CLUSTAL format seed alignment for MF_01481

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

A0A3Q7HFK3_SOLLC      ------------------------------------------------------------
F6HIG7_VITVI          ------------------------------------------------------------
PB27A_ARATH           ------------------------------------------------------------
I1H5S8_BRADI          ------------------------------------------------------------
A9NTN0_PICSI          ------------------------------------------------------------
D8QT53_SELML          ------------------------------------------------------------
B8ANZ0_ORYSI          ------------------------------------------------------------
C1FGV0_MICCC          ------------------------------------------------------------
K8E9D7_9CHLO          ------------------------------------------------------------
E1ZQ67_CHLVA          ------------------------------------------------------------
D8UBY6_VOLCA          ------------------------------------------------------------
PSB27_THEEB           ------------------------------------------------------------
B8HY22_CYAP4          ------------------------------------------------------------
Q3MFN4_TRIV2          ------------------------------------------------------------
K9UBN6_CHAP6          ------------------------------------------------------------
B0CF06_ACAM1          ------------------------------------------------------------
K9YDL6_HALP7          ------------------------------------------------------------
K9EY09_9CYAN          ------------------------------------------------------------
I4IE80_9CHRO          ------------------------------------------------------------
PSB27_SYNY3           ------------------------------------------------------------
K9Z723_CYAAP          ------------------------------------------------------------
B1XKN5_SYNP2          ------------------------------------------------------------
Q46GR8_PROMT          ------------------------------------------------------------
Q7VD76_PROMA          ------------------------------------------------------------
A2BVG9_PROM5          ------------------------------------------------------------
Q7TUU3_PROMM          ------------------------------------------------------------
A5GSC2_SYNR3          ------------------------------------------------------------
A3YZG3_9SYNE          ------------------------------------------------------------
W0GSK8_9SYNE          ------------------------------------------------------------
K9SIE1_9CYAN          ------------------------------------------------------------
K9SU81_9SYNE          ------------------------------------------------------------
B7FPG7_PHATC          ------------------------------------------------------------
D8LJ72_ECTSI          ------------------------------------------------------------
L1JUL8_GUITC          ------------------------------------------------------------
C1MVC4_MICPC          ------------------------------------------------------------
C1EBG2_MICCC          ------------------------------------------------------------
Q00XW4_OSTTA          ------------------------------------------------------------
K8F207_9CHLO          ------------------------------------------------------------
A4RWG6_OSTLU          ------------------------------------------------------------
C1FI04_MICCC          ------------------------------------------------------------
E1Z6S6_CHLVA          ------------------------------------------------------------
I0Z4U7_COCSC          ------------------------------------------------------------
A8I9T6_CHLRE          ------------------------------------------------------------
B9RTR9_RICCO          ------------------------------------------------------MAVILA
A5B749_VITVI          ------------------------------------------------------MAVFLA
I3SB38_LOTJA          ------------------------------------------------------MASILA
D7KF37_ARALL          ------------------------------------------------------MGFLVA
A2XLZ4_ORYSI          ------------------------------------------------------MSLMAS
A9NR68_PICSI          ------------------------------------------------------MVLPKS
K4ACJ3_SETIT          --------------------------------------------MARTCAGGERPSGGPS
F2E2M3_HORVV          ------------------------------------------------------MPGPPS
K4AJZ9_SETIT          -----------------------------------------------------MLSSPPP
Q2JR63_SYNJA          ------------------------------------------------------------
K8EHR0_9CHLO          ------------------------------------------------------------
E1Z3X7_CHLVA          ------------------------------------------------------------
D8TM37_VOLCA          ------------------------------------------------------------
I0Z4T1_COCSC          MSAFISFATEALNVSKTFPGIRFYMLTLVQNFYIPFIRDFVLAHGMCDCARSTCLRLLTR
                                                                                  

A0A3Q7HFK3_SOLLC      ------------------------------------------------------------
F6HIG7_VITVI          ------------------------------------------------------------
PB27A_ARATH           ------------------------------------------------------------
I1H5S8_BRADI          ------------------------------------------------------------
