CLUSTAL format seed alignment for MF_01485

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RECB_MYCTU            ----------------------MDRFELLGPLPREGTTTVLEASAGTGKTFALAGLVTRY
RECB_MYCS2            ----------------------MKVFDLLGPLPAPNTTTVLEASAGTGKTFALAGLVTRF
RECB_ECOLI            ------------------MSDVAETLDPLRLPLQG--ERLIEASAGTGKTFTIAALYLRL
A0A140NNW5_PROSM      ---------------MSKMQISSQLLDAFSLPLQG--QRLIEASAGTGKTYTIGILYLRL
Q8D2T8_WIGBR          -------------------MKKYRKLNPISFPIKG--TCLIEASAGTGKTYSIIIFYLRL
Q057F5_BUCCC          --------------------MQYIPLNTKEIPHFG--ITLIEASAGTGKTFSIIIFYLRL
RECB_BUCAP            --MVYSDTKTSKKIKKYKINIMKKKLNIFQIPLKG--IHLIEASAGTGKTSTIAFLYLRL
RECB_BUCBP            -----------------MITTIPKSINVTTIPLSG--KILIEASAGTGKTFSLTILYIRL
Q493D5_BLOPB          ----------------------MRNLNVLELPLYG--INLIEASAGTGKTYTLIIIYIRL
Q1LST8_BAUCH          -------------------------MNPITLQLKQ--HCLIEASAGTGKTYTLVILYLRL
A1SUW1_PSYIN          -MDKLNKMNTTKTELVVQ------PLNALTFPLYG--QRLIEASAGTGKTYTIASLFIRL
Q87M84_VIBPA          -MDQMSGAECPLHTLDRTEQPQPTPLEPMTFPLHG--ARLIEASAGTGKTFTIAGLYLRL
A6W0A9_MARMS          ------MSLSSESAQAEGLNMVPEPLNALTFPLFG--KRLIEASAGTGKTYTIANLYLRL
RECB_HAEIN            -------------------MAETIPLNPITLPLNQ--ISLIEASAGTGKTYTIGSLYLRL
E1W5R9_HAEP3          ------------------MSQKSTALNAISLPLNQ--VNLIEASAGTGKTYTIGSIYLRL
A6VNJ9_ACTSZ          --------------------MPVQHLNPISTPLQT--TTLIEASAGTGKTFTMASLYLRL
B0BTM4_ACTPJ          ----------------------MKTLSPIELPLNC--TALIEASAGTGKTFTMANLYLRL
B7J9Q6_ACIF2          ---------------------MTTILDPLHLPLHG--SRLIEASAGTGKTWTIAALYLRM
F9ZQ70_ACICS          ---------------------MSRVLDPLSLPLQG--SALIEASAGTGKTYTIATLYLRL
D6CML0_THIA3          ------------------MTAIPDPLDALTLPLQG--SRLIEASAGTGKTWTIAALYLRL
C1D6T6_LARHH          ------------------MSNLMQALDPRRFPLHG--LRLIEASAGTGKTFTIAALYLRL
Q5QUQ8_IDILO          --------MSQLSSHNSGHTLGHKLDNPLDFPLNS--SRLIEASAGTGKTYTIAALYVRL
A1TWK0_MARHV          --------------MTEQRTNRNPNLDPLTLPLNG--SALIEASAGTGKTFTIAILYVRL
D3RS60_ALLVD          ------------------MNTTIQRLNPLEVPLHG--SRLIEASAGTGKTFTLAMLYLRL
K0NNV1_DESTT          ---------------------MPEKLNPLTFPLHG--TRLIEASAGTGKTYTIAALYLRL
K0CGD3_ALCDB          --------------------MSQPRPLPLTFPLHG--TRLIEASAGTGKTFTLAALYLRL
E1SLY0_FERBD          ---------------------MAHKLDALTFPLTG--TRLIEASAGTGKTYTIAALYLRL
G0A1X0_METMM          -------------------MSIARTIDALTFPLSG--TRLIEASAGTGKTYTIAALYVRL
Q1QYD3_CHRSD          -----------MTTFDDAPVAQPQPLVLEHLPLAG--HHLIEASAGTGKTFTLAALYVRL
Q3IJ14_PSET1          ----------------------MQALNPLTMPLTG--QSLIEASAGTGKTYTITGLYLRY
Q15V10_PSEA6          ----------------------MIPLNTKTFPLTG--ASLIEASAGTGKTYTIVNLYLRL
A1S6V0_SHEAM          -------------------MQASMPLDAFTLPFDG--ARLIEASAGTGKTYTIANLYLRL
E8RCD0_DESPD          ----------------------MRPLDPLTLPLDG--RRLLEASAGTGKTYTLALLFVRL
Q2SQD6_HAHCH          ----------------------MRPLDPIAIPLQG--VQLIEASAGTGKTYTITTLYLRL
Q60AZ5_METCA          -------------------MSAVRPLDVFRCPLAG--VNLIEASAGTGKTWNICGLYLRL
Q74CY7_GEOSL          -------------------MTSLRPHDNLTVELSG--HNLVEASAGTGKTFAIACLYLRL
B5EAR6_GEOBB          ----------------------MKRFDLLHTPLAG--RNLIEASAGTGKTFTIAGVYLRL
Q2LTC8_SYNAS          ----------------------MKPFDLLNAPLQG--RNLIEANAGTGKTYAISGLFLRL
A4SEL9_CHLPM          ----------------------MQPLNTSSIALSG--INLVEASAGTGKTYALTELYLRL
A8ZX09_DESOH          -------------------MARREPFDILCADLSGGITTLVEASAGTGKTYAIVGLFLRL
B8FB94_DESAL          ---------------------MTKSNEAQFAPLEG--VNLIEASAGTGKTYTLTSLYIRL
C7LVF7_DESBD          ----------------------MEPMDLCTAPLDG--TTLIEASAGTGKTYTLTGLFVRL
Q7NQR1_CHRVO          -------------------MNAPQALDALNCPLQG--VNLIEASAGTGKTWTIAALFARL
I1XM81_METNJ          ----------------------MKQFDLLQTPLHD--VNLIEASAGTGKTFTLAGLYLRL
M1PKI5_DESSD          -------------MSVNS-------FDAASAVLNRG-VNVVEASAGTGKTYAIAMLVLRF
Q6ANK1_DESPS          -------------MSYKAGTPDPIIFDVAKTPMERG-VNFIEASAGTGKTYAIGMLVLRA
G4SWQ2_META2          -------------MLSEH-------FDPITTDCRQG-INLIEASAGTGKTYAIAMLALRF
F5ZCK0_ALTNA          ----------MSLSNREASTSASQLLNVPAMPLKG--RHLIEASAGTGKTYNITRLYLRL
Q480N9_COLP3          MTQFDTSDSQQTATKDNHQEVTLQNLDAATIELTG--KHLIEASAGTGKTYNITRIYLRL
RECB_BORBU            -------------------------MNKILEKIQNNTTILIEASAGTGKTHILENVVINL
Q0SMM1_BORAP          -------------------------MDKILEKIQNNSKILIEASAGTGKTYILENLVINL
RECB_CHLTR            ----------------------MSSFDIFSPTASVSGKFFLEASAGTGKTFTIEQVVLRS
RECB_CHLMU            ----------------------MSSFDIFSPTTSVSGKFFLEASAGTGKTFTIEQVILRS
RECB_CHLPN            ----------------------MKPFNIFDSNSSIQGKFFLEASAGTGKTFTIEQIVLRA
C6S650_NEIML          ------------------MSAPIQAFDPLTVPIAG--TNLIEASAGTGKTYGIAALFTRL
F4HA58_GALAU          ---------------------MNTPLNVITLPLAQ--NNIIEASAGTGKTYTMVTLYLRL
D0KVH3_HALNC          --------------MPLSKSNMPLPLNPLTFPFAG--SRLIEASAGTGKTFTIALLYVRL
F6DBR3_THICA          ----------------MTHSNHYPAFEVMTHDLKPE-SCLIEASAGTGKTFSIAFLVLRL
Q5NF53_FRATT          ----------------------MDNLNANTITLQG--RHIIEASAGTGKTFNITKLYIRL
B2FP80_STRMK          ------------MNTAITEDGSESLSRDPYLALSLEGIRLIEASAGTGKTFTLATLFTRL
C1ACJ1_GEMAT          ------------------MSRAAGPFDVARSPFPPG-ISLIEASAGTGKTFNIAMSVVRL
F8E603_FLESM          --------------------MGHNYFNIQECPIEG--SNLIEASAGTGKTYSIASLFLKA
D4H410_DENA2          --------------------MKRKQMELLTAPLTG--TSLIEANAGTGKTYNITALFTRM
C7PDT4_CHIPD          ----------------MNEHINYQDFNAATVPLQD--SNLIEASAGTGKTYSIAILVLRL
                                                             .:**.******  :     . 

RECB_MYCTU            LAETAA-------------TLDEMLLITFNRAASRELRERVRGQIVEAVGALQGDAP---
RECB_MYCS2            VAEGVA-------------TLDQMLLITFGRAASQELRERVRAQIVAALVALDDPSR---
RECB_ECOLI            LLGLG-----GSAAFPRPLTVEELLVVTFTEAATAELRGRIRSNIHELRIACLRETTDN-
A0A140NNW5_PROSM      LLGLG-----GENAFPRPLTVEEILVVTFTEAATNELRGRIRERIHKMRLACIRDGVGFE
Q8D2T8_WIGBR          LLGLN-----IK-SFPHGLSVKEILLVTYTEFAKNQLKERIRKGIIHLKSACINKD----
Q057F5_BUCCC          ILNIG-----IKKSYSSPIPIKKILIVTFTETAKNELKERLYKKICQLYYMSINKNYYV-
RECB_BUCAP            LLGLE-----KNKENIRKLSVKEILVVTFTNAAKEELYIRIKKSIKELHLSCIKKKSKD-
RECB_BUCBP            LLGIT-----NHVKYKKGLLIKEILVVTFTEHTRAELEIRIKTYIKIFKTACIKKYSNN-
Q493D5_BLOPB          LLCLG-----NRSDFSRPLTVKEILVVTFTKSAVRELRHRIRENIHQFRLDCMRGYSHN-
Q1LST8_BAUCH          LLGIG-----GLSAYHRPLSITEILLVTFTEAAIKEIRSRIHDTIHRLRISCVCGYSND-
A1SUW1_PSYIN          LLGHG-----EQAAHQGPLTVDQILVVTFTEAATAELRNRIRERIQDVRLDFIQGESDN-
Q87M84_VIBPA          LLGHGS----AETRHRVPLTVDQILVVTFTEAATAELRDRIRARIHDARIAFARGQSSD-
A6W0A9_MARMS          LVPTG-----QAGDLDKPLTVDQILVVTFTEAATAELKARIRGRIRAARKALLQGESSD-
RECB_HAEIN            LLKAGE----NN--FSRPLNVEEILVVTFTEMATEELKKKIRERITDAINKLTAFAKTQD
E1W5R9_HAEP3          LLQAGE----NR--FSRPLNVEEILVVTFTEMATEDLKRKIRERLTAAISVFSEYYETKD
A6VNJ9_ACTSZ          LLQAGD----NA--FSVPLTVEQILVVTFTEASTEELKERIRARIHLAKAQFAAYRETQD
B0BTM4_ACTPJ          LLGVG----------CASLTVEQILVVTFTKAATEELRDRIRRNIKACRRFLQEYDAEK-
B7J9Q6_ACIF2          ILGHGSEGEHFPRP----LLPEDILVMTFTRAATQELKERIRDRLQTAARYFRGTEH---
F9ZQ70_ACICS          LLGHG---EPATLP----RQPREILVMTFTRAATEELRERIALRLYAAMTALREGAP---
D6CML0_THIA3          VLGHGTEATAFARP----LSPEQILVMTFTRAATRELAERIRARLVEAAQCFQGALA---
C1D6T6_LARHH          VLGARSEDDGLAFNAGG-LLPPQILVVTFTEAATEELRERIRSRLVEAARAFRQN-----
Q5QUQ8_IDILO          VIGHGSHNGAEETAFDRELVPKNILVMTFTKAATEELSDRIRARLAEAAAYFRDPEA---
A1TWK0_MARHV          VLGHGQ----SEDSPLQNLLPPNLLVVTFTEAATKELRDRIRTRLTQAAEVFSEAADSLE
D3RS60_ALLVD          VLGHG-----GETAFARQLMPPEILVVTFTNAATEELRDRIRRRLVEASLVFRNQSS---
K0NNV1_DESTT          VLGHG-----KENGFFRPLIPPEILVVTFTNAATEELRERIRNRLTEAAAFFRGQG----
K0CGD3_ALCDB          VLGHG-----GRAAFRQPLLPPEILVVTFTEAATEELRERIRDRLAEAARVFADPQA---
E1SLY0_FERBD          VLGHG-----GSAAHPHPLTPEQILVVTFTKAATEELKDRIRARLVEGAACFRGLA----
G0A1X0_METMM          ILGHG-----LQG---AELLPPDILVVTFTDAATKELRERIRSRLTQAAAFFREKP----
Q1QYD3_CHRSD          VLGPLP--GREACDYPRPLLPPEILVVTFTEAATAELRGRIRARLKEARDWLLAPPE---
Q3IJ14_PSET1          LLGMQIADD-ANSLLNKPLSVEQILVVTFTDAATQEIKDRVRNRIITARDALLGQDP---
Q15V10_PSEA6          LLGDECT----------PLSVDKILVVTFTNAATAELKQRIRQRLQRAYLDFYAGVS---
A1S6V0_SHEAM          LLGIGQQ---------RPFKVEEILVVTFTNAATSELRDRIRRRIQDGFRLCLGEPS---
E8RCD0_DESPD          LLE-RGLA------------IDQILVVTFTRAATAELRDRIRTRLREALDVLHG------
Q2SQD6_HAHCH          LLE-RQLD------------VRQILVVTFTRAATEELRTRIRQRIREVMQTLQA------
Q60AZ5_METCA          LLE-QERE------------VQNILVVTFTNAATAELRERIRSRIVETLVYLRGGGG---
Q74CY7_GEOSL          VVEGEGLL------------PDNILVVTFTEAATKELRARIRQRLRQARDRFAGGG----
