CLUSTAL format seed alignment for MF_01484

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ACRZ_ECOLI            ----------------------------------MLELLKSLVFAVIMVPVVMAIILGLI
Q1REG9_ECOUT          --------------------------------MTMLELLKSLVFAVIMVPVVMAIILGLI
A8AJ32_CITK8          MTENRFRAKSTAQKGSAFLIYAVRISKESYLELTMLELLKSLVFAVVMVPVVMAIILGLI
B7LJZ7_ESCF3          MTENHCRAKTTAQKGSAFLRYTVRINKGLHLELTMLELLKSLVFAVIMVPIVMAIILGLI
A9MJH6_SALAR          MTEKRGSAKPTAQKGSAFLCYAVKIQKGLYLELPMLELLKSLVFAVIMVPVVMAIILGLV
D2TPG6_CITRI          MTENPACAKPTAQKGSAFLRDAVRILKELNQEMTMLELLKSLVFAVIMVPVVMAIILGLI
E3G3Q8_ENTLS          ----------------------------------MLELLKSLVFAVIMVPVVMAVILGLI
A0A0H3FQE5_KLEAK      -------------MGRVFPAEMVTMKYSYYLEPTMLELLKSLVFAVVMVPVVMAVILGLI
L0M573_ENTBF          ----------------------------------MLELLKSLVFAVIMVPIVMAIIMGAI
A7MIY3_CROS8          -MKESGGSAQMAQKGRMFRADAARMTVYCFQEATMFELLKSLAFAVIMVPVVMAVILGLI
A0A198GNU1_9ENTR      ----------------------------------MLELLKSLVFAVIMVPVVMALILGAI
I2BB18_SHIBC          ----------------------------------MLELIKSMVTAVIMVPIVMAVILGLI
D2BVE9_DICZ5          -------------------MLAAQRPATVKDEVDMLELLKSLVFAVCMVPVMMALILGAI
C6CCT9_DICP7          ----------------------------------MLELLKSLLFAVCMVPVMMAVILGAI
S4YIH8_SERPL          ----------------------------------MLEMIESLATVVILVPVMIAVLLGSI
A0A0H3L1I8_PANAA      ------------------------------MGLFMLELIKSLAVAVIMVPVVMAIMLGLI
E6WC59_PANSA          ----------------------------------MLELLKSLAVAVIMVPIVMAIMLGLI
S4YDK3_SERPL          ----------------------------------MLELLKSLLFAVVMVPVVMAIILGLI
A8GBB6_SERP5          ----------------------------------MMELLISLLFAVVMVPIVMAIILGLI
A1JS39_YERE8          ----------------------------------MLDLLKSLLFAVVMVPVVMAVILGMI
A0A2U2GZS4_YERPE      ----------------------------------MFELLKSLVFAVVMVPVVMAVILGLI
C5BEK5_EDWI9          ----------------------------------MFELLKSLVVAAIMVPVVMAIIMGLI
H2IWG9_RAHAC          ----------------------------------MLELLESLIFAAIMVPVFIAVILGLI
D2T346_ERWP6          ----------------------------------MLELLKGLAVAVLMVPVVMAIILGLI
B2VBU8_ERWT9          ----------------------------------MLELLKGLAIAILMVPVVMAIILGLI
D4HZF3_ERWAC          ----------------------------------MLELLKGLALAILMVPVVMAIILGLI
D8MPV2_ERWBE          ----------------------------------MLELLIGLGEAILMVPVVMAIILGLI
A0A0H3I8D8_PECPM      -----MAITTISAYRKIAHQAAKVAVTVAISEVSMLELLKSLLFAVAMVPVMMVLIMGSI