A9NTN0_PICSI          ------------------------------------------------------------
D8QT53_SELML          ------------------------------------------------------------
B8ANZ0_ORYSI          ------------------------------------------------------------
C1FGV0_MICCC          ------------------------------------------------------------
K8E9D7_9CHLO          ------------------------------------------------------------
E1ZQ67_CHLVA          ------------------------------------------------------------
D8UBY6_VOLCA          ------------------------------------------------------------
PSB27_THEEB           ------------------------------------------------------------
B8HY22_CYAP4          ------------------------------------------------------------
Q3MFN4_TRIV2          ------------------------------------------------------------
K9UBN6_CHAP6          ------------------------------------------------------------
B0CF06_ACAM1          ------------------------------------------------------------
K9YDL6_HALP7          ------------------------------------------------------------
K9EY09_9CYAN          ------------------------------------------------------------
I4IE80_9CHRO          ------------------------------------------------------------
PSB27_SYNY3           ------------------------------------------------------------
K9Z723_CYAAP          ------------------------------------------------------------
B1XKN5_SYNP2          ------------------------------------------------------------
Q46GR8_PROMT          ------------------------------------------------------------
Q7VD76_PROMA          ------------------------------------------------------------
A2BVG9_PROM5          ------------------------------------------------------------
Q7TUU3_PROMM          ------------------------------------------------------------
A5GSC2_SYNR3          ------------------------------------------------------------
A3YZG3_9SYNE          ------------------------------------------------------------
W0GSK8_9SYNE          ------------------------------------------------------------
K9SIE1_9CYAN          ------------------------------------------------------------
K9SU81_9SYNE          ------------------------------------------------------------
B7FPG7_PHATC          ------------------------------------------------------------
D8LJ72_ECTSI          ------------------------------------------------------------
L1JUL8_GUITC          ------------------------------------------------------------
C1MVC4_MICPC          --------------------------------------------------------MPLA
C1EBG2_MICCC          -----------------------------------------------------------M
Q00XW4_OSTTA          ------------------------------------------------------------
K8F207_9CHLO          --------------------------------------------------MTMCTSYASM
A4RWG6_OSTLU          ---------------------------------------------------------MPT
C1FI04_MICCC          -----------------------------------------------------------M
E1Z6S6_CHLVA          ------------------------------------------------------------
I0Z4U7_COCSC          --------------------------------------------------------MLIH
A8I9T6_CHLRE          -----------------------------------------------------------M
B9RTR9_RICCO          ---------------------------------------------------------LKL
A5B749_VITVI          ---------------------------------------------------------MKI
I3SB38_LOTJA          ---------------------------------------------------------ANM
D7KF37_ARALL          A--------------------------------------------------------MNF
A2XLZ4_ORYSI          ----------------------------------------------------RCYCCSSP
A9NR68_PICSI          T-------------------------------------------------------MTSL
K4ACJ3_SETIT          RVCWWPRRARDSRVRGSLDGCCSAGDKVPDYQKRLEVNQEQGTAIEATLCTRVNKLIHPS
F2E2M3_HORVV          ---------------------------------------------------------TTM
K4AJZ9_SETIT          ----------------------------------------------------------PM
Q2JR63_SYNJA          ------------------------------------------------------------
K8EHR0_9CHLO          ------------------------------------------------------------
E1Z3X7_CHLVA          ------------------------------------------------------------
D8TM37_VOLCA          ------------------------------------------------------------
I0Z4T1_COCSC          AKGSAIVLCVGGAREALLAQRDHFEIVLGKRLGFVRIAVRTGSALVPVLSFGENNIYQVA
                                                                                  

A0A3Q7HFK3_SOLLC      ------------------------------------------------------------
F6HIG7_VITVI          ------------------------------------------------------------
PB27A_ARATH           ------------------------------------------------------------
I1H5S8_BRADI          ------------------------------------------------------------
A9NTN0_PICSI          ------------------------------------------------------------
D8QT53_SELML          ------------------------------------------------------------
B8ANZ0_ORYSI          ------------------------------------------------------------
C1FGV0_MICCC          ------------------------------------------------------------
K8E9D7_9CHLO          ------------------------------------------------------------