B5EAR6_GEOBB          VLE-QKFD------------VSRILVVTFTEAATKELKERIRNKLKEAENGFLTGA----
Q2LTC8_SYNAS          IVE-HALQ------------VGEILVMTYTVAATEELKDRIRCTLSRALEALGHGR----
A4SEL9_CHLPM          IIE-KELL------------PESILVVTYTEAATKELRQKIRERIRDTTAMLASPL----
A8ZX09_DESOH          IAE-TDAG------------VDNILAVTYTEAATQELKGKIRTALRKAATAFKTGT----
B8FB94_DESAL          LIE-KGLL------------VDQILVVTFTVAATQELKDRIRNRLKIARDAFDGKE----
C7LVF7_DESBD          LLE-KNLT------------VDQILVVTFTDAATEELRGRIRKRLSDVAGVLAGEL----
Q7NQR1_CHRVO          LLEERDGAP--------PPAIERILVVTYTKAATAELRERLRRRLAEMLALLDGKAD---
I1XM81_METNJ          ILEHQ-------------LNVDQILVVTYTRAATQELRDRLRKKLSDERKLILNEQ----
M1PKI5_DESSD          VVEFE-------------VAVEELLVVSYTRAATEELRSRIRTRLLEARNILTDGSR---
Q6ANK1_DESPS          ICEQD-------------IGIDRILIVTFTRAAAEELRSRVRARLVEARDLLQGRHE---
G4SWQ2_META2          VVEFD-------------MKIDELLVVTFTKAATEELKERIRLRLNEAKQAASGKTE---
F5ZCK0_ALTNA          LLEKK-------------LNVKEILVMTFTKAATEEIKGRVAKTLREASAFWEACLDVND
Q480N9_COLP3          LLERE-------------LTVEQILLMTFTKDATQELRGRIDAFIRLALSDWDS------
RECB_BORBU            IKTKLY-------------SINEILVLTFTKKATEEMHTRILKVIENAYSNSKTNEI---
Q0SMM1_BORAP          MKTKLY-------------SINEILVLTFTKKATEEMHARILKAIENAYFNSKTNEI---
RECB_CHLTR            LLEGSI------------EQTKNILVVTFTNAATNELKLRIQASLKQALSLFSQALS---
RECB_CHLMU            LLEGNV------------EQTKNILVVTFTNAATNELKLRIQESLKQALTLFSQALS---
RECB_CHLPN            LIEGSL------------THVEHALAITFTNASTNELKVRIKDNLAQTLRELKAVLN---
C6S650_NEIML          IVLEQK-------------NVERVLVVTFTKAATAELKTRLRARLDDVLQVLESKEIAEL
F4HA58_GALAU          LLQAGENN------FPTPLDIEQILVVTFTRDATRELRQRIRERTQSWLKLLESYQQNR-
D0KVH3_HALNC          VLGHGT----------EPLMPPQILVTTFTDAAADELRDRIRARLFEAYRIFSEAGSELD
F6DBR3_THICA          VVEKA-------------LPIEQILIVTFTDAATQELRERVRQRLVDAKNALNGEVG---
Q5NF53_FRATT          LLEKK-------------LLPSNILVMTFTKDATQEIIGRVEKEIRDVLASYTDEKKES-
B2FP80_STRMK          VVEQG-------------LRIGQILAVTFTDAATQELRKRIRERLALAARLVDLEAA---
C1ACJ1_GEMAT          LLEQDAAG------QPIVSGLGGILVVTFTNAATEELVTRVRRMLQLAHEVWSGALYAK-
F8E603_FLESM          LLEKRV------------KSVKNILVLTFTKAATAEIKLRIYENLLTAKRMLEETSENVR
D4H410_DENA2          VTELQY-------------PVESILVVTYTNAAVSDLKAKIYKRLNDVLLAMVSLRDSVE
C7PDT4_CHIPD          VLENGL-------------SIKEILMVTFTKAAVAELEERIRLFVRTAYKISQGQETR--
                      :                       *  ::   :  ::  ::                   

RECB_MYCTU            -------------------------------PSGELVEHLLRGSDAERAQ---------K
RECB_MYCS2            -------------------------------ACNDLEEYLVK---TDQQA---------R
RECB_ECOLI            ------------------------------PLYERLLEEIDDKAQ--------------A
A0A140NNW5_PROSM      ----------------------------KEPEYLELLSQIPTPEQREF-----------A
Q8D2T8_WIGBR          -------------------------------ETHPLFKEIKNVKK--------------S
Q057F5_BUCCC          ------------------------------KDLKDFKKEIKDFKK--------------I
RECB_BUCAP            ------------------------------PIFQSFLTKIKNFDE--------------A
RECB_BUCBP            ------------------------------YVLSKLLSKITDFPK--------------T
Q493D5_BLOPB          ------------------------------FLFSKLLLQIHNVEL--------------A
Q1LST8_BAUCH          ------------------------------PLLAALLLQIKNIPL--------------A
A1SUW1_PSYIN          ------------------------------PFTQSLLKEVVDHQV--------------A
Q87M84_VIBPA          ------------------------------PVIQPLLNEFDDHKQ--------------A
A6W0A9_MARMS          ------------------------------VFLADWLVQMSDEQR-AG-----------A
RECB_HAEIN            ----------------------------KSAFKND--EFLTALCDNL--------NIFEA
E1W5R9_HAEP3          ----------------------------KAIFTGEH-QFLAELLPYLK-------DIPTA
A6VNJ9_ACTSZ          ----------------------------LTVFLNTDNEFLVKENGQLTDRFLAKLDPNEA
B0BTM4_ACTPJ          --------------------------------TYDINDFFFQLHQQIE-------SVEEA
B7J9Q6_ACIF2          -----------------------------PAQPDPFLEALLADHPDPE-------VRARA
F9ZQ70_ACICS          -----------------------------PASGDALLQRLLRDYPDPA-------TRAAA
D6CML0_THIA3          -----------------------------PKVDDEFLLRLLDSYPPGS-------ARQTA
C1D6T6_LARHH          ------------------------------DSDDAFLRGLLDDYPAG--------QRGRH
Q5QUQ8_IDILO          -----------------------------VEGDPFLASLREDCAAQGQ-------NLMHL
A1TWK0_MARHV          ----------------------------PTPETALIHKLRDDSYPDPA-------SWPEC
D3RS60_ALLVD          ----------------------------PGSSDPLLLDLRDQ--MAGG-------DLAHS
K0NNV1_DESTT          ------------------------------DGDEFLENLKAE-YDPD--------HLPGK
K0CGD3_ALCDB          -----------------------------HKPDLILQGLLDD-YADDE-------QRRHC
E1SLY0_FERBD          ------------------------------EPDPYLASLMAD-FPAE--------QHPHC
G0A1X0_METMM          -----------------------------ADGDDFLQRLREA-YPAE--------QWAAC
Q1QYD3_CHRSD          ----------------------------ARHDDVLGALLTPLVEAGQT-------AVASA
Q3IJ14_PSET1          -----------------------------------KDELIAGVIAAVD-------DKHRA
Q15V10_PSEA6          -----------------------------------SDDFTQYLIERSD-------NIELD
A1S6V0_SHEAM          -----------------------------------EDRFLTQLLHALP-------DRQLA
E8RCD0_DESPD          -------------------------------RRDADPLLLRLLTALPA-------AR--S
Q2SQD6_HAHCH          -------------------------------PPETDIAEWLQPWRDPE-------RNGDA
Q60AZ5_METCA          -------------------------------AADPFVTGLVAALEGGF-------DRALL
Q74CY7_GEOSL          -------------------------------APDEFLDRLALGERWP--------GHATA
B5EAR6_GEOBB          -------------------------------TDDFLIEGLLKSTQ----------DHSEA
Q2LTC8_SYNAS          -------------------------------VEDLFLDSFVRRLAEDD-------RTNSA
A4SEL9_CHLPM          -------------------------------ECTKRLASLGSLAM-EK-------GAGEV
A8ZX09_DESOH          -------------------------------MSGDPLIDGLLKKR-ET-------TRAVA
B8FB94_DESAL          -------------------------------VDDDLVQAVVKEHN-----------NPQS
C7LVF7_DESBD          -------------------------------EADEELEWDLLARF----------GGTDA
Q7NQR1_CHRVO          -------------------------------GDDF-LRALAARFPEGP-------ARDVA
I1XM81_METNJ          -----------------------------------------------P-------HRNED
M1PKI5_DESSD          --------------------------------SGDDPALLAYLDNLPN-------KALA-
Q6ANK1_DESPS          --------------------------------DASLRAWQEHAVKDEG-------VARRF
G4SWQ2_META2          --------------------------------HID-GAIITWLNRLEI-------DRDLI
F5ZCK0_ALTNA          INTASASAGNDSASIDNDDVKESADLAALLNSADPVYAHLYRACSPKD-----------S
Q480N9_COLP3          -----------------------------LCLKDAYFATLAQRIEKKQ-----------R
RECB_BORBU            ------------------------------------------------------------
Q0SMM1_BORAP          ------------------------------------------------------------
RECB_CHLTR            ----------------------------------HPGTPLPPYISSSE------TKVKQL
RECB_CHLMU            ----------------------------------HPETPLPPYVSSQE------TKVKQL
RECB_CHLPN            ----------------------------------SQPASLPTYLDIN-------CNVKQI
C6S650_NEIML          GDGALSDGIAAYCA--------------EHHKGDTFLPALLKQALQKE-------GRTRL
F4HA58_GALAU          ------------------------------DKSEIKDNELLALLPYLED------HLALA
D0KVH3_HALNC          -----------------------------PIAVDPYLLDLRAAFPTSE-------ERLAA
F6DBR3_THICA          -------------------------------NDELLNNWLAQLDNIVP--------KADA
Q5NF53_FRATT          --------------------------------------------------------DKEN
B2FP80_STRMK          --------------------------------DDEAPEVRLTRDVLQRHLQCGTESAAAL
C1ACJ1_GEMAT          --------------------------------SNSEIEILRELANGRE---------PWA
F8E603_FLESM          EHLFE---------------------------KEPVIRDILKPYLDER---------SEA
D4H410_DENA2          -------------------------------ITMEDEFPLDYALKRKE-------NLTKD
C7PDT4_CHIPD          --------------------------------DENIFRLVEEAVERNG--------LAAV
                                                                                  

RECB_MYCTU            RSRLRDALANFDAATIATTHEFCGSVLK--SLGVAGDNAAD-VELKESLTDLVTEIVDDR
RECB_MYCS2            RRRLRDALAGFDAATIATTHQFCQIVLK--SLGVAGDSDAG-VTLVESLDDLVSEIVDDL
RECB_ECOLI            AQWLLLAERQMDEAAVFTIHGFCQRMLN--LNAFESGMLFE-QQLIEDESLLRYQACADF
A0A140NNW5_PROSM      INWLLTAERQMDEAAIYTIHGFCQRMLV--HNAFESGVLFE-QTMIQDELPIQKQACADF
Q8D2T8_WIGBR          LIKLIYAEHNIDEASIFTIHGFCHKMLS--ANLIESKFFLD-KNTIEDESYLYNQISKNF
Q057F5_BUCCC          SKLLKKAKKNIDQINIYTIHSFFRKILI--EQKFLCKKKIY-QNIITNIKKIQFEATKDF
RECB_BUCAP            IHILEDAKININNAAIYTIHGFCQDVLE--NNTLISN-----REIIENESFLYLQATQDF
RECB_BUCBP            IDILSKAENSIHELSIYTIHGFCYKILK--LNKFNSELMLQ-NKILKHTYPLYLKISIKF
