CLUSTAL format seed alignment for MF_01482

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MCA_MYCS2         ----------------------------------------------------MSELRLMA
MCA_MYCTU         ----------------------------------------------------MSELRLMA
B1MKJ9_MYCA9      ----------------------------------------------------MTGLRLMA
F6EQ39_HOYSD      ----------------------------------------------------MGGLRLMA
H6MSI6_GORPV      --------------------MRETHTAESHPSTSSTQGAGASTPTGVVTTSSGGGFRLMA
H6QZJ8_NOCCG      ----------------------------------------------------------MA
D6Z904_SEGRD      ----------------------------------------------------MSGLRLMA
C4LHN0_CORK4      ----------------------------------------------------MTGFRLLA
G0HFP1_CORVD      ------------------------------------------------------------
F8E0G9_CORRG      ----------------------------------------------------MNTYRLLA
C6WKR7_ACTMD      ---------------------------------------------------MGEKLRLMA
G0FRL5_AMYMS      -----------------------------------------MVDADELRNTANPRLRLMA
F4CIX5_PSEUX      ---------------------------------------MTQPDIDGEYEAAGPRFRLMT
I0H605_ACTM4      ----------------------------------------------MTAVTGTSPLRLLA
G0G6W9_AMYMS      -----------------------------------------------------MTYRLLS
A6W700_KINRD      ------------------------------------MGDRQPERYFPRGAVVAETLRLMA
E1VTM1_GLUAR      ------------------------------------MEIHDVKKIAP-----SQGLRLMA
C7QZX6_JONDD      ------------------------------------MS--------------TSPLRLMA
MCA_STRCO         ---------------------------------------------------MTDQLRLMA
E4NG89_KITSK      ----------------------------------------------------------MA
D2PP24_KRIFD      ------------------------------------------------MCLVTEDLRLLH
F5XTG2_MICPN      -----------------------------------------MERPPLRLDAAGERLRLLH
I6XRZ2_PSEPQ      --------------------------------------------MSSMTSHPKGPLRLLH
D1A8F7_THECD      ---------------------------------------MGSEAPIGMTSCEDGPLRLMA
D2B2F3_STRRD      ---------------------------------------------------MSAPLRLMA
Q47ST0_THEFY      ---------------------------------------------------MSERLRLMA
D7B6Z3_NOCDD      ---------------------------------------------------MSERLRLMA
E3ITI9_FRAIE      MDFMPVNPGAAPSYDDLPDQHSVSARGDLSADGESVAGPATGGGLAASPHAPGHGLRLMA
A8L168_FRASN      ----------------------------------------------MFPDEQERGLRLMA