E1ZQ67_CHLVA          ------------------------------------------------------------
D8UBY6_VOLCA          ------------------------------------------------------------
PSB27_THEEB           ------------------------------------------------------------
B8HY22_CYAP4          ------------------------------------------------------------
Q3MFN4_TRIV2          ------------------------------------------------------------
K9UBN6_CHAP6          ------------------------------------------------------------
B0CF06_ACAM1          ------------------------------------------------------------
K9YDL6_HALP7          ------------------------------------------------------------
K9EY09_9CYAN          ------------------------------------------------------------
I4IE80_9CHRO          ------------------------------------------------------------
PSB27_SYNY3           ------------------------------------------------------------
K9Z723_CYAAP          ------------------------------------------------------------
B1XKN5_SYNP2          ------------------------------------------------------------
Q46GR8_PROMT          ------------------------------------------------------------
Q7VD76_PROMA          ------------------------------------------------------------
A2BVG9_PROM5          ------------------------------------------------------------
Q7TUU3_PROMM          ------------------------------------------------------------
A5GSC2_SYNR3          ------------------------------------------------------------
A3YZG3_9SYNE          ------------------------------------------------------------
W0GSK8_9SYNE          ------------------------------------------------------------
K9SIE1_9CYAN          ------------------------------------------------------------
K9SU81_9SYNE          ------------------------------------------------------------
B7FPG7_PHATC          ------------------------------------------------------------
D8LJ72_ECTSI          ------------------------------------------------------------
L1JUL8_GUITC          ------------------------------------------------------------
C1MVC4_MICPC          IGSVSSAATLRASARASASHRGRRRASLVVVRASASSSSS--------------------
C1EBG2_MICCC          IALTSTSARITVARPVAA----KKTANASAVRCGAFSS----------------------
Q00XW4_OSTTA          --MNKARATFNVSASALF----KRVAEDASRAESAPST----------------------
K8F207_9CHLO          MTRTTNEARCCLLSASSFRNATKTTSSSSSSSSSSFTRGGRGGKKTSVFCIGNDNNDTTI
A4RWG6_OSTLU          RATTPTR-----------------------------------------ATTPTRATR-RD
C1FI04_MICCC          RGSVSQV-----------------------------------------AAGTIKDDD---
E1Z6S6_CHLVA          ------------------------------------------------------------
I0Z4U7_COCSC          RGCHHHP-----------------------------------------RLSQGRSTPQFE
A8I9T6_CHLRE          TLSQAAS-----------------------------------------KQSLASRALRSQ
B9RTR9_RICCO          CPSVTCKTSIPN------------------------------------NNCKLQWRCDTV
A5B749_VITVI          CPPMIPKPIEKNSYI---------------------------------HEYKLKSRCHIV
I3SB38_LOTJA          SSITSSKTVERIKRFD--------------------------------IHDKLQFRSNIA
D7KF37_ARALL          SPTLMHHHMKSKHHCQ--------------------------------NEKLLQGQTSSL
A2XLZ4_ORYSI          HSPSPPQRRDAESK----------------------------------QQHQQHIRYLSP
A9NR68_PICSI          TFGSCHSLAELEPAIS--------------------------------MSQSPPSSERRL
K4ACJ3_SETIT          TAISRVRRCCVAEVVARINNA--------------------------SPSAASDARAEQV
F2E2M3_HORVV          SPPSRCYRCCS------------------------------------SPSTPPPPPQQPI
K4AJZ9_SETIT          PTLDRCCRCCL------------------------------------SPSAKLQRAVETR
Q2JR63_SYNJA          ------------------------------------------------------------
K8EHR0_9CHLO          ----------------------------------------------------MTSRRTGH
E1Z3X7_CHLVA          --------------------------------------------------MALTASSRTC
D8TM37_VOLCA          ------------------------------------------------MQLQARPPSALR
I0Z4T1_COCSC          RPADGTFAARLQRNLLKLLGLGFPIFHGTGIMLSSIGMLPYQGPIYVVVGAPFEVPKFEG
                                                                                  

A0A3Q7HFK3_SOLLC      -----------------------MIRHVALIP---LITKTTTLSFSPNLFKKHKSMASPT
F6HIG7_VITVI          -------------------MVARRPAHVAINQPSFFLTRKEKYKLSSSGLISPKSMASPT
PB27A_ARATH           ---------------------------------------MASASATATLLKPNLPPHKPT
I1H5S8_BRADI          -------------------------------------MRPASSPVPAMLAAPSAASVAKP
A9NTN0_PICSI          --------------------------MAAATSLVAFASAAAPAHSLLNTRRPNRAMAMAT
D8QT53_SELML          -----------------------------------------------------------M
B8ANZ0_ORYSI          -------------------------------------MRPASSPVPAVLTAPATAATAAI
C1FGV0_MICCC          ----------------------------MAAIAASSVSIAPARVAAARQSRSRARAAVVV
K8E9D7_9CHLO          ----------------------------MDEKFDRREMLKNALVASVG-----VVAATPM
E1ZQ67_CHLVA          ----------------------------------MMACTAATAFQATLCGRPARPNRRAV
D8UBY6_VOLCA          --------------------------------MASLTCCSGKAVAASRA-RSTRPTTQRL
PSB27_THEEB           ------------------------------------------------------------
B8HY22_CYAP4          ------------------------------------------------------------
Q3MFN4_TRIV2          ------------------------------------------------------------