Q493D5_BLOPB          INQLSEAEKKINQASIFTIHSFCQNILN--HNTIELNMLFN-TNIVDNETILYQQACTDF
Q1LST8_BAUCH          INQLLAAEQQINEAAIFTIHGFCQRMLNINYNLLESSFWSQ-KQLLEDDTHLLQQVVTDF
A1SUW1_PSYIN          IRLLRFAELQMDEAAIFTIHGFCQRMLM--QNAFESGSLFE-QNLLEDDAQLLQLACNDF
Q87M84_VIBPA          AEILLQAERQMDEAAVYTIHGFCQRMLT--QNAFESGSRFN-NEFVTDESHLKAQVVADY
A6W0A9_MARMS          IEKLLYAEKQMDEAAVFTIHGFCQRMLS--QNAFESRMLFQ-QTIETDELAPLSMAVKDV
RECB_HAEIN            IHRLKLAEQNMDLAAIYTIHGFCRRMLM--QYAFHSGIHFN-LELIKDQSDLLVRFANEF
E1W5R9_HAEP3          LRRLKLAEQNLDLASIYTIHGFCRRMLM--QHAFNSGVHFN-LKLLKDQSDLLKQFANEF
A6VNJ9_ACTSZ          FRRLGFAEQNMDLAAVYTIHGFCRRMLM--QYAVNSGIHFN-LELVTDETDLLNRLANDF
B0BTM4_ACTPJ          ILRLRIAEREIDLASIFTIHSFCQKMLF--QFAFDSGMRFD-NDLQPDESDLLRRLSEEV
B7J9Q6_ACIF2          AHQLTLAADAMDDSAIFTIDAWCQRTLR--EHAFATGSDFR-ETLLLDETDLRDDAVRDF
F9ZQ70_ACICS          IIRLENAFNSVDEASIHTIDAWCHRVLR--EHALATGHDPD-AEILTDSAPLRIRAVQDF
D6CML0_THIA3          AWRLAMAAQEMDDAAVFTIDAWCQRMLR--EHAFDSGHSFD-EDLLADEGELTTQAVHDF
C1D6T6_LARHH          AHQLELAAQWMDEAAIFTIHAYCQKMLR--THAFDSGSLFE-LTVNTDESALREQAVNDY
Q5QUQ8_IDILO          ARLLDLASQSMDEAAVKTIHGWCQSMLK--EHAFASGSLFS-QDVETDNEELRLQAAGDY
A1TWK0_MARHV          RKKLLLAAEWMDEAAVSTIHGFCNRMLS--EHAFDSGSLFK-LTLETDQSELLEDVARDY
D3RS60_ALLVD          ARRLELAAEWMDEAAISTIHAWCYRMLR--EHAFDSANAFE-QTLENDDAERLQHAAEDY
K0NNV1_DESTT          ARLLDQAALWMDESAIHTIHAWCRRMLR--QHAFDSLSLFD-LELAPSDQDLMEEAACDF
K0CGD3_ALCDB          AQRLNAAAQWMDEAAIYTIHGFCNRMLK--QHAFDSGSLFS-LELQEDASDEQQLAACDY
E1SLY0_FERBD          ALVLDQAAQLMDLAAVHTIHGWCQRMLR--EHAFDSGSLFS-QEMEADTTPLREEAVRDY
G0A1X0_METMM          AYRLELAANWMDEAAVYTIHGWCNRMLQ--QHAFDSGSLFK-QEVDTDDQELLNQVVRDY
Q1QYD3_CHRSD          AKRLDQAARLMDEAAIFTIHGFCQRMLT--RHAFDAGARFG-AELLQDGSTLLTRVVEDY
Q3IJ14_PSET1          FDLLDAAAKSMDEAAIFTIHGFCQRMLK--QHAFESGVAFN-LEFILDERDILLETIKDF
Q15V10_PSEA6          CHRLLLAIKQMDDAAVYTIHGFCQRMLS--LHAFESGAMYE-QSLVLDESQWLKLAVEDY
A1S6V0_SHEAM          LRQLDLALKTLDEAAIYTIHGFCQRVLS--DMAFESALLFE-SEFTLDDSELLSMAAADF
E8RCD0_DESPD          RQRLEDALVRMDEAAIHTIHGFCQRILR--DHAFESSLPFD-LELRESEAALVQEVLEDF
Q2SQD6_HAHCH          LALLQQALLNMDEASIFTIHGFCQRALQ--DNAFESGLLFD-LRLQEDLGPLLQQAAEDT
Q60AZ5_METCA          RQRLERALLAFDEAAIFTIHGFCQRALA--GTPFAAGLPFA-LELVQDDAMLAQEVANDF
Q74CY7_GEOSL          LARIDSALQTFDCAAISTIHGFCLRALQ--ENAFESGSLFD-TELAADQEPLLRQVADDF
B5EAR6_GEOBB          RRLLSSAIRSFDEAAIFTIHGFCQRMLQ--DNPFESGSLCD-TELVTDQGKILMEIAQDY
Q2LTC8_SYNAS          RRRLATALRDFDEAAIFTIHGFCQRTLQ--ENAFESHSTFN-AELITESEKITDLILQDF
A4SEL9_CHLPM          SSLLENALYLLDTASVFTIHGFCLRALQ--DNAFESGSLYD-TEIAADERELAGSIVDDF
A8ZX09_DESOH          ARRLKRALEAFDQAAIFTIHGFCSRMLG--EFAFESGVLFG-AEMVTNQDELVQQVARDF
B8FB94_DESAL          RLRVEDAIRRFDEAAVFTIHGFCQRVLG--ENAFESGASFD-AELATDNQDFLMEIARDF
C7LVF7_DESBD          ARRLELALRNFDLAQIFTIHGFCQRMLG--RNGFECSALFD-TQLEPDLSDLRRQVCVDF
Q7NQR1_CHRVO          RQRLTAAVNGFDAAAIYTIHGFCQRVLT--DAAFESGQTFQ-AELVEDDAARLAEIVDDF
I1XM81_METNJ          LKRLDLAIQSFDEAAIYTIHSFCQQVLK--DFAFESGSPFE-MDLIGDDRELLLSVTDDF
M1PKI5_DESSD          IARLEIALLDMDRAAVFTIHGFCQRMLQ--EQALESGQLFD-MELTADVSKIRSELVADY
Q6ANK1_DESPS          ISRLQLAIVNIDRAGIFTIHSFCQRMLS--EQALESGQLFR-MDLLTSLDDLRLRAAEDF
G4SWQ2_META2          KKRLELALLDIDQAAVFTIHGFCQRVLK--EHALESGQLFD-SELTADAAAVKQACADDF
F5ZCK0_ALTNA          LALLKAAQLELDDASVFTIHGFCQHVIG--QLAFNSGFAMA-LNLSKDTNDLYLQATQDW
Q480N9_COLP3          EFLLKRALLFLDEAAIFTIHGFCQRVLN--QYAFTSGLPFN-ANMAANSSEITLQVCQDW
RECB_BORBU            ---LKEAYEQSKKLFISTINKFALHALN--NFQIETENYSK-YKPKEKFSKEIDEIVYDF
Q0SMM1_BORAP          ---LKKAYEQSKKLFISTINKFSLHALN--NFQIETENYSK-YKPKEKFSKEIDEIVYDF
RECB_CHLTR            YMKIRNSLATLDEMNIFTIHGFCRFTLE---QHFPWIQPIQ-PSSIFSEPQTIQQHILDY
RECB_CHLMU            YXKXRNSLATLDEMNIFTIHGLCRFTLE---QHFPWVQPIH-PSSMFSEPQTIQQYILDY
RECB_CHLPN            YMQVRNALATLDQMSLFTIHGFCNFVLE---QYFPKTRLIH-KNPALTHSQLVLHHITNY
C6S650_NEIML          IVRLKAAIGQFDNAAIYTIHGFCQRILR--DYAFLCQAPFD-VELTEEDGDRLLIPAQDF
F4HA58_GALAU          IQRLSFACEYIDKAAIFTIHGFCQRILR--QYAFDSGLGFK-FELSEQNQEQLRQVNYQL
D0KVH3_HALNC          ARRLEMAANWMDEAAIFTIHGWCQRMLN--EHAFHSRALFE-QTVRTSLTPVVDQAVQDY
F6DBR3_THICA          QARLVQALASIDQASISTIHGFCQKVLT--EYPLESEQVFG-QSLTTDMKTIYDELVADF
Q5NF53_FRATT          YKHLKRSLLEIDEAAIFTIHGFCKKVLS--EQAFASGIEMD-VSMEVDTSDILQKVVEDF
B2FP80_STRMK          KRRLQVAADEIDLASIFTIHGFCTRVLR--EHALESGHTFDPPELLASDRELLEELAADL
C1ACJ1_GEMAT          ATRAQEALRALDALAVFTIHGFCKRVLD--EFALESGAPFS-MELLDDPTPLIEEAMFDW
F8E603_FLESM          LKIISNAVKNFDENGIYTIHGFCNLILS--EYAFSSGVPFD-KNMVTDQSLLVFETIVDY
D4H410_DENA2          IKLLKGAVRDFDQCAIFTIHGFCQRMLK--ENAFSGHVAYD-IDLTGDSREILKKPVYNF
C7PDT4_CHIPD          QQQLRDAVLFLDETAVLTIHSFCQKTLN--EFAFETDQLFG-AEMIQDTKTLIAEEVQKF
                            :    .   : * .      :      .                        . 

RECB_MYCTU            YLANFGRQETDPELTYAEALALALAVVDDPCAQLRPPDP---------------------
RECB_MYCS2            YLAHFGGQKDDPELSYPEALKLARVVVGNPATQLRPRDP---------------------
RECB_ECOLI            WRRHCYPLPREIAQVVFE--TWKGPQALLRDINRYLQG----------EAPVIKAPPPDD
A0A140NNW5_PROSM      WRRHFYPLDYSMAKVVLS--QWNSPEALLADIKPFLQG----------DMPYIVNETPNK
Q8D2T8_WIGBR          WEKYCSKLPILISKIIFS--YWKDSDFLLKDTLPFIK----------GEKPTILSSVNKK
Q057F5_BUCCC          WRKYVYYQNIEIIKLIFK--KWKNPLELFKHIYIWIS----------QIKIKIKHDFKKK
RECB_BUCAP            WRYFFYNLPKKIIKIIYE--EYRSPEDLLREIKPILKV---------NSSINFKKKFDKK
RECB_BUCBP            WKYYFAFLSLDITSILLE--YFNNPKTLLKEILPLLNK---------TQLISKLTKTKRK
Q493D5_BLOPB          WRRNFYSLPLNIARLIQE--YWKDPNSLLNDIIPYIYRARS------NLDCYNHNVHEDK
Q1LST8_BAUCH          WRRYCSPLPDSVARIVQQ--YWTGPDQLLTSLLPYLHNMHI------ESIIVSDQLI-TT
A1SUW1_PSYIN          WRTFFYGLSTPLTELIFS--YWENPGQLQKNLRPFLSR-----------SDLHFLPKIND
Q87M84_VIBPA          WRRNFYPLPFTLAGEIRQ--LWSSPSALLSDISNYLTG-----------APLSLSVPAMK
A6W0A9_MARMS          WRSVFYPMDDTKAALIQP--IWSNPDALLKDLYLLNNQ-------------PDAKIAVPD
RECB_HAEIN            WREHFYPLDFESANFIAT--ELVSPANVLSLLKADL-GKDLQVEIENKQALSVPIQIFLP
E1W5R9_HAEP3          WREHFYSQPFEIANFISK--ELGSPDDVLSILESDL-NKDVSVATDNQQSLSLSIDEFLQ
A6VNJ9_ACTSZ          WREQFYGQSFVVTEFIHR--KLESPQQVLKKIRAYLKGETLKVSVNRPHLLTMSTAEFLQ
B0BTM4_ACTPJ          WREMFYPMGLTETAAVAE--YLGTPNNAFAAIRAFVSAELPSLSDE---------QHWLN
B7J9Q6_ACIF2          WRQEIYPLGEPALDEVLQ--LFSGPDKIRQETAALCKLD------------PPLPAPASR
F9ZQ70_ACICS          WRREIYPL-QRAAPWWLQ--RTPDPETLLEQVAGLPWLD------------PPLPAPRAA
D6CML0_THIA3          WRQQVYPLSGAALDGVLQ--VWPDVGALESEVKSRLRAAQAG--------APPVADKDDS
C1D6T6_LARHH          WRRHFYPLPRARLLPLQA--IAASPAELGRLAL------------------PLLGRLPAG
Q5QUQ8_IDILO          FRRFIYPADAELSARLLE--DFKSPETLLGLTYSLSKSG--------------QAPIDGD
A1TWK0_MARHV          WRTFVYPLPPALMDEALS--HWKTPTDLRKAVRNLIDD------------PAALGTPPEN
D3RS60_ALLVD          WRTFLLGLPAERLEPILE--QWSQPSDLAKAVRGLLSL------------AEYLPPIADP
K0NNV1_DESTT          WRESFYPQSVETVALLKAVAAITTPQALLKQVSPIIN--------------AGIQVNADP
K0CGD3_ALCDB          WRNVITRFPVSAANALQA-NKLGHPEALLAQCRPLLG--------------LGGTDPDTL
E1SLY0_FERBD          WRRFLYPQPRAVLAAITG--LYACPSALEQAIVPLMGP------------LAEESAPADP
G0A1X0_METMM          WRRFFYPLSATACQAVYT--LASSPEQLASLLKPLLFETEA---------LGLAFPEGDI
Q1QYD3_CHRSD          WRCHFYPLAAHWQREIRR--RWEGPEALSQALQPLLKDARPQ--------PLWWDGERVE
Q3IJ14_PSET1          WRAFVYPLNKEKTDAILG--VFAAPEALFGKVSSILNKANAQ--------ITPQVNLDDV
Q15V10_PSEA6          WRGHIVHLPSQVLNELLD--IWHCPQALQSALRSLLYRHVTP--------LQ-TVDVKTS
A1S6V0_SHEAM          WRAHCYPLSADIAAMVQA--KFASPKALEQELKSLLGARDAV--------VELQMEDFSK
E8RCD0_DESPD          WRTHLYPAS--EEEAAWALATWGGPAGLLKGLGKALTAL-------------------RC
Q2SQD6_HAHCH          WRKLFYPD---RLLAELAQAKWGEPADMLNGLRSYLAQG-------------------DL
Q60AZ5_METCA          WRRRVAAGGLSRAMIAHLLEAGDDPEKYASLLGHALAKS-------------------LS
Q74CY7_GEOSL          WRHHFFGADAPLLPLALGRR-WSPEELAAFLRNIAGKPH-------------------LA
B5EAR6_GEOBB          WRINCYGQPEERIAAAGAAK-VSPESLLKLVQRVCGDPN-------------------AA
Q2LTC8_SYNAS          WRRHFYEAQPELVAYALETK-NNLAGYRSFLRQISSHPD-------------------IR
A4SEL9_CHLPM          WRSRYFSSTAVLPGYAMKE---SPESFLRFLGEVRASSG-------------------ER
A8ZX09_DESOH          WRQRFYGASPLFLDYAVGEKGLCVDTFTRLLNNWMVFPD-------------------LR
B8FB94_DESAL          WRREFYEAPELIIAYAMHRT-RTPEYYARLLEYAAKYPG-------------------IR
C7LVF7_DESBD          WRSHILPLGGLTGTEVRKQL--TPDHLTEMSGLPFLGQR-------------------IR
Q7NQR1_CHRVO          WRRRIVAAPL-LAQVLVERG-ETPDAWLAEIRPYLSKPY-------------------LK
I1XM81_METNJ          WRQNVVQADNDFSAYLLVRK-QTPETLLQSIRNLVAKPY-------------------LQ
M1PKI5_DESSD          WRRQMYELSDFHCSLFLS--HFSDPDSLYETVKGVGAED---------------CIEPAD
Q6ANK1_DESPS          WRIHVYSLSPWSCSLVMG--QWSSPADLLANAFVHLHGD---------------TRIEPE