D3UZU1_XENBS          ----------------------------------MFELIGSMAFALIMVPVVMALILGLI
D3VAQ7_XENNA          -------------------------MSRSGYEVGMFELIRSLGFALIMVPVVMAAILALI
Q7N6R6_PHOLL          ----------------------------------MFELIKSMAFALVMVPVVTVGILGLI
B4EST6_PROMH          ----------------------------------MFELLKSLGFALLMVPVVMVLIMGII
A0A140NQ55_PROSM      ----------------------------------MLEILKSMGFALLMVPVVMFLIMGLI
C4K5R8_HAMD5          -------------------------------MLAMFELLKSFLFALLMVPVMITMILSLI
                                                        *:::: .:  .  :**:.   ::. :

ACRZ_ECOLI            YGLGEVFNIFSGVGK---KDQPGQNH-----
Q1REG9_ECOUT          YGLGEVFNIFSGVGK---KDQPGQNH-----
A8AJ32_CITK8          YGLGEVFNIFSGIGQ---KDQSRQNH-----
B7LJZ7_ESCF3          YGLGEVFNIFSGIGQ---KDQSRQNH-----
A9MJH6_SALAR          YGLGEVFNIFSGIGQ---KDQSRQNR-----
D2TPG6_CITRI          YGLGEVFNLFSGIGQ---KDRSRQNH-----
E3G3Q8_ENTLS          YGLGEVFNVLSGIGH---KDGPQKNH-----
A0A0H3FQE5_KLEAK      YGLGEVFNIFSGVGH---KDSSQQNH-----
L0M573_ENTBF          YGLGEVFNIFSGVGH---KDNRPQNH-----
A7MIY3_CROS8          WGLGEVFNIFSGIGH---KDQSKQHR-----
A0A198GNU1_9ENTR      YGLGEVFNVFSNIGH---KDQPKKQH-----
I2BB18_SHIBC          YGLGEVFNVLSGIGH---RDTSTRQR-----
D2BVE9_DICZ5          YGLGEVFNLFSAIGH---RESSAARK-----
C6CCT9_DICP7          YGLGELFNLFSAIGTGGRRDSSLVSK-----
S4YIH8_SERPL          YGLGEVFNVFSAIGR--KKD-----------
A0A0H3L1I8_PANAA      YGLGEVFNLISKTGR---RDNNNARS-QN--
E6WC59_PANSA          YGLGEVFNVISKFGR---RDDRPANSSQH--
S4YDK3_SERPL          YGLAEVFNIFSKVGR--SKENRTQH------
A8GBB6_SERP5          YGLGEVFNVFSKVGH--SKENRT--------
A1JS39_YERE8          YGLGEVFNIISKTGH--TKERS---------
A0A2U2GZS4_YERPE      YGLGEVFNVISKTGH--PKERNTLRS-----
C5BEK5_EDWI9          WGMGELCNLISAWGH---PEE-KES------
H2IWG9_RAHAC          WGLGEVFNLISHVGH---SKESREKPHY---
D2T346_ERWP6          WGLGEVFNVISKLGH---RDGSSANKSHSAR
B2VBU8_ERWT9          WGLGEVFNVISKFGH---RDDSAENKSHSAR
D4HZF3_ERWAC          WGLGEVFNIVSRLGH---RDNRQATKGHSVR
D8MPV2_ERWBE          WGLGEVFNVISTIGH---KKDQTEQSRH---
A0A0H3I8D8_PECPM      YCLGEVFNVLSRIGH---SDGQRANNQH---
D3UZU1_XENBS          YGLGAVFNVISKTGN---TERQP--------
D3VAQ7_XENNA          YGLGGLFNTISKNEA---KSSVEQ-------
Q7N6R6_PHOLL          YGLGELFNIVSRIGR---SEK----------
B4EST6_PROMH          YGLGEIFNLISPSQS---KADKKA-------
A0A140NQ55_PROSM      YGLGAFFNLLSKAHV---PHHHTEKE-----
C4K5R8_HAMD5          YGFGKIFNLISHKND---HSSSL--------
                      : :. . * .*