K9UBN6_CHAP6          ------------------------------------------------------------
B0CF06_ACAM1          ------------------------------------------------------------
K9YDL6_HALP7          ------------------------------------------------------------
K9EY09_9CYAN          ------------------------------------------------------------
I4IE80_9CHRO          ------------------------------------------------------------
PSB27_SYNY3           ------------------------------------------------------------
K9Z723_CYAAP          ------------------------------------------------------------
B1XKN5_SYNP2          ------------------------------------------------------------
Q46GR8_PROMT          ------------------------------------------------------------
Q7VD76_PROMA          ------------------------------------------------------------
A2BVG9_PROM5          ------------------------------------------------------------
Q7TUU3_PROMM          ------------------------------------------------------------
A5GSC2_SYNR3          ------------------------------------------------------------
A3YZG3_9SYNE          ------------------------------------------------------------
W0GSK8_9SYNE          ------------------------------------------------------------
K9SIE1_9CYAN          ------------------------------------------------------------
K9SU81_9SYNE          ------------------------------------------------------------
B7FPG7_PHATC          -----------------------------------MMKTSLFLIAAVT-TCASAFTPMQM
D8LJ72_ECTSI          -----------------------------------MKTFAACTIALVAGDLAAAFTGPLA
L1JUL8_GUITC          ------------------------------------MLRLLLPIALVI-GQAAAFAPSSS
C1MVC4_MICPC          ------------------------------SDDDDAATTPPSLPS----RRAAMLAGFVA
C1EBG2_MICCC          --------------------------------DDVSVSLPTSQ------RRAVLLAGLAS
Q00XW4_OSTTA          -------------------------------------------------SRRFVALSLAL
K8F207_9CHLO          ITISASSSKASSSSAKGGKKRITKIRNQHRGDDDDRAFSEESEKNNAKMKGGALFSTAVS
A4RWG6_OSTLU          ASARACDP---------------------------RSRANLVRVTPCVGEIFRCEALGLV
C1FI04_MICCC          ---KVPDP---------------------------DSRAASTRRDFLAAQV---------
E1Z6S6_CHLVA          ------------------------------------------------------------
I0Z4U7_COCSC          PSTSKPGN---------------------------SRPFSCRRTKWQRAVCADEGKERPS
A8I9T6_CHLRE          PNVIRAPA---------------------------RATCYRQNAIYLTGSTGRTESGSLT
B9RTR9_RICCO          PSSPAVTL-------------------------SRRHILLCS-ASFLTILNLNCISTPLP
A5B749_VITVI          LPSQESPS-------------------------SRRHVLVGSGASLVAILTFNGGFLPLP
I3SB38_LOTJA          LPPLEASS-------------------------SRRHLLLSVGTSLVTMTC--GGLSPLM
D7KF37_ARALL          FD--------------------------------RRGFLKCVVGASSFMAAF--EFSGLQ
A2XLZ4_ORYSI          PPSIFVSR--------------------------GGARLAVTTRRALLAAAIVVVGSGTA
A9NR68_PICSI          HSSWRCPA---------------------------TFSETTAQTRRLFLMGATFMVPLSF
K4ACJ3_SETIT          LPLLLVAVAADTAEAAASCGDQEEANLAGGGAARLPITRRAHAASLLLGLVGVDVAVAAP
F2E2M3_HORVV          ------------------------------RGARLLLTRRAHALSLLAGAASV-ASVAVA
K4AJZ9_SETIT          ---------------------QKPICTAGGGAARLPITRRADASSLLLGLAGM--AVAAP
Q2JR63_SYNJA          ------------------------------------------------------------
K8EHR0_9CHLO          QFSPLEEE---------------------------KERGKSRRSFITTTNCPSVLEAKSD
E1Z3X7_CHLVA          LPFQTVAS---------------------GRSGRRPTNIVVTQCSAAAEPQVARRSLLGV
D8TM37_VOLCA          VGATRVAR-----------------------RPRVVRVQAASSRAEVATADESTVGPSRR
I0Z4T1_COCSC          DINGDEGRRAVREAHEKYVAALRGLWDAHKGRYALERKGTLKIVDLPPAPQTGTVFSRHD
                                                                                  

A0A3Q7HFK3_SOLLC      LITPSTSTPKSLITPIRSKLITSVTTT----TITLRRREFLSLSAG--ILSPSLLLP-AT
F6HIG7_VITVI          LITPTTK-PKPLFL-IKSKLPTTTTNAAPPPTPQPRRRELIAVTAG--VLSHALLLPVAP
PB27A_ARATH           IIASSVSPPLPPPR-----------------RNHLLRRDFLSLAATSTLLTQSIQFLAPA
I1H5S8_BRADI          LPAPRSNNSITAQA-------------------AASRRDVLAGSGLGAALLLC-GAPVPP
A9NTN0_PICSI          AMARRVHQSQSQSQ----------------PEGALYCRRDVALLGVAGLISLAEAAP---
D8QT53_SELML          IQEEKLESPPSLSR----------------RQAVLASTTGIVLAGMMELHPCA-------
B8ANZ0_ORYSI          AVKPTPPQRALQAS-----------------------RRELVVAAGGVAAAAVALWPCGG
C1FGV0_MICCC          KASADERQVEATTSR--------------RELAVKGFAALAAVAAVRPEP--AHALFGFG
K8E9D7_9CHLO          PVRSFVRLVLPMISRVF------------MCFVVFRLDHQKAEKETRRESAFALALFGIG
E1ZQ67_CHLVA          VTLAQQQRSEGVTRR------------------EAGLAALAALAALSAAPQPAHALFGFG
D8UBY6_VOLCA          SVVASAQRQAPASRR------------------EVLGASVAAFSLLLSSS-PAYAIFGFA
PSB27_THEEB           -----------------------------------MKRFWAMVCALFLSVSLLLTSCANV
B8HY22_CYAP4          -----------------------------------MKQFLSCVFSLILAVSLLLGGCSAT
Q3MFN4_TRIV2          -------MALTTSLIPRYQSKIGWTLIYVFFYIMLMKRYWSRLLALVLVVAIGLVGCGS-
K9UBN6_CHAP6          ----------------------------------MFKRLWSQLFALVLVVVVGLAGCSAS
B0CF06_ACAM1          -----------------------------------MKRFVSRLLSLMLVASMFLTGCSLL
K9YDL6_HALP7          ---------------------------------MFIKSMLKRLLTLTLVVMISVVGLAGC
K9EY09_9CYAN          -----------------------------------MKRILSRLFAFTLVAILGLTGCGGD
I4IE80_9CHRO          ------------------------MGLTYGIENMSLKPYISRLLALVLVLVI---GLMGC