G4SWQ2_META2          WRGQIYQRASWEAALLTA--TYSTPDALLAGIDRIPLDI---------------EIFPEY
F5ZCK0_ALTNA          IRKVSQNEDDFMLLAEQG---WHVPDNLLKEFSSSVRSA---------------------
Q480N9_COLP3          YRSLAKSDHECFMLLASY---WATPDSFLSSFSKAIGHT---------------------
RECB_BORBU            LRKSDSLIQALDIKDYELKVFKSDAKKTEEIVLKIKKAY-----------------ERDT
Q0SMM1_BORAP          LRKSDSLIQALDIKDYELKVFKSDAKKTEEIVLKIKKAY-----------------ERDT
RECB_CHLTR            LRKNLWDTVLSPKQYAFLSYHHRATTQQTRHLIERLLQD---------------------
RECB_CHLMU            LRQNSWENVLSPKQYAFLSYHHRATTQQTRHLADRLLQD---------------------
RECB_CHLPN            LKQDLWKNVLFQEQFHLLAVRYNVTSKHTSSLVDKLLAS---------------------
C6S650_NEIML          WRERVSNDPVLAALAFKR---KAVPQTVLAQIRAYLSRP---------------------
F4HA58_GALAU          WRDKFYSISAEQAQIVRQ--VFVSPDKLFKQNERLLTGE---------------------
D0KVH3_HALNC          WRHYIYALPPAQALSVAN--LLGGPSALTQKLNGLLSRD--------------GAPLFVD
F6DBR3_THICA          WRQTVYNRAESDVEMILS--VLPSPKDLHKLLEAVKQPG---------------------
Q5NF53_FRATT          FRKHINKSETNFGYLQIY--KLHTPEKFLDDLENIIRSN---------------------
B2FP80_STRMK          WRVHANDPATLEPLTWLWS----SPDALAADLRALLGTP--------------------P
C1ACJ1_GEMAT          WRRTFYIDPALAAWAVHRQWSPLSFVQDYAMWRRWPDAV-----------------LDPM
F8E603_FLESM          WRMFAFFAPKCVMNKLEKLEFSDLISLYKIKESNPHIRIN--------------------
D4H410_DENA2          WRENIYKMPQEAIKLLKS----LTPDSLINFYMQVQSNQ---------------SITVAE
C7PDT4_CHIPD          WRKYVTTLHIRLLEKVWE---PDMMEGINVALNEHMGGK---------------------
                                                                                  

RECB_MYCTU            ------------------------------------------------------------
RECB_MYCS2            ------------------------------------------------------------
RECB_ECOLI            ETLASRHAQIVARIDTVKQQWRDAVGELDALIESS-----------GIDRRKFNRSNQAK
A0A140NNW5_PROSM      ETFEERHQRLIELITQVKSLWLAGGSEIEKRIVSS-----------DVDKRSYSSRFLPS
Q8D2T8_WIGBR          QSIKNFYYSKIIYINKIKRIWK--KLIIKMLLKIV-----------SNLMNANKKEKILK
Q057F5_BUCCC          SSLIKKYNLIIKLINKAKKTWKIDKKKIKFLIKKI-----------YLNKKKNNKKKIKI
RECB_BUCAP            ETLITFHEKIINKINIFKQKWLNYNLIILKIINQL-----------KVNKKIYSNFNILK
RECB_BUCBP            -NIVQEYYILIKKIKLFKQKWANYSHLIHSEIIKT-----------NVNKRIYTKSNLKR
Q493D5_BLOPB          KSIITYYEKILDHVNHVKKEWLKNKHNIITILNSY-----------DINRRIYNKSNLIR
Q1LST8_BAUCH          ASIIDHHNKIINYIDALKKQWLLFMQQWSIFIQYI-----------PING--ICKKTALN
A1SUW1_PSYIN          FDFKAKYERSISFIETLKINWLNDQSDYADIITHS-----------AVSKRSYSKKNIPN
Q87M84_VIBPA          GSLADLHTENLKKIDELKAQWRESQDDFFTLISDS-----------DINKRSYTKKSLPT
A6W0A9_MARMS          YDWESALSQAQETMMAVRAMWLAQSQDIIDALERS-----------GIKRTFWRKDP-SK
RECB_HAEIN            QYLGGYQKALN----ELKAFWLESADEISAIITNELVKDYPKDQLKSLNRKKYQVKRLGD
E1W5R9_HAEP3          KSVGERLKAIG----ALKVFWLKNVDKISSIIMEEITKDYPKDQLTSLSRRSYQKERLKT
A6VNJ9_ACTSZ          QELAVHLAGSDNIPDELKSAWTDNFAEISALFEANYAGAS------VFNGNKFKRDYFIA
B0BTM4_ACTPJ          GELAVYLAALQHFLADAKRHWSAHGEEISRLIESELAKKYKTGEKKALNRRSYQTRYLEK
B7J9Q6_ACIF2          LADWLPDALAAPRRRLATLKAQWAAE-HDAFAEWLSGLVNGPKADNPLNGNTLSAAIVSR
F9ZQ70_ACICS          FHDWLENAAAPLLKAGTELKAQWSSTLRDTYGRWLRELAD--RDPYPLNRKSLPPEKLQG
D6CML0_THIA3          LLDLWQRLGEPQQAQVRTLKAQWAER-IASMRQWLCALVQ--SETNPLSKNKYGLKSVCG
C1D6T6_LARHH          PADWTPVE--AILAARRAEKAAWRQQ---GWLEELARTLTGLRENKTVNGNKVRADSCQK
Q5QUQ8_IDILO          LHSLLNEAESAHQQRMVAIKQEVAPI---------------VQELVDKTSQAKGAATKLK
A1TWK0_MARHV          VHQAINQVVSERQARANELKAHPWAQ---WQQEVTDLLNGL---NKAKRLHGGSKNAMLK
D3RS60_ALLVD          PDEIVGRCLETRRHTIATLKTDWRTQ---DHIAALERLFEQAVKNKAFKQPSLNKTHRAK
K0NNV1_DESTT          FEVLENRRQS-------IEDARIIWA---SDFEEAVDRVRKAQTDKTLNNNKYRKASLTG
K0CGD3_ALCDB          PESVQRWLDDSGPQAALEQNARDTLT---AELPALLEWVHSARDNKWLNGNSYRASSLPG
E1SLY0_FERBD          FALLNERAEA-------VAETKSRCR---VEWPTFVEQFNEAVANKWVKGNMIKPAQLDN
G0A1X0_METMM          AQVFQNWENWAIEKDSLENHARSLWR---QDLQALQTLLKKASEKGLLNGNQYRKASFDD
Q1QYD3_CHRSD          APASLTTLLGDAERALAARQALEDSLRQAWDREAIAGCLNEAFSRGALNRNSYKPDELDT
Q3IJ14_PSET1          WQARDEYIIRVPAFKKAVLEQEFIAA------------------IKGSGLSGSKTPGRKG
Q15V10_PSEA6          HESVDKYIKALQDTKRWWRENEVAQQ------------------IIDADLKANTKLGKAD
A1S6V0_SHEAM          LASGFSARIARLRLAWQRQAEDTLTT------------------LCKLPLNGVSYGKAAD
E8RCD0_DESPD          DLIPQVEDAEVASLAARARDVFAQVREAWERQRAQVACLLEQDSSLLRNQNAYRHDQVTG
Q2SQD6_HAHCH          ELIRP--DVDPQALSHLAGALKAQWRQQGDDLTAAVREAAE-NKILGRAEKTYREDKLND
Q60AZ5_METCA          DWRWPEPVEPPDERDEQALLAAFGEARRLWQADAFGIVRLLEEAIDQLNGVSYKAASLET
Q74CY7_GEOSL          VEPVWHSG-EADRVAGEIRDAFAALSSLWRTQRAEIAAILAADPGLSRSRSNYHPDLVPG
B5EAR6_GEOBB          VIP---------------------------------------------------------
Q2LTC8_SYNAS          IVLEPPAP-NHDIVEEEIAAYRREISKLRDSWKECRETVCSLLRDGSLNGKVYGEYQTDR
A4SEL9_CHLPM          IIPQFSSS-DIVAIEDECQSLYSQIAEMWRDEGEKVKKMISEDRGLSRAAGKYREDDLVE
A8ZX09_DESOH          VVPGADETVDTAALEAAFAASLEQVAAQWTADKAAVQEILLNSGGLRRNL--YRADWLSG
B8FB94_DESAL          IIPQAEKP--EFSALDGFKAARKKVADAWPANLDQVLAVFESGDLKANQYGKPDSGKAQV
C7LVF7_DESBD          IVPGTLAP-DPAPLDRAVREACERLKASWSVMEPEVRTLLLARADNFNARQFSPQKLDQR
Q7NQR1_CHRVO          LRAPDAVR-----LENARWVASERWRLLASAPEQVEEGLALFLAHPGFKANIYRPDTMAR
I1XM81_METNJ          IQALPEVD-----AEAVAEALTNAFWHASQCWQKESEQISAFLHSGSLSKTSYKPEKVER
M1PKI5_DESSD          RISVPESLMSVDTALTELVDWWNEKSDALYDSFSKALDEGKFKKPFAENFEQWWQQCGRF
Q6ANK1_DESPS          VEDISLLWQNLEGAIARMKEWWLGSGTALQEALAEACGEDKFKKAFVADFAGSFRACEKF
G4SWQ2_META2          RDPNEALAVCREQAEQARIHLDQAA-----QTLLNHFGDGFFKSSYTEIFEHRLQELRAW
F5ZCK0_ALTNA          LTPVLLDEETIEKAFIAGLHENESTAPAQFTFHYNNIVDNEALIHAQLLKKPDHKAVRTP
Q480N9_COLP3          STLSVVDVESIEAEFIVLVRLAAQTLTANSDLFENGLILVKKGADQEKRRDELSQLKIWL
RECB_BORBU            TQELGDWLKTQTAFENILLKKEELIKDYNKIIEDLDKMTKDEILSFYNKHIQTGKLEIEY
Q0SMM1_BORAP          TQELGDWLKTQTPFENILLKKEELIKDYNKIIENLDEMTADEILNFYNKHIQTGKLEIEY
RECB_CHLTR            -----YTSTPNLALSPLSITLQKLKAW-----VSRYQHLAPLSLEEMQAFSLRFKQSDLS
RECB_CHLMU            -----YASTPNLALPPLSITLQKVKNW-----SSQYKHLSPLSLEELQDFSLRFKQSDLP
RECB_CHLPN            -----YTQPISSYFSSRVERLEQISLWHQQIYNSLLEIPKQVFLDQLTAHISGFKKQPFS
C6S650_NEIML          -----YLNFRRPQADLKQAQRNAETSWQTVCRLLPELEAGFWRIHPDLNGNSYRKNSFGN
F4HA58_GALAU          --LPKIKQALPFTDISAGLDYYQQQLQQFQRLEQQYLAEFIDWFKQYEANLNQQRSKSKK
D0KVH3_HALNC          GKPVDPAALDFFAMVADIAELDTQAQQAEQDARQAWSKHAETLKDAWLPIMSALSGTSHR
F6DBR3_THICA          -----LVITPEVPNLDNLMTELLAHQQVWQNWIAQSRPQIDDFIAEAQAQKWINARSQNK
Q5NF53_FRATT          YEILTKQAISLDEFKILKKQQLELFINNHDIVDDFL---------SKLGKGELQGKRVDE
B2FP80_STRMK          LHPLPRPAALADPRPALQSAAEALSASVREHGEQFFIDLCDAVDNKWLNGVSYKLGWLHP
C1ACJ1_GEMAT          IRLSEARSVLTTVAKRMLDVWSPDSLRGTAAAVKWNKGAVLATEDGLASLDALIQEARAG
F8E603_FLESM          QQEENMTGISNTVENCYNSAEEIHGELAERLKYTDTTSFLGLIPFEKLKGNIYQKSSIEA
D4H410_DENA2          PAVIVEPEDILKIISELTDCMTTVKTCFTSNETELRELLDSKRKNFPLDKRSYQARYVND
C7PDT4_CHIPD          ----RYYAYQPGKRYAIKQKEQEEWLHQLDAIDDKKAAVEKILMDYVINERETLRGLCEG
                                                                                  

RECB_MYCTU            ------------------------------------------------------------
RECB_MYCS2            ------------------------------------------------------------
RECB_ECOLI            WIDKISAWA-EEETNSYQLPESLEKFSQRFLEDRTKAGGE---------TPRHPLFEAID
A0A140NNW5_PROSM      WLDKMARWA-EEETQDYQLPKEIIRFSQAALHDKSKSGSG----------PEHEVFALID
Q8D2T8_WIGBR          YINIIDAWS-NNKTENFDVPIEIKKIKNLLKNHYKNYKN----------ILQNIFFNKVD
Q057F5_BUCCC          WCKKIQIWS-EKKTIKYSVP---KILKHFILKKIKKKKE----------YLFFLYIKKIF
RECB_BUCAP            WKKKITEWA-ESETKNYKMPICLKYFSETSIEKNIKNYN----------FKKHIFFEEID
RECB_BUCBP            WINNITAWATQKQTKNFFIPSELKYFRYSFIIKKTTSEK----------ILDDKFFKFID
Q493D5_BLOPB          WIDRINQWV-KRPTIDHTTPNDLQRFRTTELKIHNNSNKS---------DYICTLFDSVE
Q1LST8_BAUCH          WKKKISIWA-NKLTVDYAIPIELERLNYLLCNTNTLPVEI---------RDHLFFKELAK
A1SUW1_PSYIN          WLKEVSQWA-LTSSASLSLPKSLVKFSQKTLDEKTPKGE----------IPTHPVFSEIE
Q87M84_VIBPA          WLEAVNAWA-ATETTGYDYPDKLEKFAQNVLLEKTPKGS----------APQHAVFEAIE
A6W0A9_MARMS          DIQAMTQWANSTRFELDKSLEKFDTNEHASRLSKGGDLPA---------HEFFALVLALR
RECB_HAEIN            WINKINQWS-NNPRDYQINTTLKDYFLQSSIEKNCEESTDKNKDKKPATPFYSPIFADLE
E1W5R9_HAEP3          WIEQINEWA-NNPLDYEIHETLRKYFLQSSIEQKYEKPTEKTKNKKAAIPFYAPIFEELE
A6VNJ9_ACTSZ          RTAKIQAWA-DSER-RDIPDELW-YFTQDYLNGAVLKGKTAFSH-----PFFDYLAEQKA
B0BTM4_ACTPJ          WRASVDEWA-ASSL-SYLPEEQFERFCQEFLNEKAEEGAE---------PLVHPHFAKNQ
B7J9Q6_ACIF2          ALAALRDWADRSD---PLIPDELDKC-QRLSASKLPEYCKN-----KPPPVLHPAAETLD
