4_9FIRM      ELCGRKREET---AVPRYFSRLQVPDGWEIRS-TGTEGNIWDYDTKRAQLVYAHP-ASRR
Q74L35_LACJO      FYCGFGDE-----NTPLYFNRLKVPEFHRIVA-TASKGEVYDLYEKRADIFFLAT-DNTR
Q4LAH4_STAHJ      YFTKEKKE-R---FKPLYFNEVPVPEYWEIKG-DNKSAKIMDKGKIRGKIIYKKNIGQSR
C4ZG31_AGARV      FFLGDYREADSLPGKPLYFNQIQIPDYWRIEG-DNSSAKVMDRTRERARIFFTEP-THRR
R5Z4P3_9FIRM      VFCGKKEG-----GKPRYFNQIDVPDYWEIKS-SNTVGQIFDRNHERGKIFYTKP-THKR
R7R9C3_9FIRM      SFLGEYEKSEEIPGRPRYFNEVKVPDYWEISG-NNNSGQIHDLYRLRGKIFYTEP-AHKR
F2I915_AERUA      FFMGEEDK-S---AKALYFNELPMDPFWEISG-DNSKAQVKDLGQLKAQIYYADP-KEQR
T0TYR9_9STRE      YFLGQAKG-E---KRGRYFNEVPVPDFWEVSG-DNSSGRVTYYGQEKARIVYHAA-SYKR
A8AWV5_STRGC      YFLGDEEG-V---DHPLFFNQVPVPPFWEITG-DHQSARVSDMGEERARIHYASQ-AKGR
T0UYH5_9STRE      YYVEDQDE-T---GKPRFFNQVPVPAFWEISG-NNQVAQVSNLTEERARITFPEG-SKAR
S5QZV0_9STRE      FFCGTADE-E---GDYLYFNQLPVPKFWQITG-TNTQAEIWDMSDLRGRIFYHTE-MHNR
GTFB_STRAG        FFCNMEGK-N---GNPLYFNQVPLPDLWEIKG-NNIEAEIWDFSIKRAKIFYQEP-KYKR
GTFB_STRPA        FFCEVEMD-----GSPLYFNQLEVPYLWQITG-TNIEGEIWNRSSKRGVIHYHEP-KYLR
G9WHE2_9LACT      FFSTGNHDLQ---GKPKSFYEIPIPKFWEIRA-DGNAADIFDDGVKRGHMTYYLPLANHR
Q8DYM9_STRA5      YYTGFAKTGA---GRPLYYNELRVPDTWEIIG-FSSGADIVDLGVKKGRIIYANP-NHKR
Q5M5P9_STRT2      FFTGFDKV-Q---GSALYFNQVPVPDYWEILG-TNSNAEIFRFDKKRGHIHYAHP-AHQR
T0UYY0_9STRE      YFTGFDKV-Q---GSALYFNQVPVPDYWEILG-TNSNAEIFRFDKKRGHIHYAHP-EHQR
Q4A0Y0_STAS1      FFANNPET-T---SQPLFFNEVPIPRFWTIEG-NNNTAFIKNLDEVKARIIYKAN-YKHR
B9DJS3_STACT      FFAENEIKDN---DHALYFNEIEVPRFWNIEG-DNNQAVIKDMGQVRGKIHYQPN-YKQR
Q2FUW8_STAA8      FFADNHNTEN---MKPRFFNQVTVPAFWEIKG-NNNSATINDMGRLRGKIFYQSG-ERPR
Q4L9N3_STAHJ      FFANYKRNDD---DKPAFFNEVQVPPLWEIKG-NYNHAEIIDNGNVRGRIFYREY-FKNR
                                    :  : :     :       . :       . : :       *

F8HXU6_WEIKK      LVDTVDWYLNGDPKKIIKKDFYNISGKHYATSFFSE--GKPYLTEYY-KDGE-AVVIENL