PSB27_SYNY3           --------------------------------MSFLKNQLSRLLALILVVAI---GLTAC
K9Z723_CYAAP          ----------------------------------MIKSYLRKIISLVLIVTI---ALFSF
B1XKN5_SYNP2          ----------------------------------MLKKFLSRLVAFVLVVMVSVTGLTAC
Q46GR8_PROMT          ---------------------------MISAFHRLSIRLVRAALAICLGFCLMLFQFASE
Q7VD76_PROMA          ---------------------------MAWDFHHLIKKTIKASLPLFLGLLLIFHPFGQS
A2BVG9_PROM5          --------------------------MLVKEKPLLFPDFFAKVISFTICLSIFFTLFNSP
Q7TUU3_PROMM          ------------------------MKRMTTALHHMAKQLMRAGLAICLVLCLMLTANGSA
A5GSC2_SYNR3          ---------------------------MFAALRGFGQQLVRAGLQLLLVVALVFGLSACG
A3YZG3_9SYNE          -MEMLMTVVWRSFSRAAGAALSTAFESFLAGMFSRSWWSRRLTPLLAIALGLSLTLSSC-
W0GSK8_9SYNE          ----------------------MTLKGFMLSALTRLLRPLSRAAV-ALGLGLCLLLTACS
K9SIE1_9CYAN          ---------------------------MLKSSLK---NIVFKLVALVLVATIALTCTSSA
K9SU81_9SYNE          ---------------------------MTKNSISFFSSLTTRLIALALVAVIFWVGGNAD
B7FPG7_PHATC          PDSSSVTARRN-----------------------FLQTASAAVIATTLPGAALA--EIVV
D8LJ72_ECTSI          ARTGATSAARASSSSAVCMSVGDEAMSRKNAIAAFSAGAAAVLGAAAVPAAVFAAEEAAA
L1JUL8_GUITC          SSLSLLSSSRSAPAVCALRASGSDASNVLSR-RDVLASSAAVIAGLSMPAIVRAEGEAAV
C1MVC4_MICPC          ASTSAMMTTRVSPARASSADMLAGVRTKVCDPTADGAECRANEIGKDL---GGLGDYDQK
C1EBG2_MICCC          TTALFFDAQRANAARP----------TPVCDPTADGAECRANLLQGDE---SNLDGYEAK
Q00XW4_OSTTA          AAASTASAPGANAQKF----------KEVCDPTEDGAECRANILAQDG---IDVGAYEVG
K8F207_9CHLO          VVVVLSTSQSVFNVQPAYATFSKSQFEILCPVGDEGTECRMKALAEDKGAYLNDAEYNTK
A4RWG6_OSTLU          RGDDATSTTARD---------DDGAGGADARDVRRRTFFATNAIALAAGACSTATDAANA
C1FI04_MICCC          ---------------------------------------VAAVTATQALVPHDAWAAVER
E1Z6S6_CHLVA          ------------------------------------MPAGLREAAPAH------------
I0Z4U7_COCSC          TSRQPD---------------------ITDRRSIVLMAAALPLLHPRQLDAQVLQSFSEP
A8I9T6_CHLRE          SSSQPN---------------------ASVSR----RSALLSLVGTSIVLARPSAVGAVE
B9RTR9_RICCO          VRAEDESNA--------------------------QEEKD-GVIGTIKSLFDPNEKTKSG
A5B749_VITVI          VWAEDESNG--------------------------QEDDEKGVVGAIKSLFDPNEKIKSG
I3SB38_LOTJA          ASAEENSAD--------------------------KEDDDKGVVGAIKSLFDPNEKSKSG
D7KF37_ARALL          AQAAEEK-----------------------------LEEGEGVVGAFKTLFDPNERTKSG
A2XLZ4_ORYSI          GRARATEEG--------------------------GGGEGEGVVGAIKSIFDPNERTKSG
A9NR68_PICSI          QRAHAEEKA--------------------------SSENDEGLLGGLLSLFDPNEKTKSG
K4ACJ3_SETIT          APARADDES---------------------------GGGEEGVLGAIKSIFDPNEKTKAG
F2E2M3_HORVV          GRARAAAEE---------------------------DGKGEGVVGAFKSLFDPNEETKAG
K4AJZ9_SETIT          ALARADDESNVRGGGEGGKSLLGSGGDYGGAGQAGGGGGAEGSAGGDEGAGCPNRGSSRG
Q2JR63_SYNJA          ----------------------------------MLKPFFLRFLGLLLSVTLMLGWATAS
K8EHR0_9CHLO          STTRNDEDSSAEAKSCFVSENTRGRCLRKRRRSIVLLQITSSMAALMSNISEEKVFAASS
E1Z3X7_CHLVA          ALLAATSAAPAQAILPVSRWDGESSAVGSCELGEAGDACPQAILAGNPAVLGSYDAKAGG
D8TM37_VOLCA          SLFTMTAGALLAGVASSSHPAQALTCASETTTEADDTACRRAVLSNDQGAVQNAEANYGS
I0Z4T1_COCSC          DQHYKEHLKHLCPRMCRTRSLPLDHHIGSPPGKTYEDIHRRNLLALGLFLTAAQAAGEAS
                                                                                  

A0A3Q7HFK3_SOLLC      SAF---------------------------------------------------------
F6HIG7_VITVI          QAV---------------------------------------------------------
PB27A_ARATH           PVS---------------------------------------------------------
I1H5S8_BRADI          QAR---------------------------------------------------------
A9NTN0_PICSI          -AK---------------------------------------------------------
D8QT53_SELML          -AL---------------------------------------------------------
B8ANZ0_ORYSI          AAR---------------------------------------------------------
C1FGV0_MICCC          GD----------------------------------------------------------
K8E9D7_9CHLO          EK----------------------------------------------------------
E1ZQ67_CHLVA          NE----------------------------------------------------------
D8UBY6_VOLCA          GDD---------------------------------------------------------
PSB27_THEEB           -----------------------------------------------------------P
B8HY22_CYAP4          -----------------------------------------------------------P
Q3MFN4_TRIV2          -----------------------------------------------------------P
K9UBN6_CHAP6          -----------------------------------------------------------P
B0CF06_ACAM1          S---------------------------------------------------------PE
K9YDL6_HALP7          S-G-------------------------------------------------------AD
K9EY09_9CYAN          G-M-------------------------------------------------------GA
I4IE80_9CHRO          S-S-------------------------------------------------------SS
PSB27_SYNY3           D-S-------------------------------------------------------GT
K9Z723_CYAAP          S-Q-------------------------------------------------------GA
B1XKN5_SYNP2          SGA-------------------------------------------------------SA
Q46GR8_PROMT          VNA-------------------------------------------------------AK
Q7VD76_PROMA          LAA-------------------------------------------------------AK