F9ZQ70_ACICS          ALQSLDQWCVEKE---AAVPTAMATV-AKL-GSALAECVKK-----GMHCPAPPSQAQFD
D6CML0_THIA3          WFDALQAWLDDPA---QQQPDLDDKTWAKLTPDGLRAGCNQ-----GKQVEPPAVFNQVE
C1D6T6_LARHH          WLDDLADWLARDSDDLPLAGKPFETARWRLTPAGILDALKA-----GMSFDPPEPFFAVE
Q5QUQ8_IDILO          QFQKFADWCGDPD----LVEPEATAANWKNISTDELQKFAD-----AKLGDMPQSWAVLG
A1TWK0_MARHV          VWDSLLAWAESDELLPEKLDSAAGYKNQTPEGLDNILKGD------EPAP-RHPAFDAID
D3RS60_ALLVD          VLDGLRVWLETPDQTEPDIFGGQSWQRMSSLAIAEIWNDP------AKAPVDDPACRALA
K0NNV1_DESTT          WITQMDLWVNKGGPLPDD----QALEKFSAQGLANGVSK-------KKSPPMHPAYDALD
K0CGD3_ALCDB          MLLTLERYA-AGEVLNDKDY--DTLSRFSTAGMKLTKKG-------EEHRPGFAFCDQLD
E1SLY0_FERBD          LTAWLEGSD---ELPLDNAG--KVMARYTTGTFADALSAGG-----KKQATTVADSPVLA
G0A1X0_METMM          RLRQLAAWADGDALDLDSLA--KFGQQKLQAGLTKAHQD-------KTHLFAQAAFAAID
Q1QYD3_CHRSD          RLAAFEQWLATFEADDGTTD---SQGRFWLSQAKLEKATKK-----GHDVPTHPFFARLD
Q3IJ14_PSET1          SLAALEAFCLGGDLFFEFGTSKYSFEVWSSENLSDISNYKK-----NQPLFTHPLLTEFD
Q15V10_PSEA6          FIAKMQAFCLSDDSRADFDKDLWTTFSPAKV----LSAMKK-----TSKSLAHLDFSRFE
A1S6V0_SHEAM          GFPKLKNHWDTMTAWSLRCEGTPPEKAMQAVAYGNIKLNKG-----GQ--LPGPETLSLL
E8RCD0_DESPD          LLAAMDGLAAGPVMPYLLPRIVARMAASVMATLVKK---K------SAGPPEHPFFALFD
Q2SQD6_HAHCH          AILSLTIWSRTEEQMTLPPAAALFSQSVLDASVLKKAADK------GLGAPQHAFFTALD
Q60AZ5_METCA          ARKGWDAWFATNDPLAPVEDKVQLFRAAMLKGGTKK----------GNTTPYHPFFDAAE
Q74CY7_GEOSL          LLVAMDGYAA-GADPYALFAGFDKFTTGFLAGQRLK----------KADPPRHDCFDLCD
B5EAR6_GEOBB          ------------------------------------------------DPP-ADANELDD
Q2LTC8_SYNAS          YVDELDVFLERGGPCFPLPKNFEKFTAGKLSRSCRK----------GCVPPKHHFFEICQ
A4SEL9_CHLPM          LFRGMDAFV-EEALPFSLFEGIVKFSASRMAEWTKK----------KFTPPRHKLFELCD
A8ZX09_DESOH          WFLRMDAYAGPREGLPSEFEQFKKFTTTGIAEGTKS----------GGTVAHHPFFDTCQ
B8FB94_DESAL          FAQAMDDYLQAGEPGFPLFPQFKYFCADTVQKAGKK----------GCEIPKLDFFNDCQ
C7LVF7_DESBD          LKATRDFLNDPRLDAKEQLKALGELTSTYVQGMTKK----------AFTAPEHRLFDEIQ
Q7NQR1_CHRVO          AADNLRGWLAQPDALPELDSDSRKLLDKLRPEALAKGMKK------GCDAPAHPLFERME
I1XM81_METNJ          LLALLQIIFNEQSCPLAWD----ELLELATLEKAEASLKK------GTALPELRFWSAMD
M1PKI5_DESSD          FSGTERRLPP--RLEFFGRTPLMDELNGTKLRGAAKK----------------EAFLEDF
Q6ANK1_DESPS          FLGQAEKFPA--NLSWLTVAGLKVEINGNKFRGKKKDE--------------IDPFLNSM
G4SWQ2_META2          LNQETLQLPSPEAFACLTVTGLVDGLNGNKFRKTKTQTGEQ----------RKHEYLATL
F5ZCK0_ALTNA          ELAALKSWLESGEYEPLPAEGAAFLDGRRFGRNKSGVKEIL-----------APIKGFAD
Q480N9_COLP3          ESIISKELSLLDVGEGKVKMPDGFFDGKRYAR--STYKAEL-----------LEAFAPVK
RECB_BORBU            SKENDIFKIAETLLKNKFFSTLIEKETKKNSKLSPKELKIKNDLICLGINIKHEKYKSED
Q0SMM1_BORAP          SKENDIFKIAETLLKNKFFSTLIEKEIKKNTKLSPKELKIKNDLIHLGINIKHEKYKSED
RECB_CHLTR            IERELPAFVQQFETNPYSLDMLFFPGMVQKFQEENR---------------NKKKLSAPA
RECB_CHLMU            IDRELPDFVKQFETDPNSLDILFFPGMVQKFQEENR---------------NKKKLGPPF
RECB_CHLPN            ILDDLHHFVDLLYTSETHSSLFSFFKIAETFNFKHRL--------------ARYKPCAAF
C6S650_NEIML          LFKELAQKSAAGQLPFLDKDTHDRLLKLASDKLEAGLKKGK--------TPDAAVFAELQ
F4HA58_GALAU          FTDYFDAVISATTTIEQRIALAEKLLPIYFKKNKE--------------VELPTFVVEME
D0KVH3_HALNC          TLSKLTDFSTLWDSLDLWAQTGEPLPIDVFKFLTQPKFNKK---------LERPFHPALA
F6DBR3_THICA          LQELLDNFTDDPIALLAYLEQGKAFNKTGKTAAEAFVAKI------------HPGDTNLN
Q5NF53_FRATT          YYRVLEWLKLDNQTLFPENISIITDGRKISAKLIK------------------PIFIGIK
B2FP80_STRMK          LGRQLLAWAERADPRELLASDRLPALLPEVLADKTNKKFPD-------RTPSSPLQAPLA
C1ACJ1_GEMAT          SLAAMQGLAGALNIDALQAKANKVGKQNRATADGIA---------------DWPIAVAAT
F8E603_FLESM          KAEKFLNFISADQPLYAKDILDDSIIIYFTAGKITSSLKKN-----NKIDEMPEIFKIIE
D4H410_DENA2          SFNELKKLTESGNIHCPLESENKKIYRLTNHSIEGKI--------------EHVFFSLVH
C7PDT4_CHIPD          NRYAKTALLPCMDDPELFIKTVADKRNSAKYISTLL----------------PDMLAHMD
                                                                                  

RECB_MYCTU            ---------------EPGSKAAVRLRFAAEVLEELERRKGRLRAQGFNDLLIRLATALEA
RECB_MYCS2            ---------------DPDSPAAVRLKFARDVLAELEIRKRRRGVLGYDDLLTRLADALEP
RECB_ECOLI            QLLAEPLS----------IRDLVITRALAEIRETVAREKRRRGELGFDDMLSRLDSALRS
A0A140NNW5_PROSM      ELLSQSLT----------IKDLIIPVAITEVRQNIAREKHSRGEMGFDDLLTRLDNALKK
Q8D2T8_WIGBR          ESYKFYKK----------LKELIFQKSIIKMREYKKTEKKNQEKLDFDDLIILFKTELFK
Q057F5_BUCCC          FYYKLFFK----------YFIYLALKKIPKLIKKKKKMKKGLEFNDLNT--IMWKEIKKK
RECB_BUCAP            KILKKNFS----------LKNIILFYAIKNIPKFVKREKEKKLLLGFNDLLKILLKNIKK
RECB_BUCBP            TFLDSKFS----------LKEIFIIDASLEIKAMFMQEKIKNRYFEYDDLITFCWNMVNK
Q493D5_BLOPB          KLYSQLSS----------FKTSIFKIAINEIHNDLNNTQHYRSEITLNDLVDVLAHHLVK
Q1LST8_BAUCH          FYLNYQFS----------LQEFILRLAINEIIPSLEKEKNLKNIMSFHDLLKDFDNILTS
A1SUW1_PSYIN          ALLALDLS----------LENTILVKATHWVQAHLQSNKNKQMLLGFDDLLTRLDAALQN
Q87M84_VIBPA          TFLANPIS----------LKAPLLAHAIEHCRVMLANAKNQKQWLSFDDLLTQLSASIDT
A6W0A9_MARMS          ESFPDAGR----------LKAVLLTQLWQQTQERMKRWKRSTQSLTFTDLLTSLDVALAQ
RECB_HAEIN            KRVNALMT-------PDLLSKLTLYHYRQGLQQKLLDYKLNHQEKSFDDLLRLLCEALQD
E1W5R9_HAEP3          ELVAKHQS-------SDLLKKIILYHYRQGIQKKLLEYKANHPEKSFDDLLRLLKEALHG
A6VNJ9_ACTSZ          RIEAAQTQ-------LDLDEKILLFHYLRTLNERLSAYKRHHPEKSFDDLLRLLKNALQS
B0BTM4_ACTPJ          QILTAYQQ---Q--FANKQKPLLLYQFLLAVRTKLADYKATHSEKSFNDMLTLLNQALNA
B7J9Q6_ACIF2          TLFRELETIAQ---QFTRLHGEIRTHAAAWINARLSRLKAQSGQVSFADYQRRLARVLHD
F9ZQ70_ACICS          TFLAALQQWQV---DDEVLHGQALAQAAASMAALYGEEKQRLRQLEFNDLSRALWNGLRG
D6CML0_THIA3          TLRAALADLAD-------LVPELQTYAAAQVDARLRALKAASGQFSFHDQLERLDAALAG
C1D6T6_LARHH          RLLQPALADTS-------LRAALLTHATRSIAAALAAEKSRRAEIGFDDMIRGLAQALAP
Q5QUQ8_IDILO          ELQERIKRSKV---QQQEELAKVKQHAAFWVSNRFAELQNQRAEMGHDDMLTRLRDALKG
A1TWK0_MARHV          ALLAF----GQ---NLPSAKSDILRHASHWVAARLEAEKQQRSEMGFDDLLTRLDDALH-
D3RS60_ALLVD          DLHET----LT---TLPDPTEDLLTHAVHWLKSHVEREKRQSAILTQNDLLIRLDQALQ-
K0NNV1_DESTT          QMNE-----RI---DSLDVKQALVSHAAVRINNRITAAKTRLSRMGFNDLLSRLAQALS-
K0CGD3_ALCDB          QVLEQ----RE---QTALPRTDLLAHAAAWIGKRVDRMRRQTATMGFDDMLSRLHGALH-
E1SLY0_FERBD          ALENLAR--QL---DANPVKAALLRHCAHWVAHRVAAEKRRRAQLDFDDLIKDLGKALEQ
G0A1X0_METMM          NLADC----AA---NEIDIANLLTRHAVGWLRERYDAEKQRIARMTFDDMLNRLDLALQ-
Q1QYD3_CHRSD          ELAET----AT---PFDVLAPRLLAHARDTVAAMFAAEKRRQGLWEFGDLLQDLDAALDP
Q3IJ14_PSET1          QLAALN---NT---INQGLAIAVVQHAAKWVKAAVIKRKQEQSVITPDDLLSNLHSALNN
Q15V10_PSEA6          TLAHLQ---KQ---CHDQLLLAHSLDALKHISTNLASNKQRLQLLSPDDLLSSLHRALLA
A1S6V0_SHEAM          VQIDEL---LH---AQENLMPAFLVLAKNEIQARFDGLKAERNLMAPDDLLKHLAKALGV
E8RCD0_DESPD          TFVQDHGRFLR---CRTIQVLTTARTFVHQERS---RRKRAQGWLAFDDLLTRLAEALEQ
Q2SQD6_HAHCH          QFLTQQTQLDA---WLVGATLTAFKDVLQ-------RLKTQAEILGFDDLIGSLKDALA-
Q60AZ5_METCA          NLLALKDGIQG---RLAVARLGLLRELVEHGAEALRAEKRRRRVIGFDDMLWNVHEALT-
Q74CY7_GEOSL          RLARLTSQR----------LLLLKAEFAARGRERLAALKAQRNVRGYDDLLTDLHAALGG
B5EAR6_GEOBB          WLQGLKRGF----------FDYLRAELPKR--------KRLKNLRSFDDLLLDLHAALLR
Q2LTC8_SYNAS          VINDLEKRLKV---VLDSILLSLKKELLQTIHAELPAFKTRRNILFFDDLLLRLRDALGR
A4SEL9_CHLPM          -------CYHR---AIRQRFLALKAELILYCRDRLPKRKKEANIRFFDDLLHDMHTALFN
A8ZX09_DESOH          QHMEIRQALTG---AFDRRIAVEKSRFLGEARKALDAQKQRLNIRYFDDLLLNLDRVLVS
B8FB94_DESAL          ELQEAGEEMER---ELEQYLLYLDQEVFRFAEKAEPERKTAKNIRFFNDLVLGFQKALSG
C7LVF7_DESBD          NILDQVEALRH---LLGPFVVHLRHAFLSGVTARLDELKRRRNVLGFDDLLRNMHAALAS
Q7NQR1_CHRVO          AWLAAWDVYMD---QVANSLAGLKLELIAWANEELARRRGVERSRSFDDLLTDLGAALDH
I1XM81_METNJ          TLKQRYQDLDT---VRALQLQQLRLQLLSYIRDQLPQQKIQQQVQSYDDLLINLAQALQG
M1PKI5_DESSD          PLADSIVDSFLE--SCKNAVLVFRINLALELQGGLRERLLSQGRFSFDDLVVSLAQALDG
Q6ANK1_DESPS          GLPEMAATELLE--LKKQLFIGYRIFFAGELERGVGRQLQEHGSISFDQLISRLAAGLCG
G4SWQ2_META2          KIDTTPFEVLVD--SIDRIGLVFRRALLEHVRIELDKQMQQLNILSFDDLISRLANALQG
F5ZCK0_ALTNA          AILAACKDKQDN--LDKIPVFTLINDAISFIKSNVAAQKQQLGVIDFDDLIRMLADEVVK
Q480N9_COLP3          EVKEQVKKIANN--INKARAYGIVKSGIYIIRQQVIEQKKALNLLDFDDLINTLANCLQS
RECB_BORBU            NRNKNRNN------LKQYVILKVEYKILKYIEKELKKTIKSTNTIDQNYIISNLKNYLKS
Q0SMM1_BORAP          NRNKNRNN------LKQYVILKVEYKILKYIEKKLEKIIKSTNTIDQNYIISNLKNYLKS
RECB_CHLTR            SPLDPFFQDWIQ--LAHPFCQKEPIFHTLLKSVQQHLKTHCAQSYSHDESIATLESLLAH
RECB_CHLMU            SPLDPFLKDWLL--IAQPFCQKEPIFHTLLKSVQQHLKTYCAQSYSHDESIATLESLLAQ
RECB_CHLPN            TVLENM--SWVE--RTLEFCNLDRIFNTLLVDLQEYLKQNYTPWLSPDESVFALEKLLSS
C6S650_NEIML          KLADFGYDLNALEEAEEATIIRLQLDLIGYLNRSLAEMKKSRRERGFDDLLLDVHTALTD