R5C9V4_9FIRM      FLQTVNWL--DSAGKNIWQDHYDDSGELYARTTCDAE-GRPVLKTSYAASGE-ECIVENL
Q74L35_LACJO      LIKEVHWL--DKNGNLSWIDHYNRQGKLFAKTYVN-N-GQQVLKRYFNKDGK-EVITQYL
Q4LAH4_STAHJ      IVDKVEWL--SEDGQLKYVDFYNQQGFRFAQLLYDEF-KMKILKRYFDKENN-VVIVENF
C4ZG31_AGARV      QVKIVDWL--DDAGQVRLSEHYNRYGAIFCHTVFNKK-GQKALRKFFDVTGR-EMIVENF
R5Z4P3_9FIRM      LVHIVDWY--DEEHIVRCSDHYNRYGFMYARTVFNHK-GQLVSRSYFDAEGK-EKVSENY
R7R9C3_9FIRM      LVKVVDWY--DERGTVRSCDHYNKYGALYARTIFNAR-GQKVNKSYFDAKGR-EIIVENY
F2I915_AERUA      LINKVDWL--DEQGRVAFVDLYNQFGRHFSRIAFDMA-GGMSMQTYYDTMGR-EVIVHNL
T0TYR9_9STRE      IVERLEWL--DDKGQVFMIERFDQYGRKIAVTTCGDQ-GQHLVTTYF--EGDIERLTENH
A8AWV5_STRGC      LVKQVDWL--DKKGQLRLSECYNKQGRCFAKTAYKSA-QEAFNTTYYSKDGQ-ERIVENH
T0UYH5_9STRE      IVKSVEWL--DKSGKVRQVDHYNKYGFCFAKTTHDEN-GQPVFTSYQTKEGD-ERILENH
S5QZV0_9STRE      YIKTVDWL--DKKGKARLCDHYNRFGRRFAQTTLDED-EKPIIKRYFNNNGQ-EVILENV
GTFB_STRAG        QVKNIDWF--DNNKKVRYTDHYNRFGWCFARTHFDKN-QNVTTKSYFDKDGK-EVIVENF
GTFB_STRPA        FVQSVDWL--YPDGSIYMTDHYNKYGWAFARTYFFSD-QQVSHKKYYTKSGQ-EVLSENI
G9WHE2_9LACT      IVSEVAWF--NRQGKTQSIDHYDRFGRRFAETTCDEN-GHWFATSYFSLSGT-ETIIENH
Q8DYM9_STRA5      LIKEVDWF--DEQGRVILKDRFNKFGFCFAQTFYNAD-GQAIQTSYYNKDRQ-EVISENH
Q5M5P9_STRT2      LVKAVDWY--DESGRLRVTDHYNNKGYRFSQTTYNIK-QEATITSYFTPDNK-EVIVVNH
T0UYY0_9STRE      LVNAVDWY--DESGRLRVTDRYNNKGYRFSQTTYNVK-QEATITSYFTPDNK-EVIVVNH
Q4A0Y0_STAS1      IVERVEWL--NKRGHTQYIDYYNKVGKRYAQVVLDANSQKSILKRYFNYNNE-VMMVENF
B9DJS3_STACT      IVSSVEWL--DPQGFVRYRDHYDQFGICFAQTTYDLR-GVAIFKEYFTREGE-PLIYVNY
Q2FUW8_STAA8      IVSRVEWF--DDQQRVRFVDYYSKNGIKFAQTVYDLN-RKAILKKYMTAEGK-EVIYENF
Q4L9N3_STAHJ      IVSFVEWF--DTKDRLRSVDFYNKDGFKFAETVYDLN-KKPILKTYVDRQGK-EVLYENF
                   :  : *            : :.  *   .                         :    