A2BVG9_PROM5          SYA-------------------------------------------------------AK
Q7TUU3_PROMM          -NA-------------------------------------------------------AE
A5GSC2_SYNR3          -GT-------------------------------------------------------PS
A3YZG3_9SYNE          -GS-------------------------------------------------------VS
W0GSK8_9SYNE          -GD-------------------------------------------------------AE
K9SIE1_9CYAN          YAARNTYTLGSGNPLTT-----------------------------------KELREKVN
K9SU81_9SYNE          AAL-----IGSGQKVTT----------------------------------NKEILEKAN
B7FPG7_PHATC          PPQTVDYE------------------------------------------------FPTD
D8LJ72_ECTSI          PAPAAVSEDG----------------------------------------------PPSD
L1JUL8_GUITC          EAAPAPAKAA----------------------------------------------SGEK
C1MVC4_MICPC          ANKK-----------------------------------------------VELAK-AMT
C1EBG2_MICCC          SARK-----------------------------------------------IELAK-TST
Q00XW4_OSTTA          GSRS-----------------------------------------------FKAANPTGA
K8F207_9CHLO          SDKKKSMK-------------------------------------------TSAAATAGR
A4RWG6_OSTLU          L-----------------------------------------------------------
C1FI04_MICCC          G-----------------------------------------------------------
E1Z6S6_CHLVA          ------------------------------------------------------------
I0Z4U7_COCSC          A-----------------------------------------------------------
A8I9T6_CHLRE          E-----------------------------------------------------------
B9RTR9_RICCO          ------------------------------------------------------------
A5B749_VITVI          ------------------------------------------------------------
I3SB38_LOTJA          ------------------------------------------------------------
D7KF37_ARALL          ------------------------------------------------------------
A2XLZ4_ORYSI          ------------------------------------------------------------
A9NR68_PICSI          ------------------------------------------------------------
K4ACJ3_SETIT          ------------------------------------------------------------
F2E2M3_HORVV          ------------------------------------------------------------
K4AJZ9_SETIT          GRGWLGRRRRGGSCSSWRCGGRARAASLLLGLAGMAVAAPVRADDESSGGGEEGVLGAIK
Q2JR63_SYNJA          AQA---------------------------------------------------------
K8EHR0_9CHLO          SPE---------------------------------------------------------
E1Z3X7_CHLVA          KRG----------------------------------------------AQWAGGVPVAD
D8TM37_VOLCA          LSEKK----------------------------------------------FTAVSGVPV
I0Z4T1_COCSC          AGQ-------------------------------------------------------SN
                                                                                  

A0A3Q7HFK3_SOLLC      AATDEEYVKEASEVIQKVRSTLNMDKGDP-----NIADSVAELREASNYWVAKYRREKAL
F6HIG7_VITVI          AANDEEYVKETADVINKVRTTINMDKTDP-----DVATAVADLRDASNSWVAKYRREKAL
PB27A_ARATH           AAEDEEYIKDTSAVISKVRSTLSMQKTDP-----NVADAVAELREASNSWVAKYRKEKAL
I1H5S8_BRADI          AASDDEYTSETKEVIGKVRSTISMDKADP-----KVADAVTELRELSNSWVAKYRREKSL
A9NTN0_PICSI          ASLEEDYSKETKEVINQVKSTIDMEKSNP-----NTSAAVAALRETSNNWVAKYRREKQL
D8QT53_SELML          ADFIEDYKSDTEAVIAKVKETLALEKTDP-----AKPNAVASLRQSSNSWVAKYRREKSV
B8ANZ0_ORYSI          AASDDEYVSETKDVIGKVRSTINMDRADP-----GVADAVAELRELSNSWVAKYRRGEVA
C1FGV0_MICCC          --KETQYAEQTAGVIAQVRFTLDLPADSD-----EKAAAIEKTRKLTNDWVARYRRDKGI
K8E9D7_9CHLO          --SDAKYEEDTKEVINQVREVLDFPMGAD-----GREQSIEKTRALTNEWVARYRRSGDY
E1ZQ67_CHLVA          -KAQQRYEKETGQVISDVRNAALLERGAP-----GREETMESVRKEINDWVARYRRDTAF
D8UBY6_VOLCA          SKLFDDYNSETSAILGKVKVTLALDKDDP-----TKEDSVKALRKDINNWVAKYRREPKV
PSB27_THEEB           TGLTGNFREDTLALISSLREAIALPENDP-----NKKAAQAEARKKLNDFFALYRRDDSL
B8HY22_CYAP4          TGMTGNFRQDTLALIDSLRTAITLPDDNS-----GKTAAQADARAKINDFIALYRRDDSL
Q3MFN4_TRIV2          DSLTGDYRQDTLAVVNTLRQALEITEDSP-----DKAALQAEARQKINDFSARYQRVNSV
K9UBN6_CHAP6          GGLVGNYRQDTMTVLNSLKAVLEMPDDSP-----DRAAAQSLAKLNINDFAARYRQDPAL
B0CF06_ACAM1          TLLSGDYQQDTIYVIDNLSNAITLPDDDP-----NKAENQAAAGALISEYVSRYRRKPKL
K9YDL6_HALP7          TGLTGNYRQDTLTVLETLRTTLEISVDDP-----NREEIRAKAREQLNDYAARYRRDEEV
K9EY09_9CYAN          DGLSGNYRQDTMAVVETLRTTIELPADAP-----NLPEVRSQARQQINAFSARYRRSANA
I4IE80_9CHRO          -GLTGNYGKDTLTVIETLTTALDLVKDDP-----NKAAAESQAKEQINDYISLYRRDKKS
PSB27_SYNY3           -GLTGNYSQDTLTVIATLREAIDLPQDAP-----NRQEVQDTARGQINDYISRYRRKGDA
K9Z723_CYAAP          IALTGKYTDDTLTVIEDLTQVIETPADASI---EVKRENQTLARKQINDYVSRYRKNNKY
B1XKN5_SYNP2          SGLTGKYVDDTLLVVENLTEAIQLPADAP-----NRSEVQAAARLQMNEYMSRYRRDPKT
Q46GR8_PROMT          TLMTGDFAKDTIAVSSTLKETITLPKEDK-----GLSEAEKEAVFLISDYISRYRNRSQV
Q7VD76_PROMA          PFMSGDFAKDTVSVAQSLKETIALSDDDG-----QLSESKDEALALITAYISRYRNRPQV
A2BVG9_PROM5          TSMTGDYTQDTISVVKTLQIAVDTPKDSP-----NKNEVRDESLALITDYISRYRNRGMV
Q7TUU3_PROMM          IQLSGNYVDDTVNVAHNLQDAIALSSDDE-----GFSAAQEEARDLSYNYIARYRPRSKV
A5GSC2_SYNR3          -GLTGTYVDDTVSVAKSLLSIIAPE-DGQ-----ASSEQQQQARDLINEYISLYRPNSRV
A3YZG3_9SYNE          NSLSGSYVEDTMTVAESLLGTIALSQDDP-----ARPDAESEARVLINDYMALYRPKGRV
W0GSK8_9SYNE          ARLSGDYVEDTVAVSRTLLTVIDLPQDDP-----THAEVEADARALINDYMSRYRPQPRV
K9SIE1_9CYAN          AGLTGNYVDDTKKLIESLKYTLSLAKDAD-----DRSEAQAETRARINAYSARYRADNSK