F4HA58_GALAU          HFLQQFSQ--------NDFCQKMHYLYVAELRQRIFEYQDNHNEKQFDDLLRMLRDVLQK
D0KVH3_HALNC          VFSAWPVAMEAARHGREQSAIRLLAHAAFWVRDRIDTVLQQNAEMGFDDILLNLDRALTG
F6DBR3_THICA          NQSR----------LYKTLAITLQSGFSMHVQLNLLLKLQAQNLMSFNDLIQRLYHALQQ
Q5NF53_FRATT          ELRDLQQEIKQ------AQAAQFIRKACLQIRQDFAKAKEQKGVLDFDDLITKLCQSVKK
B2FP80_STRMK          RYVALLAERDAW---LRGTALDFLHTLRAEATQRLQALKRTRRVQTYDDLIDGVALALEG
C1ACJ1_GEMAT          ALAAAIQQ----------LVLAVRADCLQDVDDRVRTLKRERSLMGFDDLLGQLHAVLAA
F8E603_FLESM          HFYDIYLQYMQA---ADGWLAGFKKNMIDFVHKRLNAYKSARGILYFNDQLSILHDALSE
D4H410_DENA2          KWYDKEAEFREL---SRLFESTLKYKLCLYMEEVLETHKQKNNIQSYDDLITRMRNSVME
C7PDT4_CHIPD          EVAVVDEERKG---VVQQVISRLYCFAIEEIAAGVKGFKKRNNLLSYDDMITNLHKSLVD
                                                                                  

RECB_MYCTU            AD------------------------SPARDRMRERWRIVLVDEFQDTDPMQWRVLERAF
RECB_MYCS2            ED------------------------SPARVRMQQRWPIVMVDEFQDTDPVQWQVIERAF
RECB_ECOLI            ES-----------------------GEVLAAAIRTRFPVAMIDEFQDTDPQQYRIFRRIW
A0A140NNW5_PROSM      QG-----------------------GDYLAKAISQRFPVAMIDEFQDTDPQQYRIFQRIY
Q8D2T8_WIGBR          F-------------------------NKLSKIIRNIYPVAIIDEFQDTDLIQYKIFFKIY
Q057F5_BUCCC          K-------------------------INYKKNILKKYTISMIDECQDIDNYQFNIFYKIY
RECB_BUCAP            E-------------------------ESLREIIIKQYPVALIDEFQDTNIQQYQIFNTLY
RECB_BUCBP            NN------------------------FNISQTILKKYPVALIDEFQDTNNKQYNIFKKIY
Q493D5_BLOPB          DK-----------------------DNKLAHILRTRYPVTLIDEFQDTDCQQFKIFSTLY
Q1LST8_BAUCH          NH-----------------------GEIFANFIRSRYPVAMIDEFQDIDPLQYRIFKRLY
A1SUW1_PSYIN          GN-----------------------EKSLALNIRTAYPIALIDEFQDTDPVQYRIFTTIY
Q87M84_VIBPA          DE-----------------------SELLAARIRTLYPVAMIDEFQDTDPLQYSIFSRIY
A6W0A9_MARMS          DE-----------------------AGKLAERIRHLYPIALIDEFQDTDAVQYRIFSTIY
RECB_HAEIN            AQ-----------------------GDELAEMIRFQYPFAMIDEFQDTDSQQYAIFSKIY
E1W5R9_HAEP3          EG-----------------------GEQLAELIRFQYPFAMIDEFQDTDALQYQIFSKIY
A6VNJ9_ACTSZ          ER-----------------------GEQLATFIRHQYPFAMVDEFQDTDEQQYQIFSAIY
B0BTM4_ACTPJ          ER-----------------------GAELAAQIRAQFPFAMIDEFQDTDKEQYEIFHKIF
B7J9Q6_ACIF2          -------------------K---TQGPALAARLRQKYPAALIDEFQDTSALQYQIFDDIY
F9ZQ70_ACICS          -----------------------PGGEALAEALRQRFPVILIDEFQDSSARQYAIFERIY
D6CML0_THIA3          -----------------------PQGERLRSRILEQYPVALIDEFQDTSALQFSVFNRLY
C1D6T6_LARHH          -------------------D--SPNRERLAQALRQAYPVALIDEFQDTDPAQYAIFRTLY
Q5QUQ8_IDILO          -----------------------PSGEALAAAIRKQYPVAMVDEFQDTDPVQYEIFNRIY
A1TWK0_MARHV          ----------------------GPRGDQLAATIRRQFPVALIDEFQDTDPVQYRIFNRIY
D3RS60_ALLVD          ----------------------GEVRERLAAAIRRQFPVALVDEFQDTDPLQYRIFSSIY
K0NNV1_DESTT          ----------------------RPD-SHLAEVIRCQFPVAMIDEFQDTDPVQYDSFGTIY
K0CGD3_ALCDB          ----------------------GDNGPRLAQVIRDQFPVALIDEFQDTDPTQYGIFSALY
E1SLY0_FERBD          -------------------EH-RAGGDKLASAIRHQFPVALIDEFQDTDPVQYRLFQRLY
G0A1X0_METMM          ----------------------GDNGERLAAAIVKQYPLAMIDEFQDTDPVQYRIFARLY
Q1QYD3_CHRSD          -------------------EAAPEAAWRLAGRIRQALPVALIDEFQDTDPLQYRIFSRIY
Q3IJ14_PSET1          EQGN-----------------------VLAQKIAQLFPVAMIDEFQDTDPIQYGIFSKIY
Q15V10_PSEA6          QVESNSGQVIEPDSELSHRDKLDTAHQSLAQAIQLSYPAALIDEFQDTDPVQFDIFRIIY
A1S6V0_SHEAM          QGSGSG------SGFEPASEIDREIALRLSSEVASRFPMALIDEFQDTDPLQFAIFSALY
E8RCD0_DESPD          PGSG----------------------GQLADRVAARYPAALVDEFQDTDPVQYQVFSRIY
Q2SQD6_HAHCH          AATG----------------------PQLRQALQRRYPVALIDEFQDTDPSQYRIFSSLY
Q60AZ5_METCA          SGCY----------------------PWLAPALRSRYPVALIDEFQDTDPLQFAIFRALY
Q74CY7_GEOSL          PGG-----------------------AALADRLRERYRAALIDEFQDTDQVQYRIFRAVF
B5EAR6_GEOBB          PA------------------------STLPRLIRERYQAALIDEFQDTDPLQFAIFDAIY
Q2LTC8_SYNAS          PEG-----------------------DLLAAAIRRKYRAALIDEFQDTDPVQYAILQAAF
A4SEL9_CHLPM          HEEG----------------------EAFRLLLRRRWPTALIDEFQDTDARQYDIFRSIY
A8ZX09_DESOH          DAR-----------------------TGLIEKARHRYRAVLIDEFQDTDPLQYRIFSSLF
B8FB94_DESAL          PMG-----------------------PALADAVRKKYQAALIDEFQDTDAAQYDIFYNLF
C7LVF7_DESBD          PEL--------------------------VAAARTQYRAALIDEFQDTDGLQYDIFRTLF
Q7NQR1_CHRVO          PATG----------------------PLLAAQVADSFSVALIDEFQDTDPTQYRIFRRCF
I1XM81_METNJ          P-QG----------------------EWLITRLREQFKAALIDEFQDTDPVQYDNFRRVF
M1PKI5_DESSD          P-----------------------RREDLQRVLAGRFQVALIDEFQDTDAAQYRIFSSLF
Q6ANK1_DESPS          ------------------------EETHLQTALQARYDLALIDEFQDTDNEQWHIFSKLF
G4SWQ2_META2          N-----------------------QGELLTAELRQRFKAALIDEFQDTDQNQWLIFSTLF
F5ZCK0_ALTNA          PDNS------------------------LVPELRKKFPVALIDEFQDTDAKQYAILDAVY
Q480N9_COLP3          DSSGDE------------------HSQLLAKQLLAQYPVALIDEFQDTDPKQFGILQSIY
RECB_BORBU            ED------------------------KKLLNAIKNRYKIILIDEAQDLSLIQIEIFKILK
Q0SMM1_BORAP          ED------------------------KKLLNAIKNRYKIILIDEAQDLSLTQIEIFKILK
RECB_CHLTR            N-------------------------DTVVSQLRKQFQLVLIDEFQDTDKRQWQIFSKLF
RECB_CHLMU            N-------------------------DHVVSQLRKQFQLVLIDEFQDTDKRQWKIFSKLF
RECB_CHLPN            SEA-----------------------QPVVQALREQYQLVLIDEFQDTDKQQWSIFSNLF
C6S650_NEIML          NPHA----------------------ETLARTVAENWETALIDEFQDTDPLQYEIFQKIF
F4HA58_GALAU          PS-----------------------AHKLIALIRQQYPFAMIDEFQDTDPVQLAIFSKIY
D0KVH3_HALNC          AE-----------------------GQQLADTIRTQFPVAMIDEFQDTDPLQYRIFDRVF
F6DBR3_THICA          PN-----------------------AANLIAQVQGGYQAALIDEFQDTDQWQWGIFSKLF
Q5NF53_FRATT          SP-------------------------ELVKTLQKQYPVALIDEFQDTDAEQYEILDTIY
B2FP80_STRMK          PQR-----------------------LTLVRQLRAQYRIALVDEFQDTDDRQWGIFHTVF
C1ACJ1_GEMAT          QGSE----------------------GLLARAIRQQFQAALIDEFQDTDSHQFHVFRIAF
F8E603_FLESM          TG------------------------DHFKDRIADEYQLVFVDEFQDTDPLQYEIIKKLF
D4H410_DENA2          NEG----------------------HGNMSISVNRKFNAALIDEFQDTDPHQYDIFNTVF
C7PDT4_CHIPD          RNN-----------------------PKLEEVLREKYKAVFVDEFQDTDRMQYEIFEKAF
                                                              ::** ** .  *   :    

RECB_MYCTU            SR-------------------------------------HSALILIGDPKQAIYGFRGGD
RECB_MYCS2            SG-------------------------------------RSTLVLIGDPKQAIYAFRGGD
RECB_ECOLI            HH-----------------------------------QPETALLLIGDPKQAIYAFRGAD
A0A140NNW5_PROSM      HE-----------------------------------VENSALLFIGDPKQAIYAFRGAD
Q8D2T8_WIGBR          YK-----------------------------------KKMCSLILIGDPKQAIYGFRGAD
Q057F5_BUCCC          KK-----------------------------------KKKKSLILIGDPKQSIYSFRNSN
RECB_BUCAP            KN-----------------------------------KK-TALFLVGDPKQSIYSFRGAD
RECB_BUCBP            KK-----------------------------------EN--LLILISDPKQAIYSFSGAD
Q493D5_BLOPB          NS-----------------------------------DSENGLILIGDPKQSIYAFRGAD
Q1LST8_BAUCH          DL-----------------------------------TKNTVLLLIGDPKQAIYSFRGAD
A1SUW1_PSYIN          QSLEGEDS--------------------------EPLDKSLGLFMIGDPKQAIYSFRGAD
Q87M84_VIBPA          LN-----------------------------------DPECGLFMIGDPKQAIYGFRGAD
A6W0A9_MARMS          APAQVD-------------------------------QNALGLIMIGDPKQAIYAFRGAD
RECB_HAEIN            RDNPE--------------------------------K-NTGFIMIGDPKQAIYRFRGAD
E1W5R9_HAEP3          HNETA--------------------------------SGNVGFMMIGDPKQAIYRFRGAD
A6VNJ9_ACTSZ          VN-----------------------------------RPDCGFMMIGDPKQAIYQFRGAD
B0BTM4_ACTPJ          MQETH--------------------------------T-NHGFIMIGDPKQSIYKFRGAD
B7J9Q6_ACIF2          H-AADN-------------------------------NPDTLLLLIGDPKQSIYAFRGAD
F9ZQ70_ACICS          R-PSEP-------------------------------WPDSLMLLIGDPKQSIYRFRGAD
D6CML0_THIA3          GITTAQ-------------------------------TTHSAVLLIGDPKQSIYAFRGAD
C1D6T6_LARHH          A-DAGP-------------------------------EARLGLLMIGDPKQAIYAFRGAD
Q5QUQ8_IDILO          N-LADP-------------------------------HPGTGIFLIGDPKQAIYSFRNAD
A1TWK0_MARHV          NVEAN--------------------------------QPDTCLLMIGDPKQAIYGFRGAD
D3RS60_ALLVD          EIQAN--------------------------------HAATGFFMIGDPKQAIYAFRGAD
K0NNV1_DESTT          LE-----------------------------------QEQAGLFMIGDPKQAIYAFRGAD
K0CGD3_ALCDB          EH-----------------------------------RDDTGWFMIGDPKQAIYAFRGAD
E1SLY0_FERBD          LA-----------------------------------QEDTALLMIGDPKQAIYGFRGAD
G0A1X0_METMM          PADA---------------------------------ERDLGCFMIGDPKQAIYSFRGGD