F8HXU6_WEIKK      VTHKIQLIIKER-----KIIFNNLTEFFIFFLEKAEINPDDIFINSLNYPLFIAKIVAVK
R5C9V4_9FIRM      QNHTMLLREKKEDGTLTSRLFPGKVELVLYYLEKTKADCDRIFFNSLSYPLFAQRRLRME
Q74L35_LACJO      VSGDIFLHEENN-----ERYFANLAQFVTYYLRKKKYQLDHIFYNTLNQSMMVSLGLQN-
Q4LAH4_STAHJ      VTKDIILNYNDK-----NLFFNNKKEFYSYYLSQLEVPKNHILINSLSYPFLTTYSFKEE
C4ZG31_AGARV      VTGDILVRWQDK-----DWIFRSKTDFIAFFIRCAGLEDTAVYFNSLSYPFFASQALAPN
R5Z4P3_9FIRM      VTHTILVNEGKK-----LHIFKEKVDFIKYVFDAMGIEPNRIFYNSLSTPFFVSEALPDQ
R7R9C3_9FIRM      VTRHITLNEGSM-----VKIFRNKTDFVIYYMKVNGLESRNLLFNSLSVPFFVSERLDKT
F2I915_AERUA      VTAAVSLAYQDK-----NYFFKDLIDFFCFYLKASGLDLSELLMNSLGLPFLVSHRLNL-
T0TYR9_9STRE      QTGDLILTLDHQ----PMRIFKNRLDYFVFYLEYRGFDLDGLVYNTLATSFSISLQLGNK
A8AWV5_STRGC      ATGDIILTLDQE----PLRIFKSRVDFIRFFLERLDFDLDHILFNSLAYSFLVSHSLTGR
T0UYH5_9STRE      ATGDILLTLPGQ----SLRRFSNRTEFVKAFLAQVFGDIDHIIFNSLATPFIVSWTMENT
S5QZV0_9STRE      KTGTLLLMWQEK-----THLFDRKIDFFYFYLVAAGLSGTSIWFNSLSIPLLISYYYEK-
GTFB_STRAG        RTGVIILNWLNK-----DYFFDNRVAFLNFYFSLMGWNLSRIWYNSLSTPFFVSYRMTY-
GTFB_STRPA        LTGDILLNWKGK-----VYHFTKKVDFFLFYFKKSGLDLSSIWYNSLGMPFLISYYLGG-
G9WHE2_9LACT      QTGDIILNYHAQ-----VYSFPSKTDFVLFYLKEAHYKLDRIFYNSLSTPMLLSYSLKT-
Q8DYM9_STRA5      MTGDYILNDNNQ-----FKVFKSKVEFVINYLQEAKFNLDRIFYNSLSTPFLVSFYLNRL
Q5M5P9_STRT2      LTKDVILNWKDK-----VYIFKNKSEFVVFYLKEAGYDLRRILYNSLSTPFLTAMNLPN-
T0UYY0_9STRE      LTKDVILNWKEK-----VYIFKNKSEFVVFYFQEAGYDLSRILYNSLSTPFLTTMNLPN-
Q4A0Y0_STAS1      VTNDIMLTWKNK-----AYFFHSKIQFVNFYLEVAQLESENFMINSLSISSAVLNGLSEY
B9DJS3_STACT      TTSNYVLTWHGK-----DYFFETEVDFIVFYLEVMGIDLDSFVINHLGTPLSVVYNLNTE
Q2FUW8_STAA8      VTSDVILDWQGK-----SYFFPSKLAFALFFIKQLEITEHHFVINSLALPFSVLYNLPSK
Q4L9N3_STAHJ      VTKDIILDWQGQ-----SHFFASKQDFISFYLDQIDVDTSTVFINSLATPFFVLYQSNHM
                   .    :             *          :         .  * *  .          