F8AVV1_FRADG      ----------------------------------------------MSKAINEGGLRLMA
D9TB41_MICAI      ---------------------------------------------------MAEQLRLMA
D3Q737_STANL      --------------------------------------------------MVTEKLRLMA
H6RSK5_BLASD      -------------------------------------------------MTHPDQLRLLA
C7MEV0_BRAFD      --------------------------------------------MTVQLPAPDEPLRMVA
B1MHK8_MYCA9      ----------------------------------------------------------MA
B0RH34_CLAMS      --------------------------------------MYSGCPDYIPHPWSPVTLRLMA
                                                                              

MCA_MYCS2         VHAHPDDESSKGAATTARYAAEGARVMVVTLTGGERGDILNPAMDL--PEVHGRIAEVRR
MCA_MYCTU         VHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNPAMDL--PDVHGRIAEIRR
B1MKJ9_MYCA9      VHAHPDDEASKGAATTARYAAEGNEVMVVTLTGGERGDILNPAMDR--PEVAANIGAIRR
F6EQ39_HOYSD      VHAHPDDESSKGAATMARYAKEGHDVMVVSLTGGERGDILNPAMDT--PGVHQRISEVRK
H6MSI6_GORPV      VHAHPDDESSKGAATSAKYAAEGNDVLIVTLTGGERGDILNPAMDR--PGVKERMSEVRK
H6QZJ8_NOCCG      VHAHPDDESSKGAATTARCADEGNDVLVVTLTGGERGSILNPAMDT--PGVLDRIDEIRR
D6Z904_SEGRD      VHAHPDDESSKGAATTARYAAEGNEVLVVTLTGGERGDVLNPALDA--PAVKANLPAIRR
C4LHN0_CORK4      IHAHPDDESSKGAATLARYANEGNEVMVLTCTGGERGSILNPAMDR--PEVRENMIELRK
G0HFP1_CORVD      ---------------MARYADEGVTVKVLTCTGGERGSILNPAMDR--PGVVERMHEIRI
F8E0G9_CORRG      IHAHPDDESSKGAATMARYIDEGHRVKVLTCTGGERGDLLNPSMDP-----VDDIVPVRK
C6WKR7_ACTMD      VHAHPDDESSKGAATMAKYVAEGHEVMVVTCTGGEAGSILNPAMDR--PEVLANMGEIRR
G0FRL5_AMYMS      VHAHPDDESSKGAATMARYAAEGHEVLVVTCTGGEAGSILNPAMDR--PEVLANMSEIRR
F4CIX5_PSEUX      VHAHPDDESSKGAASSARYVSEGHEVTVVTCTGGERGSILNPAMDR--PEIAADLPAVRR
I0H605_ACTM4      VHAHPDDESSKGAATLARYAAAGHSVLVATCTGGEAGDILNPAMDR--EEIRGRLPEVRR
G0G6W9_AMYMS      VHAHPDDESSKCAATLARYAAEGVEVLVATCTGGERGDVLNPALDT--PETWADLPAIRR
A6W700_KINRD      VHAHPDDESSKGAASMAKYVAEGVEVLVVSCTGGERGDVLNPRLKEN-ASLLRDMGEYRR
E1VTM1_GLUAR      IHAHPDDESSKGAATMAAYVDAGAEVMVVSCTGGERGDILNAAAGEL-AHAHRDLAGVRR
C7QZX6_JONDD      VHAHPDDESSKGAATTARYAAQGVEVLVVTCTGGERGSILNPHYGEV-VAEPEQMNAIRQ
MCA_STRCO         VHAHPDDESSKGAATMAKYVSEGVDVLVVTCTGGERGSILNPKLQGD-AYIEENIHEVRR
E4NG89_KITSK      VHAHPDDESSKGAATMAMYVAQGVEVLVATCTGGERGSILNPKLQGD-PWVEENIHEVRR
D2PP24_KRIFD      VHAHPDDESSKGAASTARYVAEGVDVMVATCTGGERGSILNPKMDR--PDVLANMAEIRR
F5XTG2_MICPN      VHAHPDDESSKGAATTARYVAEGVEVVVATCTGGERGSILNPAMDR--PDVLANIAEIRR