K9SU81_9SYNE          AGMTGNYVEDTKAVVKSLRYAVGLDPKDP-----NKIAAQTDARYKINAYASRYRRDSEK
B7FPG7_PHATC          WGLTFKYEEDAVKVRQHMVVATGMAKGSE-----KMEEFGKNMKKEMVDFVSYYRRFPKV
D8LJ72_ECTSI          WGLTKQYYPDASKMVRHMRYCTNMEKGDP-----YMADIANNCKKEMVEFVSNYRRSSNI
L1JUL8_GUITC          YKLSGDYKTDVSELLNKMKAATEMKKGDP-----AMKALVEDTRDEMNKFVAYYRRNNKV
C1MVC4_MICPC          NPNMTNYQLDTMKLVDECAEVLALDVYDL-----TREKRIGQLVKDGNVWSSKYAPGGS-
C1EBG2_MICCC          NPDLTNYQKETLALVGEMEEVLGLDIYDM-----TREKRISQLKKDSNVWAGKYAPGGS-
Q00XW4_OSTTA          KTSLTTYQSDTLEFVGEVEALLAMDVYDG-----SREKAVAAFQKKSNNWSGKYAPGGS-
K8F207_9CHLO          NTDLTAYQADTLALADAMDELFAMDLYST-----AREPAIKQLQKKANDWTGRYCPGGS-
A4RWG6_OSTLU          EDVPRDYARVARELVDALSTSLEHEARNANKSPGERYKFAKPAKEAVKAYISYDGGGGSA
C1FI04_MICCC          LDLPDDYFKKARDAVKTLVASLEFEATNP--SDADRFRKAEPAKEAVKAFIKDWA--SAP
E1Z6S6_CHLVA          GGRAAAYEDTAQRLVDALREAISTDLSDAE--ERQVRRAADPAKSLVRQFLTRWK--GNG
I0Z4U7_COCSC          RTLPQGYEEFAGKLAAALREAIETDLSDAE--ERQVRKKADPAKNLVKGWLSEWK--DAQ
A8I9T6_CHLRE          VKLPKEYRQLVKRLSEGLSESIETEASGAS--EAEVRRAADPAKEVVREFVRKWR--DNP
B9RTR9_RICCO          KLLPKAYLKSARDVVKTLRDSL--KEDPKD--VTQFRRTADAAKESIREYLGSWR--GQE
A5B749_VITVI          KVLPKAYLNSAREVVKTLRESL--KEDPKD--IAKFRRTADAAKESIREYLSSWR--GKQ
I3SB38_LOTJA          KVLPKAYLKSAREVVKTLRESL--NEVPDD--NAKFRRTADAAKESIRDYLGGWR--GNQ
D7KF37_ARALL          KELPKAYLKSAREVVKTMRESL--KENPKD--NAKFRRSADAAKESIRDYLSNWR--GQK
A2XLZ4_ORYSI          KVLPKAYLKAAREVVRTLRESL-GEDDGGD--VAKFRRGADAAKESIREFLGGWR--GQQ
A9NR68_PICSI          RILPKIYLKNAREVVKNLRESL--KEDSKD--TAKFRRSADSAKESIKDFMRNWT--GQQ
K4ACJ3_SETIT          KVLPKAYLKAAREVVRTLRESLEE-DDGGD--MAKFRRNADAAKESIREFLGGWR--GQQ
F2E2M3_HORVV          KVLPKAYLKAAREVVRTLRESLEEGDAAGD--SARFRRS---------RMLRWRR--PSN
K4AJZ9_SETIT          KVLPKAYLKAAREVVRTLRESLEE-DGGGD--MAKFRWNADAAKESIREFLGGWR--GQQ
Q2JR63_SYNJA          ARLTGKYYEDSMTLIQTLRTVLSEADPVMN-----PEEAQVEAMEAIQEFAGRYH-GHRY
K8EHR0_9CHLO          -DVPKEYAEKLRSACELLLKSIEYERAHPSASVSERFAAADPAKQAVKEYIQTWQGRPET
E1Z3X7_CHLVA          MGAASPYARDTLALTDRVLAFAALNGDPAN---PERIQLVKELKTEFPGWVSKYARGGSA
D8TM37_VOLCA          AVLDSEYVRSTLKLREDIISYATLDVNNYQ----VRVPLIKTLRTEGSDWVSKYARGGSA
I0Z4T1_COCSC          SQLADQYYDRTAEMVGRIKDVLDIDLTND-----DSVPKLEDFKKSANAYVADYRRLVSP
                            :                                                     

A0A3Q7HFK3_SOLLC      LGRAS-----------------------FRDIYSALNAVSGHYVSFGPTTPIPAKRKVRI
F6HIG7_VITVI          LGRPS-----------------------FRDMYSALNAVSGHYISFGPTAPIPAKRKARI
PB27A_ARATH           LGKAS-----------------------FRDIYSALNAVSGHYVSFGPTAPIPAKRKARI
I1H5S8_BRADI          LGRQS-----------------------FRDMYSALNAVSGHYISFGPTAPIPNKRRTRI
A9NTN0_PICSI          AGKPS-----------------------FSNMYSVLNAISGHYISFGPTSPIPAKRKARI
D8QT53_SELML          AGKPS-----------------------FSNMYSVLNAISGHYISFGPSSTIPAKRQQRI
B8ANZ0_ORYSI          AGPPV-----------------------LQGDVLRAQRRVGPLHQLRPHGPHPQQAPRPH
C1FGV0_MICCC          TGRPS-----------------------YGNVYSALNAVSGHYNNFGTKYPLPQKRKDRV
K8E9D7_9CHLO          SGRPS-----------------------YGLTYSALNAVSGHFNNFGTKYPFPAKRKDRV
E1ZQ67_CHLVA          SGRPS-----------------------YGNTYSAVNAMAGHLNSFGATAPIPKKRLERL
D8UBY6_VOLCA          SGKPS-----------------------FGNTYSALNALAGHFNSFGATAPIPKKRLERL
PSB27_THEEB           RSLSS-----------------------FMTMQTALNSLAGHYSS-YPNRPLPEKLKARL
B8HY22_CYAP4          TSLAS-----------------------YTTMRTALNSLAAHYTS-SPNRPLPQKLKNRL
Q3MFN4_TRIV2          SGLNS-----------------------FTTMRTALNSLAGHYSS-YPNRPVPQKLKSRL
K9UBN6_CHAP6          TKLSS-----------------------FTNMRTALNSLAAHYAA-YPNRPLPEKLKTNL
B0CF06_ACAM1          AGSAS-----------------------FMTMATALNGLAGHYNS-YPNRPLPQRLKDRL
K9YDL6_HALP7          AGLRS-----------------------FTTMQTALNALANYYTSAYATRPIPQRVKDRV
K9EY09_9CYAN          ASLSS-----------------------FATMQTALNALAGHYSS-YPNRPIPAKLKARL
I4IE80_9CHRO          GGLRS-----------------------FTTMQTALNSLAGYYTA-YGSRPIPDKLKQRL
PSB27_SYNY3           GGLKS-----------------------FTTMQTALNSLAGYYTS-YGARPIPEKLKKRL
K9Z723_CYAAP          SGLKS-----------------------FTTMQTALNSLAGYYTS-YGNRPMPEKLKKRL
B1XKN5_SYNP2          SGLRS-----------------------FTTMQTALNALAGYYSS-FGSRPLPEKLKTRL
Q46GR8_PROMT          NTSTT-----------------------FTTMQTALNALSGHYKT-FANRPVPENLKERL
Q7VD76_PROMA          NGTSS-----------------------FTTMQTALNAMAGHYKT-FSNRPLPENLKERL
A2BVG9_PROM5          NKTQS-----------------------FTTMQTALNAMAGHYKN-FATRPLPDKLKERL
Q7TUU3_PROMM          NNLQS-----------------------FTTMQTALNSLAGHYNN-FANRPLPEELQNRI
A5GSC2_SYNR3          NGLAS-----------------------FTTMQTALNSLAAHYAS-YNNRPLSDDLRARL
A3YZG3_9SYNE          NGLPS-----------------------FTTMQTALNSLAGHYTN-YANRPLPEALKTRL
W0GSK8_9SYNE          NGLSS-----------------------FTTMQTALNSLAGHYAS-YANRPLPEALHDRI
K9SIE1_9CYAN          TGLVS-----------------------FTTMRTVINSLASYYNG-TTKRSVPQRVADRA
K9SU81_9SYNE          LGLTS-----------------------FTTLRTALNALASYYNG-TTKRSVPPKVRDRV
B7FPG7_PHATC          AGKPS-----------------------FSTLYTSINVLAGHYTSYGFKYPLPEKRRKRL
D8LJ72_ECTSI          NGKLS-----------------------YSNLYTSISVLAGHYASYGPKFPVPEKRRKRL
L1JUL8_GUITC          AGAAS-----------------------FSTLYTAISTLSGHFQNYGPEYPVPEKRKKRL
C1MVC4_MICPC          SKTAS-----------------------GRAFYNAINQVSGHFNF-NGIAPLPKSRLDVV