F8HXU6_WEIKK      P----------------NTTLFWQEALGEKI--PGNMESELNSP-----KALKQIIFNNE
R5C9V4_9FIRM      KRTPHPEKNDLAEVPFGGDVLFWQEEIGERL--PGNMVTVLNDP-----QGVNGIAVQSL
Q74L35_LACJO      D---------------GSDTLFWHEKITNDL--PGNMKYLMDNS-----TRTKHIVFQNY
Q4LAH4_STAHJ      I---------------VNYKIVWQENIKDSI--PDNMKVALKHI------KNVEILVPNQ
C4ZG31_AGARV      G---------------FRDALFWHEPVGDEI--PGNMQIILHDQ----GTRAKRVFVSRR
R5Z4P3_9FIRM      G---------------KGDVLFWQEDVRPDI--PGNMQIILNGQ----STRTKTIYVQKK
R7R9C3_9FIRM      D---------------GQDILFWQEPVGSEI--PGNMQIILQDR----SNRTRHIFVQKS
F2I915_AERUA      E---------------GEDILFWQEPITDEI--PGNMQLIFNGG----TGRAKRVITDDL
T0TYR9_9STRE      GIK-------------GRDVLVWREPLHDSL--PGNMQLILKSP----EIRTKKILIPQN
A8AWV5_STRGC      A---------------GQDILFWQEPLYDEL--PGNMQLILDNS----QLRAQTIVIPDL
T0UYH5_9STRE      G---------------ATDILVWQEPLRDIL--PGNMNGILEDN----SARANAIIIPDK
S5QZV0_9STRE      A---------------GTDVLFYQEEMGADI--PGNLRLVLEGR----GKRVKHVVVQDK
GTFB_STRAG        P---------------GEDILFWQEDIEDTI--PANMRVLLEST----NTRTQKVIVQKK
GTFB_STRPA        E---------------GRDILFWQENLADQL--PGNMQIIFSGR----TSRTKKVIVQDR
G9WHE2_9LACT      P---------------GNDVLFWDEALGEQI--PGNMQVILNDD----QQRTKQIIFQNQ
Q8DYM9_STRA5      E---------------SKDVLFWQEPLVDDI--PGNMRLLLNNP-----SPNTKIVIQSY
Q5M5P9_STRT2      T---------------GQDVLFWQEPITDTV--PGNMRLLLDSN-----HRQTKIVVQEY
T0UYY0_9STRE      S---------------GQDVLFWQEPITDTV--PGNMRLLLDSN-----HRQTKIVVQDY
Q4A0Y0_STAS1      ----------------GNDSIFWQGDITPEI--MKHMENALAKE-----KRNFKIILPSP
B9DJS3_STACT      ----------------GHDYVVWQEHIDVNTALPGNMQLILNEKGINRSLRDFTLIVPDR
Q2FUW8_STAA8      ----------------GSDVLVWQEHCNGNV--PGNMQLMCKGD----MKRHCNIIIPDK
Q4L9N3_STAHJ      ----------------LNAVLFWQEQSHSNV--PGNMKLLLDKE-----TLNSKVIIPDS
                                      :.:            ::                 :     

F8HXU6_WEIKK      DHLKQAESQYVST-----KVN-----------LNYLSDIGEFTRKNTFIKKAFILTNSDR
R5C9V4_9FIRM      GVYEKIQAQIREHA----AENGIVNAERAAKIIAPVGQIYSFSGTVKKEKTICILTNSDA
Q74L35_LACJO      VDWQTWKNKLPNDK----NVD-----------FRFLGMIYPHPRGNKMRPEAVILTNSDQ
Q4LAH4_STAHJ      EEYHKIVSVVENND----KEK-----------ITKSGYVYNFKKDNHFKKNIFILTNSDD