I6XRZ2_PSEPQ      VHAHPDDESSKGAATTAKYVAEGVEVMVATCTGGERGDILNPALAGD-PGILENLPAVRA
D1A8F7_THECD      VHAHPDDESSKGAATMARYAAEGVEVLVVTCTGGERGDILNPAMDR--PEIKADIAAVRR
D2B2F3_STRRD      VHAHPDDESSKGAATMARYVAEGVEVLVCTLTGGERGSILNPKMDR--PEILENIGEVRR
Q47ST0_THEFY      VHAHPDDESSKGAATMARYVNEGAEVLVVTLTGGERGSILNPAMDR--PEIRENIAEVRR
D7B6Z3_NOCDD      VHAHPDDESSKGAATMARYVEEGVDVLVVTMTGGERGDILNPAMER--PDIRENIAQVRR
E3ITI9_FRAIE      VHAHPDDESSKGAASMARYVTEGAEVLVVTCTGGEAGSILNPAMDK--PEIRDRITEVRR
A8L168_FRASN      VHAHPDDESSKGAATMARYAHEGLEVLVVTCTGGEAGSVLNPAMDS--PEVLARMTEVRR
F8AVV1_FRADG      VHAHPDDESSKGAATMARYVREGVDVLVVTCTGGEAGTVLNPALDR--PDVHERLVELRR
D9TB41_MICAI      VHAHPDDESSKGAATMAKYVAEGVDVLVVTATGGERGSVLNPKMDR--PDVWANIGDIRR
D3Q737_STANL      VHAHPDDESSKGAATMARYVAEGVDVLVATCTGGERGSVLNSKMDR--PEVWRDITGIRA
H6RSK5_BLASD      VHAHPDDESSKGAATMAKYVAEGVRVMVATATGGERGSVLNPAMDR--PEVWERLPQIRV
C7MEV0_BRAFD      VHAHPDDESSKGAGSTARYVREGAQVTVITCTGGERGDVLNPRLRDDPSVTVEALPEIRR
B1MHK8_MYCA9      VHAHPDDESSRGAATLAKYAAEGHQVLVVTATGGERGDILNPAMNR--AGVQENLRQVRR
B0RH34_CLAMS      VHAHPDDESSKGAATYTHYTKQGAEIMVVSCTGGEAGDILNEGLAER-AMAERDLPGLRR
                                  :     *  : : : **** * :**             :   * 

MCA_MYCS2         DEMAKAAEILGVEHHWLGFVDSGLPEG---DPLPPLPDGCFALVPLEEPVKRLVRVIREF
MCA_MYCTU         DEMTKAAEILGVEHTWLGFVDSGLPKG---DLPPPLPDDCFARVPLEVSTEALVRVVREF
B1MKJ9_MYCA9      EEMAKAAAELGVRHRWLGYVDSGLPQG---DPLPPLPSDSFALVPIEEPIAKLVAVVREF
F6EQ39_HOYSD      EEMARAAEILGVQHRWLGFVDSGLPEG---DPLPPLPEGCFALVPVDVASEALVKVIREF
H6MSI6_GORPV      EEMAKAAAALGVQQRWLGFVDSGLPEG---DPPPPLPEGSFATLPLEVPTEALVKLVREF
H6QZJ8_NOCCG      EEMAAAAAALGVEQTWLGFVDSGLPEG---DPLPPLPEGCFALAPLEEATEALVRVVREF
D6Z904_SEGRD      QEMAEAARILGVSHHWLGYVDSGFPEG---DPPPPLPEGSFAAVPIEEPLRDLVAVVRRF
C4LHN0_CORK4      KEMAKAAEILGIKQRWLGYVDSGLPEG---DPLPPLPEGSFALANTEEATADVVEVIRDF
G0HFP1_CORVD      EEMAHAAEILGVEQEWLGYIDSGLPEG---DPLPPLPEGCFALADTEEATAKMVKVFREF
F8E0G9_CORRG      EEMAKAAHILGVEHEWLGYVDSGLPEG---DPPPPLPEGCFALEDTEEVTQRVVRVIREF
C6WKR7_ACTMD      AEMARAAEILGIQHRWLGFVDSGLPEG---DPLPPLPEGCFALVPLEESVPPLVEVIREF
G0FRL5_AMYMS      EEMARAAKILGVSQHWLGFVDSGLPEG---DPLPPVPEGSFAVVPLEESTEALVRVIREF
F4CIX5_PSEUX      AEMARAAEILGVRHHWLGFVDSGLPEG---DPKPPLPEGCFALADLDEATERLVRLIRAE
I0H605_ACTM4      AELAAAVGVLGVRQRSLGFVDSGWPEG---DP-PPVAAHTFAGLPLAETTAALVRLIREF
G0G6W9_AMYMS      REMAAAAEILGVRQRFLGLVDSGLPAE---GE--PLPEGCFAALPLSEAAAPLVALIREF
A6W700_KINRD      HEMAEAARILGVQHRWLGYVDSGLPEG---DPLPPLPAGCFALTPTEFTVDALVHVVREF