Q1QYD3_CHRSD          RAPEAD-------------------------------ADTTTLLMIGDPKQAIYAFRGAD
Q3IJ14_PSET1          QQEHT--------------------------------TLA----MIGDPKQAIYGFRGAD
Q15V10_PSEA6          TQQFG--------------------------------DVTPCWVAIGDPKQAIYAFRGAD
A1S6V0_SHEAM          RQQPR--------------------------------AQG--LLMIGDPKQAIYAFRGGD
E8RCD0_DESPD          R---QER------------------------------PAGTALFLIGDPKQAIYSFRGAD
Q2SQD6_HAHCH          ----DAA------------------------------DGNATLFMIGDPKQAIYSFRGAD
Q60AZ5_METCA          L---AEG------------------------------AVSGPVFFVGDPKQAIYGFRNAD
Q74CY7_GEOSL          S------------------------------------GGAVPLFLIGDPKQAIYSFRGAD
B5EAR6_GEOBB          PV-----------------------------------GHEAPFFLIGDPKQAIYSFRGAD
Q2LTC8_SYNAS          LCNRPEE------------------------------SDKPPIFLIGDPKQAIYSFRGAD
A4SEL9_CHLPM          E------------------------------------KADGPLFLIGDPKQAIYSFRGAD
A8ZX09_DESOH          Q------------------------------------GASA-LFFIGDPKQAIYGFRGAD
B8FB94_DESAL          AG------------------------------------RRQALFLIGDPKQAIYGFRGAD
C7LVF7_DESBD          ATG----------------------------------DGENSLFLIGDPKQAIYSFRGAD
Q7NQR1_CHRVO          V------------------------------------EEARPVFLVGDPKQAIYSFRGAD
I1XM81_METNJ          A------------------------------------DSGLPVFFVGDPKQAIYSFRGAD
M1PKI5_DESSD          GG----------------------------------SSKHHFLYLIGDPKQAIYKFRGAD
Q6ANK1_DESPS          ------------------------------------ASKKHSLYLIGDPKQAIYKFRGAD
G4SWQ2_META2          ------------------------------------GSDAHYLYLIGDPKQAIYKFRGAD
F5ZCK0_ALTNA          PKASIHGSDVSAK------------EDTGFETGAGNSKSENALLMIGDPKQAIYRFRGGD
Q480N9_COLP3          -------------------------------YGDNAKKANAGLFLIGDPKQAIYGFRGGD
RECB_BORBU            TA-------------------------------------GIKLIFIADPKQIIYSFRKAD
Q0SMM1_BORAP          TA-------------------------------------GIKLIFIADPKQIIYSFRKAD
RECB_CHLTR            ASP----------------------------------DYSGSLFLIGDPKQSIYEWRNAD
RECB_CHLMU            ASP----------------------------------DYSGSLFLIGDPKQSIYEWRNAD
RECB_CHLPN            ISP----------------------------------KFTGSLFLIGDPKQSIYEWRSAD
C6S650_NEIML          IAQ------------------------------------NRPLFLVGDPKQAIYSFRGAD
F4HA58_GALAU          LQAVTN-------------------------------ETTTGFTVIGDPKQAIYRFRGAD
D0KVH3_HALNC          RIGGNGE----------------------------AAGQAGTMILIGDPKQSIYRFRGAD
F6DBR3_THICA          NY------------------------------------ASHYLFLIGDPKQAIYKFRGAD
Q5NF53_FRATT          PLKNSSSHSHEGRNLLTNGLNLKDTRLREYDSSSDQNDSNLLLLMIGDPKQAIYGFRGGD
B2FP80_STRMK          GDSPE----------------------------VRELGLAPALFLIGDPKQAIYGFRGGD
C1ACJ1_GEMAT          AG--------------------------------------QPLFLIGDPKQAIYAFRGAD
F8E603_FLESM          ID-------------------------------------KSAVFFIGDPKQSIYSFRGAD
D4H410_DENA2          GR------------------------------------YGKPFFMIGDPKQAIYSFRGAD
C7PDT4_CHIPD          GE-------------------------------------STILFYIGDPKQSIYAWRKAD
                                                                   :.**** ** :  .:

RECB_MYCTU            IHTYLKAAGTADA------RYTLGVNWRSDRALVESLQTVLRDATLGHA-----------
RECB_MYCS2            IATYLRAAATAGD------KQTLGTNWRSDRALVDRLQAVLRGAQLGGP-----------
RECB_ECOLI            IFTYMKARSEV-H-----AHYTLDTNWRSAPGMVNSVNKLFSQTD---------------
A0A140NNW5_PROSM      IFTYIAAKKQV-S-----AHYTLETNHRSSEQMVEAVNRIFSHCE---------------
Q8D2T8_WIGBR          IFTYIKIKNKI-K-----NIYSLQTNWRSSVRMVNAVNFLFSRIK---------------
Q057F5_BUCCC          IFLYLKYKKKI-Q-----KCFFLKKNFRSSINMTKSINTLFSKTK---------------
RECB_BUCAP            IFSYLHAKFKI-K-----NYYYLDTNWRSSKNICKAINYLFSKNK---------------
RECB_BUCBP            ITSYLQAKSNI-K-----NQYFLDTNWRSSPKIINSINLLFSRLK---------------
Q493D5_BLOPB          IFSYMKIRRTV-C-----NKYNLNINWRSSLNIVNAVNQLFQLVS---------------
Q1LST8_BAUCH          IFTYIHARKLV-K-----ECYTLDTNWRSAPGMVNAVNQLFQSLP---------------
A1SUW1_PSYIN          IFTYMKARQNV-S-----AHYSLDYNYRSTPEMIDASNTFFEFCP---------------
Q87M84_VIBPA          IFTYIKARNQV-S-----AHYTLGTNWRSSADMVQAVNQVFALPD---------------
A6W0A9_MARMS          IYTYLAAKKRV-D-----SVYSLATNYRSSAAMIRSVNGLFTTQA---------------
RECB_HAEIN            IFTYLKASDEA-Q-----SRFELTKNYRSEKHLVDGVNALFDFPQ---------------
E1W5R9_HAEP3          IFTYLKAAKEA-N-----ERFNLGINYRSSQPLVDGVNRLFDFKN---------------
A6VNJ9_ACTSZ          IFTYLKAAKDAEQ-----ERFTLSKNYRSDGSLIRAVNGLFDFP----------------
B0BTM4_ACTPJ          IFTYLTASQQA-Q-----QKRTLAKNWRSLPPIVSATNRLFEFPEAAEN-----------
B7J9Q6_ACIF2          IDSYLQARRLTEG-----RHYALGTNYRSSHALVSALNAIYTAAEHDDPQGAFAY-----
F9ZQ70_ACICS          LDSYLRARADTAP-----RHYVLGTNYRSAEPLVGALNALYARADERCPGGAFDY-----
D6CML0_THIA3          IASYLRARQATQG-----RHSALQTNYRSTAEVVHSVNQLFERREQSAGAGAFLY-----
C1D6T6_LARHH          IFTYLAARHDTRPE----QRYTLDTNWRSTTAMVGVVNQLFCGSPEAGTVSETVF-----
Q5QUQ8_IDILO          IYTYLKARRDTEG-----RHYNLARNFRSSQAMVDGVNALFERAEELPRGAFLFK-----
A1TWK0_MARHV          IHTYLQARLGVQA-----RTYTLGTNYRSADTMVSGVNRVFEYSDQQSPKGAFLF-----
D3RS60_ALLVD          IHTYLIARAATQG-----RHYTLDVNYRSSTGLITAVNALFEHGERTATHGAFLF-----
K0NNV1_DESTT          IHTYLAARKDTRG-----RHYTLEKNYRSTKGMVNAVNRMFGQA-SGFPDGAFLF-----
K0CGD3_ALCDB          VFTYLQARRATEG-----HHYTLGRNFRSATPMVAAVNRLFEYS-QDSHGDVFMM-----
E1SLY0_FERBD          IHTYLKARRDTEG-----RHYTLDTNYRSTQQMVDAANAVFALG-ERHPDGPFLH-----
G0A1X0_METMM          IFTYLKAHQATQG-----KHYTLSTNFRSTAALVTAVNRVFAHADSQQTQGAFCF-----
Q1QYD3_CHRSD          IETYLAARRETPS------RFTLTRNFRSSVAMVEAVNRLFARHPTPFGS----------
Q3IJ14_PSET1          IFTYIGAKEAVQKQ----QQFTLGTNFRSSSDVVSSVNSLFGKHANSFIY----------
Q15V10_PSEA6          IHTYIAAKKLVDAS----RQFTLGTNWRSQPSLVEGVNTLFTQSEAGFLF----------
A1S6V0_SHEAM          IHTYLGARRTAAA------HYSLGTNYRSSSAMVQAVNTVFSVRERVFL-----------
E8RCD0_DESPD          IFTYIRARRETVPE----NRYTMGTNYRSTPAMVGAVNALFGC-RRDAF-----------
Q2SQD6_HAHCH          IYAYLQAKQRTPQD----NRYTMDTNWRSRKELVAAVNGLFEQ-CANPF-----------
Q60AZ5_METCA          LYTYLGARHQA--D----REYTLVENQRSVTEVIDACNALFGA-NPRAF-----------
Q74CY7_GEOSL          VFAYLEARQEIPAE----RRFTMDRNWRSTPEMVEAVSSLFRL-GGEHP-----------
B5EAR6_GEOBB          IFAYMGAAQ--ATK----ERHTLLQNFRSEAGLIDAVNALFA--SRELP-----------
Q2LTC8_SYNAS          IFAYMAAAK--QVD----AAYTLQENWRSAPALLNAVNSVFH--SHPNP-----------
A4SEL9_CHLPM          VFAYLKASRNVEEG----RRFTLTHNWRSVPQLLDAFNVLFS--NVPDP-----------
A8ZX09_DESOH          VFAYLEAVPGVDVA------CTLAENWRSRAGLVTGVNTLFQ--AVAAP-----------
B8FB94_DESAL          LFSYLQASR--NVE----ESYSLENNWRSSPQLIRGVNAVFS--RNPQA-----------
C7LVF7_DESBD          LHTYLTAAD--SCE----RGMTLGVNYRSTPELIAAVNRLFFRPDNPRP-----------
Q7NQR1_CHRVO          IFAYLAARH--DAE----RQYTLDTNRRSDEPLVATVNALF---GRELP-----------
I1XM81_METNJ          IFTYLKAKQ--DAN----ETYTLGKNWRSHISLVGAVNRLFM--QTATP-----------
M1PKI5_DESSD          IAAYFQARRSADY------LLGLERNYRSNPLLVAAVNRLFLQKEDAFVSPE--------
Q6ANK1_DESPS          IYSYFTARTKTDY------FYSLDTNYRSHRDLVRGVNGLFAGSDDPFLFKEE-------
G4SWQ2_META2          IFSYLAAQQQAHH------RFTLGTNWRSQPTLVEAVNALFR-RERAFFLEQ--------
F5ZCK0_ALTNA          IFTYLKAGQQADY------RWVMNTNWRSVAGMVKAYNRLFYGAPVPQAPVLQEPDLQES
Q480N9_COLP3          IFAYLNARSGCDH------HWLMDTNWRSTPQMIEGYNQFFTYKRNGSSSEETVSNEVNK
RECB_BORBU            ISFYNKEIKNKINTD---ARIVLKINHRSSKKLIGPLNKIFNNIYNNAIA----------
Q0SMM1_BORAP          ISFYNKEIKNKINTD---ARIVLKTNHRSSKKLINPFNRIFDNIYNNTIV----------
RECB_CHLTR            LPTYLQAKHSFPKE----AQLILDTNYRSTPELMQALNHLFSLPTPFLETP---------
RECB_CHLMU            LPTYLQAKNSFPKE----SQLILDTNYRSTPQLMQALNHLFSLPSPFLETP---------
RECB_CHLPN            LPTYLTAKSSFSED----KQLQLVNNYRSTPKLMEAINQIFGKISPFLEIPG--------
C6S650_NEIML          IYAYLQAAEDARH------RYTLATNYRSHAALIGSIGALFRLKERP-------------
F4HA58_GALAU          IFTYLSIKDSSEQHQAIEHIYTLQRNYRSSAKLIESINNLFLNAKNPFY-----------
D0KVH3_HALNC          MFSYLAAREATQGR-----HYTLDANYRSTPELVAAVNYVFERADRQPSGAFGHKTD---
F6DBR3_THICA          IHAYFAAAADCQS------HYTLDTNWRSQPNLVAAVNQVFDVENPFQF-----------
Q5NF53_FRATT          IFTYLKAKDSCPEE----NQWSMDTNWRSTGEMIKAYNRLFYKQDYQPEEEGQ-------
B2FP80_STRMK          IHTYLKAKQVAQQA------PVLDQNFRSRPSVLRALQALYDNGGED-------------
C1ACJ1_GEMAT          VRAYLEAARQASH------RYSLEFNFRSTPPMVQAVNALFSRSTAPFV-----------
F8E603_FLESM          IYSYIKAKENVESG------YTMKTNFRSESALVYGVNRIFNSRFRRENP----------
D4H410_DENA2          VYVYLKAASEEGNQ------YTLTKNFRSAPELVDAVNSFFQREN---------------
C7PDT4_CHIPD          IFTYFKARASVQHV------YGMNRNFRSSEPFIAAMNQFFLPVPGFDTFYFEGE-----
                      :  *                  :  * **   .      .                    