C4ZG31_AGARV      ESYDRLIALGAP------SDK-----------VKQLGYIYSFVRENKHRPHILVCTNSEN
R5Z4P3_9FIRM      ASYEKLIELGAS------SEV-----------VKPLGFVYSFKKENQHSNRLLICTNSDQ
R7R9C3_9FIRM      DAYEKLLALGAP------SEK-----------LHKLGFIYQYERKNTFGKDVLICTNSEN
F2I915_AERUA      GNYERLHQLMDAQGISSIDDK-----------LDHLGYIYPLEQPMSPANEALILTNTDQ
T0TYR9_9STRE      ATYHRALQLTSQDQ----HSY-----------FGPLGYLYDFKVKDDIRKDAFVLTNSDQ
A8AWV5_STRGC      ATYEKAMSLAATDQ----QQK-----------FLHLGYHYDFKRDNYLRKDALILTHSDQ
T0UYH5_9STRE      ATYEKALTLVPKEK----HHK-----------LLSLGYAYDFKENHGKSHNAFIATNSDQ
S5QZV0_9STRE      RTYNRLCELLPEEY----HER-----------LSYLGYLYPVRRQNQNRKEALILTNSDQ
GTFB_STRAG        NTYHKIKSMLPKEQ----QEK-----------IGYLGFIYPNKKNNKGRKDIFILTNSDQ
GTFB_STRPA        SVYKKLLHLVEEKN----KEM-----------ISFLNIIYPKLRENYSRKEILIVTNSDQ
G9WHE2_9LACT      ADFEQMMSSYQGEG----LNK-----------IHYLSFLFQYLRENTGKANALILTNSDQ
Q8DYM9_STRA5      EAYANAMRLLTDEE----QKQ-----------VSFLGFMYPLKETEKLHNQALILTNSDQ
Q5M5P9_STRT2      TAYTNLLKLISSEQ----ASR-----------VAFLGFMYPFARQNNFQNQALILTNSDQ
T0UYY0_9STRE      TAYTNLLKLINPQQ----ASH-----------VAFLGFMYPFARQNHFQNHALILTNSDQ
Q4A0Y0_STAS1      SAYEKVIELIDEQY----KNR-----------IFQSGYVYRFVKENRHSNQVLTLTNSDQ
B9DJS3_STACT      HEYDEIVGKVDKDA----KQK-----------VELGGYIYPFTRRNQFTPHILTMTNSDQ
Q2FUW8_STAA8      NEYETMLNIADAKV----QSR-----------ILQGGYLYNYRSRNRYTKEIVILTNSDQ
Q4L9N3_STAHJ      AEFEAITSNVEAQY----RPF-----------ISQLGYLYDYQKPNNYNKQVLNLTNSDD
                                                  .   .                  *::: 

F8HXU6_WEIKK      LYGLEDILNTFNELDITVAAYTNMSTKLEHLGDKYNNLHLIPSLAPKKLAAEMNKADIYL
R5C9V4_9FIRM      VEHLAELADALPEFVFHVGALTEMSAKLMAMQ-KKPNVRLYPGMSEKLGEKLLEENEFYL
Q74L35_LACJO      IEHLDEVVQAMPNIHFNIAAITEMSSKLLAFK-KYNNVRLYPNATTKQIQELYQTSDIYL
Q4LAH4_STAHJ      IPFLSEIVDHNPEFNFKVAALTEMSSKLMGLD-TKKNIKLYPKISNSAVSDLLKESDIYL
C4ZG31_AGARV      VGHLTELASLMPQMHFHVAAITEMSSKLMSAG-QYDNVSLYPNVKMSVLDSLFEKCDFYL
R5Z4P3_9FIRM      IEKLPEMVMALPNMEFHICALTEMSSKLNAFE-SYANVHLYPGAKESEIEALFMRCDYYL
R7R9C3_9FIRM      VAHAHQITKALPQLHFHIAAITEMSTKLLTVG-AYDNVTMYPCVKTSILDELFHKCDLYL
F2I915_AERUA      VESLEYIVKMLPEWEFHVGAITEMSDKLMNLD-SYDNLHLYPNISKDRVAELFKRCNCYL
T0TYR9_9STRE      IEALTYLVENLPNVTFRVAALTEMSASLLSMV-RYPNVVLYQNISQERIKELLKVSSIYL