C1EBG2_MICCC          AKTAS-----------------------GRAFYNAVNQVSGHFNA-NGIAPLPASRLEVV
Q00XW4_OSTTA          SKMAS-----------------------GRAFYNALNQLAGHYSF-NGLAPIPKSRLDVV
K8F207_9CHLO          SKQAS-----------------------GRSMYNAVNQLLGHFAN-NGLAPLPSARVEIV
A4RWG6_OSTLU          SASSS---------------------ASYADIAEALRELSAFYKKNGATAEMSAEVRDRI
C1FI04_MICCC          AAQGE---------------------RAHDDIVLAVRELGEFYKENGSRSRLSPEARESI
E1Z6S6_CHLVA          LVEGE---------------------ESYRQLSAAIQLLGTFYQQNGQRTRLTGEVGQAV
I0Z4U7_COCSC          GVQGE---------------------ASYTQLSGTIKELGEFYRKKGQRARLPRSLGNEL
A8I9T6_CHLRE          RVSSD---------------------ITHAEIKEALAELGEFYLAYGQRTKLTPPVRESV
B9RTR9_RICCO          KVVRE---------------------ESYIELEKAIRSLASFYSKAGPSAPLPEEVKSEI
A5B749_VITVI          TVVSEVCILQKHFWFLRWIPVVTVXHESYAMLEKAIRSLASFYSKAGPSAALPEEVKSEI
I3SB38_LOTJA          DVAQE---------------------ESYDMLEKAIRSLAKFYSRAGPSAPLPEEVKTEI
D7KF37_ARALL          TVAGE---------------------ESYVELENVIRALAKFYSKAGPSAPLPDEVKTQI
A2XLZ4_ORYSI          AVAAE---------------------ESYVALEKAIRSLAEFYSKAGPFASLPKDVKDKI
A9NR68_PICSI          SVTSE---------------------DSYAALVKVIRVLADFYSKKGPTAALPEDIKSKV
K4ACJ3_SETIT          AVAAEVRHAHPC---------------LRIFQLCSVQCVAIFRDCSSAGVVRCVGEGDQI
F2E2M3_HORVV          RWRSSTPRQDP---------------------------LPRFREMSKARSSTTLTPRRPT
K4AJZ9_SETIT          AAAAEKAIGSL----------------------------AEFYSEAGSSAPLPQDVKNKI
Q2JR63_SYNJA          DKLQS-----------------------FTTLRTVFNTVASHYRT--SKRPLDPEKVERV
K8EHR0_9CHLO          RDLET-----------------------SVITGEVLRELARYYKKNGSQVALDAELRDDV
E1Z3X7_CHLVA          RTVSA------------------------RKVYVVVDAISAHFAQ-NGLAPVPKTKMAKL
D8TM37_VOLCA          RTDSA------------------------RRMYIAVDALIGHLAS-NGYAPMPKPKLKVV
I0Z4T1_COCSC          GQKS------------------------FAEVYGVVTAMVGHFTVFGLGKKAFPAKLKEK
                                                                                  

A0A3Q7HFK3_SOLLC      L-EEMDTAEKALKRGR-------------------
F6HIG7_VITVI          L-EEMDTAEKALLRGR-------------------
PB27A_ARATH           L-EEMETAEKALTRGR-------------------
I1H5S8_BRADI          L-EEMDAVEKSLSRGR-------------------
A9NTN0_PICSI          L-EEMDVAEKALSKGR-------------------
D8QT53_SELML          L-EEVKDAEKALSRGR-------------------
B8ANZ0_ORYSI          P-RGDGHRREGPAPRPVR-----------------
C1FGV0_MICCC          L-QEFETAEIALSRGR-------------------
K8E9D7_9CHLO          F-EELTSAETQISRGR-------------------
E1ZQ67_CHLVA          V-KELDDAERFLGRGR-------------------
D8UBY6_VOLCA          Q-KELDDASTLLNRNR-------------------
PSB27_THEEB           E-QEFKQVELALDREAKS-----------------
B8HY22_CYAP4          E-MEFKQVEAALSREAAQPG---------------
Q3MFN4_TRIV2          E-QEFKQVESALKRGA-------------------
K9UBN6_CHAP6          E-QKFKQIELALQRNA-------------------
B0CF06_ACAM1          E-QEFKQAKIALKRENAA-----------------
K9YDL6_HALP7          S-QEFAQVERALRREEA------------------
K9EY09_9CYAN          E-QEFKQVEAALRRESA------------------
I4IE80_9CHRO          K-QEFKQVQFSLQKGI-------------------
PSB27_SYNY3           Q-LEFTQAERSIERGV-------------------
K9Z723_CYAAP          L-QEFKQVEFAIKKGY-------------------
B1XKN5_SYNP2          A-TEFETANIAVKRGI-------------------
Q46GR8_PROMT          N-KELSKAEKLAARDS-------------------
Q7VD76_PROMA          N-KELTRAEKVVAKEI-------------------
A2BVG9_PROM5          T-KEFSLAEKMVLRES-------------------
Q7TUU3_PROMM          T-KELAKAEQTVLRGR-------------------
A5GSC2_SYNR3          E-KELHKAELSVVRGS-------------------
A3YZG3_9SYNE          E-KELKKAETSVVRGT-------------------
W0GSK8_9SYNE          A-KELNKAEKSVVRGS-------------------
K9SIE1_9CYAN          I-SQISRAESALEAGR-------------------
K9SU81_9SYNE          I-LELDRVDIALEQGR-------------------
B7FPG7_PHATC          Y-QEYAEIEKSLKRGR-------------------
D8LJ72_ECTSI          L-QEYTDIERAIKRQR-------------------
L1JUL8_GUITC          S-QQYAEVEKQIARGR-------------------
C1MVC4_MICPC          N-ANLEDTRKLIAQGR-------------------
C1EBG2_MICCC          T-ANMVKTRELIDQGR-------------------
Q00XW4_OSTTA          E-TNIAKTKELIAAGR-------------------
K8F207_9CHLO          N-KNIATARDLIAQGR-------------------
A4RWG6_OSTLU          L-SRLYEARDLLPAPEPTIMDKLRAL---------
C1FI04_MICCC          L-AKLYDAREALPPAPPSLADRLLGL---------
E1Z6S6_CHLVA          L-DRLDAAEAALPMREDKVLPLPFF----------
I0Z4U7_COCSC          L-AKLAAAENALPLPGSADGKQNI-----------
A8I9T6_CHLRE          L-RHLKAARSALPEEEGSASKVLGLF---------
B9RTR9_RICCO          L-NDLSAAEEFL-----------------------
A5B749_VITVI          L-DDLNTAEEFL-----------------------
I3SB38_LOTJA          L-DYLNTAEEFL-----------------------
D7KF37_ARALL          L-DDLNKAEEFL-----------------------
A2XLZ4_ORYSI          L-ANLNTADAFL-----------------------
A9NR68_PICSI          M-DDLNSAEAAL-----------------------
K4ACJ3_SETIT          T-GGVLLQSRTFSTASTGCQEQDPR----------
F2E2M3_HORVV          S-RSSCLAALYFPV---------------------
K4AJZ9_SETIT          L-NDLSTADI-------------------------
Q2JR63_SYNJA          L-MQLDRAELALRREG-------------------
K8EHR0_9CHLO          VVPKLNEVLNMLPAKAPTLAERVLGISTNSSNKAN
E1Z3X7_CHLVA          E-GDVQVALAALAEGR-------------------
D8TM37_VOLCA          L-ANVDQAKAFLEEGK-------------------
I0Z4T1_COCSC          QEKRVALAEKLLERELARERKVATVVHPPTAFVG-