E1VTM1_GLUAR      TEMAEAAAVLGVKHRWLGYVDSGLPEG---DPLPELPFGAFALQPVEIAAAGIIKLIREF
C7QZX6_JONDD      VEMRHAAQALGVSHRWLGFIDSGLPEG---DPLPPLPPGCFALEPLDVPTRALVEVMREF
MCA_STRCO         KEMDEAREILGVGQEWLGFVDSGLPEG---DPLPPLPEGCFALEDVDKAAGELVRKIRSF
E4NG89_KITSK      KEMDAAREILGVRQSWLGYVDSGLPEG---DPLPPLPEGCFALEEVEVAAGALVKLIREF
D2PP24_KRIFD      REMDAAREILGIRQEWLGWVDSGFPEG---DPLPPLPEGCFAAQKVEDAAAPLVKLIREF
F5XTG2_MICPN      AEMDRAREILGIEQVWLGFVDSGLPEG---DPLPPLPPGCFALTDLEVEVGRLVEVIRRF
I6XRZ2_PSEPQ      AEMARAREILGIEQVWLGFVDSGLPEG---DPPPPLPEGCFALQDVAVAAGRLVKVIRDF
D1A8F7_THECD      QEMARAREILGVQQIWLGFEDSGFPEG---DPPPPLPEGCFALQPLQVAAEPLVRAVREF
D2B2F3_STRRD      LEMERAREILGVRQRFMGFVDSGLPD----DESEPLPEGCFALQPIEAASAPLVAAVREF
Q47ST0_THEFY      KEMEEARRILGVRQVFVGFIDSGLPEG---DPPPPLPEGCFALQPLEVAAEPVVRLVREF
D7B6Z3_NOCDD      EEMERAREILGVQQEFAGFVDSGLPEG---DPLPPLPEGCFATLPVEEGAAPLVESIRRF
E3ITI9_FRAIE      EEMERARAILGVRQTWLGFLDSGLPEG---DPLPPLPEGSFGTLDPEAAAGPLVRLIREF
A8L168_FRASN      EEMERARQILGVRQEWLGFLDSGLPEG---DPPPPLPEGSFATLELAAASRPLVRLIREF
F8AVV1_FRADG      AEMEQARRILGVRQVWLGFLDSGLPEG---DPLPPLPEGCFARTPIADAARPLVRLMREF
D9TB41_MICAI      AEMDAARAILGVEQAWLGFVDSGLPEG---DPLPPLPEGCFALQDVDVAAAPLVRLMRQF
D3Q737_STANL      KEMERAREILGVKQAWLGFVDSGLPEGWLPDSGIDLPEDCFYLEPLEVASAPLVRLIREF
H6RSK5_BLASD      EEMARAREILGVEQEFLGFVDSGLPEG---DPLPPLPEGCFALLPVEEAAAPLVALIRRF
C7MEV0_BRAFD      QEMARAQEILGVDHEWLGFIDSGLPEG---DPLPPLPAGSFATLPVEEAARPLVEAVRRL
B1MHK8_MYCA9      QEMALAAKTLGVEHHWLGFTDSGLQLD-----PGLLPADGFALVPLAESVACLTAVIEQF
B0RH34_CLAMS      IEMARAQAVMGVQHRWLGYVDSGMARE-----DGSLPPAAFASIPVEVSAEPLVRLVREF
                   *:  *   :*: :   *  ***            :.   *           :   ..  

MCA_MYCS2         RPHVMTTYDENGGYPHPDHIRCHQVSVAAYEAAADHLLYPDAG-----EPWAVQKLYYNH
MCA_MYCTU         RPHVMTTYDENGGYPHPDHIRCHQVSVAAYEAAGDFCRFPDAG-----EPWTVSKLYYVH
B1MKJ9_MYCA9      RPHVMTTYDENGGYPHPDHIRCHEVSMAAFEAAADPEQFPEAG-----EPWTVSKIYYNH
F6EQ39_HOYSD      RPHVMITYDENGGYPHPDHIMCHKVSMAAFEAAGDPEQFPDAG-----KPWEPLKIYYVH
H6MSI6_GORPV      RPHVMITYDERGGYPHPDHIMCHKVSVAAFESAGDPDAYPGTG-----EPWTVSKLYYTH
H6QZJ8_NOCCG      KPHVMTTYDETGGYPHPDHIRCHEVSVAAFEAAGDPEQFPDAG-----EPWTPLKLYYNH
D6Z904_SEGRD      RPHVMTTYDEKGGYPHPDHVRCHEVSMAAFEAAADPGRFPEAG-----PAWQVSKIYYDH
C4LHN0_CORK4      RPHVMITYDENGGYPHPDHIKTHAVSVRAWLRAGDPDFHPEKG-----EPWVVSKMYYTH
G0HFP1_CORVD      RPHVIITYDENGGYPHPDHIKTHAVSVRAWERSGDPDYRPDLG-----EPWTVQKMYYTH