A8AWV5_STRGC      IEGLEVLVQALPQLVFRIAALTEMSPKLLSML-SYKNVVLYQNASLKLIEQLYLESDIYL
T0UYH5_9STRE      IEHLEALVEALPDVTFQIAAVTEMSAKLLSMM-RYSNVVLHPNASHKQLDKLYQESNLYL
S5QZV0_9STRE      IEALELLVTNLPEIHFHIGALTTMSSKLTAFE-ASSNVSLYPNINATLAEQLYGHCDLYL
GTFB_STRAG        IEHLEVLVHHLSDYHFHIAAYTEMSFKLMSFS-QEQNVTLYPNISRTDLDNLFEICDIYF
GTFB_STRPA        IEGIETLTDNLSAYTFHIGALTSMSDKLQNIG-QKENVLLYPNMSPKTMLDLLEQCDIYL
G9WHE2_9LACT      IEQLETLVRALPGMHFSIAALTEMSSKLMAFA-DFDNVDLYPNVPAPLISKLWADNDFYL
Q8DYM9_STRA5      IEALESLVTSLPNLTFNIGALTEMSSDLMNFG-KYDNVVLYPNITTNQIQYLSNICAFYL
Q5M5P9_STRT2      IEHLESIVSEVPTMHYHIGAITEMSSRLMDLA-KYSNVSLYPNITTEQVKRLYQQADFYL
T0UYY0_9STRE      VEHLESIVSEVPTMHYHVGAITEMSSRLMDLA-KYSNVSLYPNITTEQVKRLYQEADFYL
Q4A0Y0_STAS1      IPHLEEIVQAHPNLEFHVAALTEMSMKLLSLN-KYDNVNLYPNAKRQKFISLYKSCDIYL
B9DJS3_STACT      IENLEELVKLSPHLKFHIGALTEMSSKLMAME-RYENVKLYPSIERETVKKLYDECDIYL
Q2FUW8_STAA8      LRNIKVLVETLPDFKFHIAAITEMSDKLMQLD-QYANVHLYPSINIDRVNELYQLCDIYL
Q4L9N3_STAHJ      LPNLEEIIRQCEDYEFHIGAITEMSAKLMSLG-KYDNVKLYPTITQAKIDQLFQTCDVYL
                  :     :          : * * **  *        *: :                  *:

F8HXU6_WEIKK      DINDGMKVDNVLKKAYRQNMIILSMDQVKSSNYKSL-----NFYD---VRSLCND-----
R5C9V4_9FIRM      DINHGNEILDAAWNAYLRRMVIFAFRETAHERAYAA---EENILPSACWAQMAEQ-----
Q74L35_LACJO      DINHGNEILDAVRGAFEQNMLILGFENTLHNSQFIS---SENVFKPNEVDKMADK-----
Q4LAH4_STAHJ      DINKGNEVLNIIERAFSYQLLIFAFKETAHNSVWID---DSNIFEINNYKALISK-----
C4ZG31_AGARV      DINHEGEIVDAVHRAFLNNMLIVGYEETMHNAYYTA---DTNTFKESEYADMAEA-----
R5Z4P3_9FIRM      DINHQDEIVDATKQAFLHNCLILGFNETIHNRKYVL---DEMIVDAKNYSLLVEK-----
R7R9C3_9FIRM      DINHEGEIVSAVSRAFLNDQLIYAFKETLHNTVYVA---KEHIYAEDNVKELIAQ-----
F2I915_AERUA      DINYSIEIYNAVRQAFNHSQMILGFNETLHQPRYIA---PGHRFSAKHSVNLVGL-----
T0TYR9_9STRE      DINHYAEVQGIVRKAFEHQQVILAFSHTLHDRHFLA---QANIFDQGKEADMVAR-----
A8AWV5_STRGC      DINHGGQVLQAVRKAFENNLLILGFEQTLHDRRYIA---REHIIDSSQPAQLAST-----
T0UYH5_9STRE      DINHHNELYKATRTAFEHQLLILAFSETVHGRDYTA---PEHIYAGQDYQAMVTK-----
S5QZV0_9STRE      DLNHGNEILSAVRRAYEENQLILAFDNTAHQPSLLA--ANGQIFSHEHPEEMLAL-----
GTFB_STRAG        DINHGNEVDDVIRRAFEYNHLIFAFDNTCHNRELVL---DSNIISHTTCEQLINL-----
GTFB_STRPA        DINHGNEVLSIVRLAFERSLLILAYDNTVHSPIFHH---ESGIFNHSKPQTLSDW-----
G9WHE2_9LACT      DINHGNEILSAVRKAFLHQQLILSFQNTYHAADYVS---PDLIYDAGNGDAMIKE-----
Q8DYM9_STRA5      DINHHNEILSAVRSAFEHQQLIFAFEETSHQIRFVS---PKNIFPKKDIFTFISH-----
Q5M5P9_STRT2      DINRQNEILSATRAAFENNLLILAFTNTSHGPDYTA---PSNIFSPMNAGQFKQT-----
T0UYY0_9STRE      DINHQNEILSATRAAFENNMLILAFTNTSHGSEYTA---PSNIFSPMDAGHFKQT-----
Q4A0Y0_STAS1      DINKGNEILDAVRAAFDYNLVILGYNETSHNKDVTP---ENNLFEEVQFEILSSI-----
B9DJS3_STACT      DINSGNEILDAVRRAFLADMLIFAYAETAHNLKYVLDGEDGDVFRTADYRELMHK-----
Q2FUW8_STAA8      DINEGNEILNAVEQAFDYELLILGYRQTAHHAKVTL---SEHLFEHNDEITMESKDQLIQ
Q4L9N3_STAHJ      DINKGGEIVNAIERAMLHNQLILAYDETAHRRSFIA---KKNITKQDEPQQLIDI-----
                  *:*   ::      *     :* .   .                       :        

F8HXU6_WEIKK      LASIMSSENTWRSSLNKMIQQNGPSSKVSDYKQFLSIKN-----
R5C9V4_9FIRM      IRRAAEHSQEKDRLLYRQDVRAMRRNA-EDYRRLLGG-------
Q74L35_LACJO      ISDALSDTNNMRELIDEQRLLAGDVSV-EQYKEVIGDLRNE---
Q4LAH4_STAHJ      INKL-NNLNGFKLLLEKQLSHADIIDK-EEFVKLLN--------
C4ZG31_AGARV      LNLTLAMPHLIDEALAMQKKAAVAADA-TDYMEILHL-------
R5Z4P3_9FIRM      IMDA----SHLDLYIKKQKALAMAQNV-VDYKNI----------
R7R9C3_9FIRM      LQRVTQDAAYMEQELDVQKAWALAETE-EHFKEIIENTELLW--
F2I915_AERUA      MQTLAQDQEERDRALAVQLSYAGQTTV-ADYQRVLG--------
T0TYR9_9STRE      IQEIYQSVDNYREAVAQQIAQSSSVEP-AVFKARLQEGIGGHSE
A8AWV5_STRGC      LEEALSGVEQMRSALQAQGRHANDVPV-SLYQETLQSVLGGQHD
T0UYH5_9STRE      INQVLEQDQAMQEAMQAQKAQANTLTA-SDLTNRLQGLLGGNHV
S5QZV0_9STRE      LKNV----EDYASLIVKQRKQSQEDSI-ENIRQVLEKWRIN---
GTFB_STRAG        MKNLSGSIMYL---LEQQREQTSNETK-ERYKEILGGYGNA---
GTFB_STRPA        LLNL----DDYSQTVSCWRSDLFPMTY-RDYKQVLVSNVD----
G9WHE2_9LACT      LQSLTADPDKLRIALAQQKHHLSTSTS-DDYRHMLN--------
Q8DYM9_STRA5      LQPLIGNKCNIEKALKQQLEDCHVSSS-TQYQSVIN--------
Q5M5P9_STRT2      LKEALGNRDFLSHLLDRQREHAHVATP-EDYKKVIG--------
T0UYY0_9STRE      LHEALGNHEFFRHLLDRQREHARVATP-EDYQKVIG--------
Q4A0Y0_STAS1      LRDIVAEPSHLDQRLRQQWQQASSISK-AEFIRSLAQ-------
B9DJS3_STACT      LHQTVDNHEKWRDLLKRQKQQANAVDV-GAFRRLFE--------
Q2FUW8_STAA8      MLESLKDQQQFRDALLAQKAHAHEISR-EQFEQVFKQALES---
Q4L9N3_STAHJ      LNEIANEPSVFKERVIAQQEQNNRIEE-TTFKNVITNALNH---
                  :             :