F8E0G9_CORRG      RPHVVITYDENGGYPHPDHIKVHAVSMRAWGAAADPDYHPELG-----APWEIKKLYYTH
C6WKR7_ACTMD      RPHVIVTYDENGGYPHPDHIRCHEVSIAAFDAAGDPDAHPELG-----EPWQPLKLYYSH
G0FRL5_AMYMS      RPHVITTYDENGGYPHPDHIRTHEVSMAAWDAAPDPARFPDAG-----EPWQPLKLYYVH
F4CIX5_PSEUX      RPHVLVTYDENGGYPHPDHIRTHEVSMAAFDAAGDPDRYPDAG-----EPWQPLKLYYSH
I0H605_ACTM4      RPHVLVTYDEIGGYPHPDHVRSHEVAVAAFDEAADDAAHPGAG-----PAWQTLKLYYVH
G0G6W9_AMYMS      RPHVVITYDETGGYPHPDHIRTHEVTVEAFTAAADPARYPGTG-----EPWQPQKLYYQA
A6W700_KINRD      RPHVMTTYDESGGYPHPDHIMTHVVSRAAFDDAADPAKFPRA-----GEPWKTSKLYYHA
E1VTM1_GLUAR      RPHVITTYDENGGYPHPDHIHCHKVSTFAFEHAANPEMYPEL-----GAPWSVSKLYYDR
C7QZX6_JONDD      RPHVVTTYDPSGGYPHPDHIRCHEVSWAAFHAAGDADAFVGT-----GEPWQPLKLYYNH
MCA_STRCO         RPQVITTYDENGGYPHPDHIMTHKITMVAFEGAADTEKYPESEY---GTAYQPLKVYYNQ
E4NG89_KITSK      RPHVITTYDENGGYPHPDHIMTHKITMAAFEAAGDPAAYPEA-----GEPWQPSKLYYNH
D2PP24_KRIFD      RPQVVTTYDENGGYPHPDHVMCHQITVAAFEAAGDQDAYPEL-----GAPWQPLKLYYHH
F5XTG2_MICPN      RPQVMTTYDENGGYPHPDHIRCHQVSVAAYDAAADPEAYPEA-----GEPWQVAKLYYQF
I6XRZ2_PSEPQ      RPHVVTTYDERGGYPHPDHVQCHRITVEAFKAAADPSLWPEH-----GPAWQAAKLYYHM
D1A8F7_THECD      RPHVMLTYDEKGGYPHPDHVMCHRVSVEAFEAAGDPDRYPGTG-----EPWQPLKLYYHM
D2B2F3_STRRD      RPHVILTYDDDGGYPHPDHIMTNRVSVEAFEAAGDPDRYPGTG-----EPWQPLKLYYQM
Q47ST0_THEFY      RPHVMITYDEQGGYPHPDHIMCHKVSVEAFEAAADPERYPGTG-----EPWQTSKLYYHV
D7B6Z3_NOCDD      RPHVILTYDENGGYPHPDHIMTHKVTMHAFDTAGDPDAYPDAG-----DPWQPLKLYYFV
E3ITI9_FRAIE      RPQVITTYDENGGYPHPDHIMTHKISAVAFEAASDPERFPEHGVDAGLEPWQPLKLYYHL
A8L168_FRASN      RPQVVTTYDENGGYPHPDHIMTHRISVEAFEAAGDPARYPEVGADVGLGPWQPLKLYYHL
F8AVV1_FRADG      QPQVVVTYDENGGYPHPDHIMNHKITIEAFEAAGDRARYQEVGQDVGVAPWQPLKLYYHQ
D9TB41_MICAI      RPHVVTTYDEEGGYPHPDHIMTHKITVAAFDAAGDPDRHPELG-----EPWQPLKLYYDV
D3Q737_STANL      KPHVVITYDEDGGYPHPDHIKTHVISMEAFDAAGDPERYKEFG-----EPWQPSKLYYHM
H6RSK5_BLASD      KPQVITTYDERGGYPHPDHIKTHEISVHAFEAAGDPDRYPELG-----EPWQPSKLYYHM
C7MEV0_BRAFD      RPHVMTTYDENGGYPHPDHIQTNRISLAAFDLAADPQFAPELG-----EPWAIAKLYYIN
B1MHK8_MYCA9      RPHVMVTYNECGGYPHPDHIRCHQMAVAAYGACPDVAKLYYFH----EIVRVTPRMVRFA
B0RH34_CLAMS      RPHVLVAYDENGGYPHPDHIQAHVIAMEAWRESGVAGSYPDAG-----EPWEISKLYFDR
                  :*:*: :*:  ********:  : ::  *:  .                     ::    

MCA_MYCS2         GFLRQRMQLLQEEFAKNG--QEGPFAKWLEHWDP------DNDVFANRVTTRVHCAEYFH
MCA_MYCTU         GFLRERMQMLQDEFARHG--QRGPFEQWLAYWDP------DHDFLTSRVTTRVECSKYFS
B1MKJ9_MYCA9      GFMRARMQLLNDECKKHG--YKGPFDEWLERWPA------DDDTFDRRVTTRVPCADFFD
F6EQ39_HOYSD      GFLRDRIQIFQDDFESRG--EPSPFREWLKSWKP------RQGDIMGRVTTQITCGEYFP
H6MSI6_GORPV      GFIRDRMILFSDEFERHG--QESPFKEWLSKWDS------SRGDLMARVTTQVECGKYFP
H6QZJ8_NOCCG      GFSIRRLEVFAEEYDRVG--EPFPMQEWLDRMRKYAV---ERGDVMTRVTTQVECAKYFA
D6Z904_SEGRD      AFIRKRLVQFHELLLERD--GESPYTELLANVPE-------DEDKSHRVTTSVPCAAYFP
C4LHN0_CORK4      GFVKSRFLALHNDFINRG--LPSPYQDRVDKADE-------WPDLMERVTTQVNVADFFH
G0HFP1_CORVD      GFIRRRFELLAQAEEEAG--HLTA-ASALERWND-------VPDIMPRVTTQIACAPWFV
F8E0G9_CORRG      GFIRQRFELLTDAMQHRGIELPGSILQFVNLTKK-------LPDLMNRVTTRVNVGEWFE
C6WKR7_ACTMD      GFSRAKLTAFHEAILARG--EESPYAEWLSGWNK-D-----QPDVMERVTTQVECADYFP
G0FRL5_AMYMS      GFSRARMVLFDEALKEAG--LESPYTEWLANWDP-N-----RGDVMERVTTRVECSEYFE
F4CIX5_PSEUX      GFSKARMIAFHEALLARG--LESPYAEWIERWEDGD-----RKDPGERVTTRVRCDEWFP
I0H605_ACTM4      EWCGAKMRAFHDALLASG--RPSPYHEWLAEWTP-------QRDVTGRITTRVPCGDYFT
G0G6W9_AMYMS      TLSRAWFQALHEATLAAG--LESSMAEVLNELPP----------DKFPVTTKIRCEAHFA
A6W700_KINRD      GFSRERMRTFHEALLAQG--KESPFAEWMKRFEEQDANPDAAKRAELEITTRVECGEFFE
E1VTM1_GLUAR      AFAPDRFRTLHYAMLEAG--YESPYTERVAMWEEDQDNQMFKWVSPHTTTTQIDCADFFS
C7QZX6_JONDD      DFSMNRVSTLHRAMIDAG--LESPYGGWVESRE-------AREIPERQATTRVECADFFD
MCA_STRCO         GFNRPRTEALHHALLDRG--LESPYEDWLKRWSE-------FERKERTLTTHVPCADFFE
E4NG89_KITSK      GFPMGRIRALHAYLSENG--HDSPYGEWIEGWEK-------SGRAEREITTRVECADYFE
D2PP24_KRIFD      TFHRERMKALHDAMLARG--LESPYAERLDDWKP-------DPENERRITTRVECAQYFG
F5XTG2_MICPN      GFHRQKFVALNHAMIEAG--LESPYAERLASWKP-------DPEHEKRVTTRVECADYFA
I6XRZ2_PSEPQ      SFHRRRFAALEALMHEQG--LSSSHPVPARDE---------DPFSDGRLTTFVNCAQYFG
D1A8F7_THECD      TFNKERIEALHAAMEKAG--LESPYGDWLKRFEER--------PAPWAVTTRVPCADYFE
D2B2F3_STRRD      GFTKERFEALHEAMNARD--MGSPYADWISRWEDR--------PQKWPVTTRVPCGDYFE
Q47ST0_THEFY      SFPLERFEAIAKVLSDRG--MENPYADWMKRLEKRD-------TRRWEITTRVECGEYFE
D7B6Z3_NOCDD      SFPPERFEALADVLAARG--LENPFEEWMKRIADRD-------HPRWEITTRVHCSEYFD
E3ITI9_FRAIE      TFHKARILALHDAMKAQG--LESPYAERLETWIDRA-------EDSNRLTTQVECGAFFE
A8L168_FRASN      TFHKDRILALHEGMLAAG--LESPYAKRLDEWIDRA-------EDTGRLTTRVPCADWFE
F8AVV1_FRADG      THHKERVLALHDAMRASG--RESPYSDALEKWVDRS-------ADSGRITTRVPCGDFFE
D9TB41_MICAI      GFSRAKIMSLHEAVLAAG--LESPYGEWMKRWDERP-------DKGARITTRVECADYFP
D3Q737_STANL      SFGRARLTALHEAVLAEG--LESPYGEWLESRDWTD-------DKGERVTTKVECASYFP
H6RSK5_BLASD      SFTLPRTKALHEAILATG--AESPYAEWLQKWDPAH-------DISHRVTTRVPCGEYFA
C7MEV0_BRAFD      GFHRQRFAAVSRHLRSEG-TPNEMLDQMLQHYDE---------SHDRLLTTRIDVRDYLA
B1MHK8_MYCA9      GRAERIVSRMPRRQSAAAASTDQRLGDVTVPGWVRVSSMLTRRVGSRRATTLVACGDYFC
B0RH34_CLAMS      IFNGAKIRAVREHLVAAD--AAPEMLEAVDEMLDWMG------DRPDLATTHVHVADHFE
                           .                                       ** :     : 

MCA_MYCS2         QRDDALRAHATQIDPKGDFFHAPIEWQQRLWPTEEFELARARVPVT-LPEDDLFKGVEP-
MCA_MYCTU         QRDDALRAHATQIDPNAEFFAAPLAWQERLWPTEEFELARSRIPAR-PPETELFAGIEP-
B1MKJ9_MYCA9      ARDAALRAHASQIPPDSSFFAVPREFERKLWPTEDFELAKSRVPTS-TPEDDLFAGVETK
F6EQ39_HOYSD      VRDEALRAHATQVDPNGPFFLVPLEMQQRLWPTEEFELAATRVKTA-IPETDLFTGISSG
H6MSI6_GORPV      QRDDALRAHATQIDPNGMFFAVPLEWQQRLWPTEEFELAQTRVTTS-IPESDLFAGVEAN
H6QZJ8_NOCCG      QRDDALRAHATQIDPNGAFFAIPLEIQQRLWPTEEFELARTRVRTA-LPENDLFAGIGDE
D6Z904_SEGRD      QREAALLAHRSQVDPNGFFFAVPVALQQQYWPTEEFELARSLVPTS-QPENDLFAGVQAP
C4LHN0_CORK4      KRDDALRAHATQIDPHSRWFAVSPEDQRRVWPTEEFELAASRVDTS-LPENDLFAGIDPD
G0HFP1_CORVD      RRDEALRAHATQIDPEGPFFAVPTELQEQVWPTEEFELAASRVPAP-VPEDDLFTGVVPD
F8E0G9_CORRG      RRDDALRAHATQVDPQGQFFIGDPEFQREIWPTEEFELAETRVHTE-LPEDDLFAGLDSD
C6WKR7_ACTMD      QRDAALLAHATQIDPASRWFAVPLELQRELWPTEEYELHRSLVDST-VPEDDLFAGI---
G0FRL5_AMYMS      VRDEALKAHATQIDPTSRWFAVPREMQREVWPTEEYELVKSLVDST-LPEDDLFAGIVGA
F4CIX5_PSEUX      VRDEALKAHATQIDPTSRWFFVPPEIQSEVWPTEDYELVRSFVDSP-TPEDDLFAGLVPS
I0H605_ACTM4      HRDDALRAHATQIDPGSHWFAVPLALQRELWPTEDFELVRSLVPVR-LPEDDLFAGI---
G0G6W9_AMYMS      TRDRALLAHATQVDPAHPFFAHSREIERQVWPHEDYHLAHPAPGPH-L-EEDLFTGVTP-
A6W700_KINRD      TRDRALLAHATQIDPDGWFFGVPLELQRELWPTEDYHLAISHVPTR-TPEDDLFAGLRDG
E1VTM1_GLUAR      QRDQALLAHRTQIDPEGFFFAVPEHVYAEHWPWEDYTLISSKVSTE-LPETDLFAGLR--
C7QZX6_JONDD      HRDAALRAHATQIDPQGFFFAVPREVERQVWPVEEYELAVSHVPTS-VPEDDLFAGIRND
MCA_STRCO         IRDKALIAHATQIDPEGGWFRVPMEIQKEVWPTEEYELAKSLVETS-LPEDDLFAGIRDN
E4NG89_KITSK      IRDKALIAHATQIDPDGPWFRVPLAIQREVWPTEDYELAKSLVDTD-LPETDLFAGLRK-
D2PP24_KRIFD      VRDRALLAHATQIDPDGAWFAVPLEVHQEAWPTEDYELARSLVESE-IPENDLFAGLR--
F5XTG2_MICPN      VRDQALIAHATQIDPEGPWFSVPLEIHQRAWPTEDFQLVRSTVETT-LPEDDLFAGIPVA
I6XRZ2_PSEPQ      VRDDALRAHATQIDPEGPWFAVPLAIQQAGWPTEDYQLVVSKVPTM-IPEDDLFTGLREV
D1A8F7_THECD      TRDRALLAHATQIDPDGFWFRCPLEVQRQAWPTEDYHLARSLVDTE-LPEDDLFAGVREK
D2B2F3_STRRD      VRDEALLAHATQVDPDGFWFVCPRELQREIWPTEDYHLARSLVDTE-LPEDDLFTGIHAE
Q47ST0_THEFY      VRDRALLAHATQIDPNSFWFAVPNDIQREAWPTEDYHLARSFVDTE-LPEDDLFAGIRDK
D7B6Z3_NOCDD      VADEALKAHATQVDPNGFWFAVPNEVVAEAWPSEDYHLVRSLVDTE-IPEKDLFAGVREA
E3ITI9_FRAIE      VRDRALLAHATQVDPEGPWFRVPLDLQREAWPTEDYQLARSLIEVGTLPENDLFAGIR--
A8L168_FRASN      VRDRALLAHATQVDPSGPWFQVPLALQRQAWPTEDYQLARSLIEVGVLPEDDLFNGIR--
F8AVV1_FRADG      IRDRALLAHATQVDPNGPWFRVPLEIQRAAWPTEDYQLARSLIEVGVLPENDLFNGIR--
D9TB41_MICAI      VRDDALRAHATQIDPDGFWFQVPMELQKRAWPTEDFQLARSLVDSP-LPESDLFAGVREA
D3Q737_STANL      VRDEALKAHATQVDPEGFWFRVPMEIQQKAWPTEDYELVKSHVATT-KPEDDLFAGLR--
H6RSK5_BLASD      VRDAALIAHATQIDPLGRWFACPVDTQQQVWPTEDYELARSLVDTT-TPEDDLFAGIRSE
C7MEV0_BRAFD      IRDDALRAHATQVDPEGPFFRISHEAETAAWGTEDYELHISRIPVK-LPEDDLFAGLRRE
B1MHK8_MYCA9      VRDRALRAHASQVDPNGPFFLVPWTWRQHLWPTEKFELAHSRVATK-APETDLFAGL---
B0RH34_CLAMS      ARDRALLSHASQVAPDSSFFRWPRDLQQRAWPFEDFQLVESRVDAP-DEEHDLFAGIVDE
                    : ** :* :*: *   :*          *  *.: *  .        * :** *:   

MCA_MYCS2         ------------------------
MCA_MYCTU         ------------------------
B1MKJ9_MYCA9      ------------------------
F6EQ39_HOYSD      DETTSKENERS-------------
H6MSI6_GORPV      SEVSR-------------------
H6QZJ8_NOCCG      HR----------------------
D6Z904_SEGRD      ------------------------
C4LHN0_CORK4      HQPDNVPGMVSEAARQEYSQGDDD
G0HFP1_CORVD      ------------------------
F8E0G9_CORRG      NND---------------------
C6WKR7_ACTMD      RERVTV------------------
G0FRL5_AMYMS      EEKVNT------------------
F4CIX5_PSEUX      PDAVRVG-----------------
I0H605_ACTM4      GAGVR-------------------
G0G6W9_AMYMS      ------------------------
A6W700_KINRD      A-----------------------
E1VTM1_GLUAR      ------------------------
C7QZX6_JONDD      ------------------------
MCA_STRCO         A-----------------------
E4NG89_KITSK      ------------------------
D2PP24_KRIFD      ------------------------
F5XTG2_MICPN      SGRELD------------------
I6XRZ2_PSEPQ      PLVPEFII----------------
D1A8F7_THECD      VCL---------------------
D2B2F3_STRRD      EVSPACH-----------------
Q47ST0_THEFY      V-----------------------
D7B6Z3_NOCDD      VRV---------------------
E3ITI9_FRAIE      ------------------------
A8L168_FRASN      ------------------------
F8AVV1_FRADG      ------------------------
D9TB41_MICAI      CRAH--------------------
D3Q737_STANL      ------------------------
H6RSK5_BLASD      VTVR--------------------
C7MEV0_BRAFD      RVEARP------------------
B1MHK8_MYCA9      ------------------------
B0RH34_CLAMS      DQAAVA------------------