RECB_MYCTU            ------------------DIVVRGTDAHHAGHRLASAPRP------APFRLRVVKRHTLG
RECB_MYCS2            ------------------DIVVHDVQARHQGHRLVGAPRN------DPFRLRVVSRKP--
RECB_ECOLI            ------------DAFMFREIPFIPVKSAGKNQALRFVFKG---ETQPAMKMWLME-----
A0A140NNW5_PROSM      ------------KPFIFEQIPFNPVNFAAKNAGKILKHHG---QAVKALTFWQID-----
Q8D2T8_WIGBR          ------------NPFIYKNINFDKALSIKKNNNLNFFIEN---KLQSAIEFVMYP-----
Q057F5_BUCCC          ------------NPFIFKKINFQPSLANKKNNKNKLVINN---ITQPALKFIFKN-----
RECB_BUCAP            ------------NPFYFKNIPFEPILSSSKNLNMKFKIKE---KNQTAISFFFQK-----
RECB_BUCBP            ------------NPFLTKNITFYPVKSSRINKTTKFEVNG---KNQPALRFLLNK-----
Q493D5_BLOPB          ------------NPFIFEDIPFIPSVTASRNSMYRFLINN---QSQTAMCFWLHP-----
Q1LST8_BAUCH          ------------IPFIFSEIPFKPAVASAFNSNLQFMLDE---KAQPAMLLWLQA-----
A1SUW1_PSYIN          ------------APFIYNDDIPFSAVQAPDKRRKKLVVENKDDPAQSALQFIHPVGG---
Q87M84_VIBPA          ------------SPFIYDSDIPFLPVKYSPNAEKRIWTMG--GQKQPALTYWLQEAD---
A6W0A9_MARMS          ------------EPFRVTGIPFVEVQ--DRGIASGFSRQG---QTQAALQFLYQRS----
RECB_HAEIN            ------------SPFIYQNIKFTAVDSRDDHLRFYLNGKV-----EPAYRFYLTE-----
E1W5R9_HAEP3          ------------DPFIYENIEFLNVGAAKKNLVFQLNNQP-----EPAFRFYIND-----
A6VNJ9_ACTSZ          ------------AAFMYDDIRFEPVAAGKDQAHFVWRGAQ-----QAPMAFYLG------
B0BTM4_ACTPJ          ------------SPFLYQGIQFHSVEAKASEAELIGADYV-----NCYLQAKFD------
B7J9Q6_ACIF2          --------A---APGADNPLPYQPVQA-HGHQKVWRIH-GKAAPALTFWGAGEKL-----
F9ZQ70_ACICS          --------R---GEG-DDPLPYQAVAA-AGRSQRWQLG-GQEGPAITFAQHPLAL-----
D6CML0_THIA3          --------RDDEAPDADNPVPFIAVGA-RGRAEQLVCS-EGPVPALTCSVHQELE-----
C1D6T6_LARHH          --------G-------RPDIPFQAVRA-AGRSERLVQG-GMPVPPLTLAWRQEAG-----
Q5QUQ8_IDILO          --------TEAENQLPFNPVGANGLKR-TFKHCLLSSN-LKTAPALLWSVSGEEKR----
A1TWK0_MARHV          --------G----NGDSTPLPFQSVAA-NGTKRLWAVN-GEIQPSLVFWTHESGEEDKE-
D3RS60_ALLVD          --------REP--DGQGNPVPFHPARPRDQAERTLTID-GRPCPPLQGWVIPPGPSGK--
K0NNV1_DESTT          --------K--------DEILFEPVLA-RGRSEQLMVD-GKEATPVTLWQMDQEGPVV--
K0CGD3_ALCDB          --------D--------NAIPFKAVEA-QGRKDTLLVD-GETKSGVTLWVEDSDK-----
E1SLY0_FERBD          --------G--------ESIPFLPVAA-NGRKEVLMDG-DSPVPAMTFWWDEGDEGE---
G0A1X0_METMM          --------KH----QDYNPLPFIPVSA-KGREDAWVVA-QQAAPALTFWQIPADQ-----
Q1QYD3_CHRSD          -----------------DEIPFVEVAAKGQKARLCNAD-GQEVAALGAWWPGDER-----
Q3IJ14_PSET1          ----------------NDAIPFNAVAAKGKKADESFLIDGQPATAFEFCVFSDTAADEK-
Q15V10_PSEA6          ----------------KDSIPFQAVASVEQ--QSGLQVVGQAHNSLAFHHLTSNDG----
A1S6V0_SHEAM          ----------------SDEIPFEPVAASDSGAKTLLIDGKTQGPALQIALLGEDPD----
E8RCD0_DESPD          --------------VFTEDIDFQPVQAATEARAEPLLLDGE---PAPPLIGLLLDSERLK
Q2SQD6_HAHCH          --------------LFAGDIEFIPVQAAGAADASVLTLDDV---PVTPLQAWLLGRE---
Q60AZ5_METCA          --------------LLEG-LEYRPVRPGAKPRPVFTDVTE----PRSPFQVWLLPRD---
Q74CY7_GEOSL          --------------FLAGDIAFPPVTAARR-QGCSFGDRDP-----APLQLWFFRRGE--
B5EAR6_GEOBB          --------------FLYPQIGFNKVEAAPK-EKSRLVEAGQR---KAPLKLWLAPRKD--
Q2LTC8_SYNAS          --------------FVYEAISFMDSKPAPGGQKEQLILAGPDEWDPAPLQLWVIPDHQK-
A4SEL9_CHLPM          --------------FLFGEISYRSLVSGTPEREDRFVVQKDDGR-VPLEFLVLDASMK--
A8ZX09_DESOH          --------------FVFDEINFAPAAPASGAQIPRLTIDGNEP---AALELRLMESDD--
B8FB94_DESAL          --------------FVLDGIEFKSVRPKPGVNPALPLEKGQ----TPPLEIWAVAPKE--
C7LVF7_DESBD          --------------FLDPKIAYQPVSAPDK-ERDRFREDGQ---TPAPMVLWQVKSAD--
Q7NQR1_CHRVO          --------------FLLDGIAYQPVAASPSSGGRLEVDDDR----APFNAQWLPAGEK--
I1XM81_METNJ          --------------FIYEQIPFVEVDASRDQKPALQVDEGE----QAALQFCYVESDK--
M1PKI5_DESSD          -------------------LSYNRVDAAKSGDCWKLWQDDRVQAAMVYCSLESPEEDG--
Q6ANK1_DESPS          ------------------GLLYYPVKSGKSRDVYLVDAEKKPLVPFVYLQLEENDDDK--
G4SWQ2_META2          -------------------LQFHPVIGAPDNADKALSLDKKTLAPMMLWQLPQSD-----
F5ZCK0_ALTNA          DLQKLGTQAPSPRDVFGFNIQYNPVEFTPKAAAATHPLNDPNDERDAMNYVSFSLDEK--
Q480N9_COLP3          ---------QQSESVFGFGIPYLPVLAGKKSAQAQQVILDSDK---ALQFIHFTNDET--
RECB_BORBU            --------------DEIEKIDFTNSLPNQKNDNNKIVINGQEIEGINIITTNTES-----
Q0SMM1_BORAP          --------------HDIEKIEFTNSLPNQKNDNNNIFINGQEIEGINIITTNTEN-----
RECB_CHLTR            -----------------QNILYHPLHSKGSAEISYSEFSPIHFFSSEDIQ----------
RECB_CHLMU            -----------------QTILYHPLQSKGSASTSYSEFRPIHFFTTQDSQ----------
RECB_CHLPN            ----------------YLPIEYHALNPQSSETFENPPHAPIHFFFYETIK----------
C6S650_NEIML          --------------FVLENIGYSEVGAARAESRLSPKR-----PAVQVRWLHENDNEK--
F4HA58_GALAU          ----------------LDEIEFIPVEAAQQTSAFYVEGQAQKAWQLLQLAQDENK-----
D0KVH3_HALNC          ---------------EGNPLPFIRVSARGKARRLQRRNEAGEWQPCPPLTGWALPRDS--
F6DBR3_THICA          -----------------DALNFQPVKAGVTADPQLAQQPAWHWLTMPASEDGKP------
Q5NF53_FRATT          ----------IGTNIFSDGIGYQLVKASPDADKKTKDFDDNFKPINYFYYEVAEDD----
B2FP80_STRMK          -------------AFLERDIRFERVRPGGVRSDADYLRDGQAAKALTLRVLRSGGDK---
C1ACJ1_GEMAT          ----------------EPEIAFHPATARNFDPNPKGVAGSHGLHWLFVPPDTRNGNS---
F8E603_FLESM          --------------FVIENIGYSDVDSENKGETKLIVEGEEYKPLKIWAFETSDGN----
D4H410_DENA2          -------------AFMEPRIEYIPSVGGHKELALTVAEKPQPHMIVWETEKTK-------
C7PDT4_CHIPD          ----------------GSAINYIKVDSPESNTKGLLFRGDEPDVPISVFNTSNST-----
                                                                                  

RECB_MYCTU            YDGTAHVPIEALRRHIPDDLAADVAALLASGATFAG------------------RPVVAA
RECB_MYCS2            -GNTRVIPIDQLRRHIGRDLAADISALLNSGATWCD------------------QPVQAK
RECB_ECOLI            ---GESCGVGDYQSTMAQVCAAQIRDWLQAGQRGEALLMNGD----------DARPVRAS
A0A140NNW5_PROSM      ---AEAVSIADYEQTMASQCAAQISQWLQGGAEGTSLFQHSDG---------KQHPVSAA
Q8D2T8_WIGBR          ---KNNIGLHNYQKYMAEQYAIKIYNIINSSDYKKTYLENKYS---------HK-NVIIS
Q057F5_BUCCC          ---KKTINKNEYFTWISKMCAYSINNLLSNKSTKKSFIIFKNK---------KKRSIKNT
RECB_BUCAP            ---KEEVNIEEYRDWIAKQCANEISYWLTCS-KKGEAIISDGS---------QERILTEK
RECB_BUCBP            ---NKNISINEYKEWISITTAKYISYWISSG-IKGNATITISN---------KVRTVNFS
Q493D5_BLOPB          ---DEIVTIGDYKRSMAQECATILYNLLHEI-RNGTAWLENDK---------YKRKLEIS
Q1LST8_BAUCH          ---SNNVGVAHYQKSMAHQCAATISYWLRSS-NAGLAWLESNK---------GRKQLQAS
A1SUW1_PSYIN          ---EN--SQG-FKDSITHACINEIKKILLLAQQDKAYLEDKKG---------KRSIIRAN
Q87M84_VIBPA          ---DKPLPKGEYLTRMAEATASQIQTILTQAQQGQACLVNGE----------KQKAVQAG
A6W0A9_MARMS          ---DEPVSAKEYRQTMAESCAAHLHELLLEGQQGEALIDGKG--------------VRPK
RECB_HAEIN            -------SDKVNKTEMAKICAISIQHWLKSAAENQAVFQNED----------TYKTLQAA
E1W5R9_HAEP3          -------KDESTQQDYAKACATSIQQWLKSAAENPIVFPNESK--------AENQTLRAE
A6VNJ9_ACTSZ          -----------SREQAAEYCADNIRQWLTSADENQAGFVMDTAQDN-----GRNLRLRPE
B0BTM4_ACTPJ          ------------EKLAAKQCAYQIQQQLKQMEAGEFGLKFTNT--T-----EEINAFQAK
B7J9Q6_ACIF2          -------NKGDYLERCAAQAAECIVGLLD----NPEAGFAQ-EGE-------ITRRLEAK
F9ZQ70_ACICS          -------TKEEFLTHFAEWTAATIAQLLG----DSTSGFVG-ADG-------KLRRVGAG
D6CML0_THIA3          -------SKRDARERFAAHAAARIVSLLN----DTQAGFRQ-ADG-------GFARLRQS
C1D6T6_LARHH          -------NKDDYRQEFARRAAEAITTLLN----DSEAGLLA-DDG-------GFEPLAPR
Q5QUQ8_IDILO          -------NKDTFFRAAANHHANLIASLLN----DPQAGYYDGDDK-------LEQRVKTS
A1TWK0_MARHV          -GNPKGLAKGTATADVAETCASEIARLLTLGQAGQAGFVLPDNPA-------DLEPVEPS
D3RS60_ALLVD          ------LNKDAYRARTAEAAARAIAELLRLGQAGRA--LLPVGQD-------GERPLEPS
K0NNV1_DESTT          -----KTGPDGYLTRMADAAAGRIVRLLNLGGQTPCRAGFQTEDG-------RITPLCPS
K0CGD3_ALCDB          -----AISSGVYRQHQAARCATEIAHLLS--GAEQGVTGFR-EDQ-------HFTLLRPR
E1SLY0_FERBD          -----VLSKGEYVSRQAQACAEEITRLLN--GAAKGDVGFD-RDG-------ERSPLAAA
G0A1X0_METMM          -----AIGMPAYRLQMAAATAGEIVRLLH--SGDTGQTGFKTPAG-------NIRPLQPA
Q1QYD3_CHRSD          ------HAKADYQASMASAARAEVQRALE------GGWHFVDEKG-------GQRDVRPA
Q3IJ14_PSET1          -N--KPTGKAIGQQHLATFFANKIVTLLT-----QAEQGRACIG---------EKPVSAA
Q15V10_PSEA6          ----LPIGWGEAQSALAQQCALSIAQFIH-----QGASGEAQIK---------QRPVRPG
A1S6V0_SHEAM          ----KGLNKQTARALMAEDAAAHIGQLLC-----LATEGRAVLAD-------KQRPLLAK
E8RCD0_DESPD          STRSTTISKDKALRAAVTVCSNTIVGLLDQARLGQATIGG--------------QALQTS
Q2SQD6_HAHCH          -DGGKTISKDQARPQLAQITASEIANWLNLGECGRARLGE--------------RPLSAG
Q60AZ5_METCA          -EAGGWLPRTEAVRRCTDTTAAEIARLIQEGMAGRIRLGE--------------RALRAS
Q74CY7_GEOSL          -SDRDCINLGTGRQRIVTAVADEISGLLADGRAGTACLED-----EDGR----MQPLTPG
B5EAR6_GEOBB          -AGK-PINKGDAWEQLPETVAAEISRLLRDGADGKLTVEELRKDAEEGSENWVQRAVEPR
Q2LTC8_SYNAS          GGKVKPLGKGHATPGILQAVTAEISHLLDAGRKGMALIGN--------------RRIEAG
A4SEL9_CHLPM          --ENALFSVDEATGFASEAVAGEIFKLLRSARNGETLIGG--------------RPLRAD
A8ZX09_DESOH          --FSTKTQKAAWIQLVARDTAAQAARLVALGREQKAWLGD--------------RPLAAE
B8FB94_DESAL          ---DKAVTIGEVQNIAVRAVASEVSRLLGLGEYS------------------------PS
C7LVF7_DESBD          ----KPLAKGALAPRICRAVAAEISRLLRGAAEGRIRIGD--------------APLLPG
Q7NQR1_CHRVO          -----ELSKEAAELAAAEACADEIARLLTLAGEDRAAIVK--------GASR--RRLAGG
I1XM81_METNJ          -----PLNIDPMKSTAVEVTTNEIARLLILAADNKARLLD--------EDSQQTRPLTGG
M1PKI5_DESSD          ---VTPWTSGKIRERLELYVAAEIRKLLHGGSLLTDTGEKRG--------------ITAG
Q6ANK1_DESPS          ---KGKWSSALARTAIRGDIVAETLHLLSISEPTSIHKLNRDGQSI-------YQPLRPQ
G4SWQ2_META2          ---KGHWSSGKAGECLQAEVVNEIVGLLNEPYFLSDSGRRVQ----------------PG
F5ZCK0_ALTNA          ------SDANTLRRGLAQWIAQEIYRLFNEVTFVDEKDPTK-----------PARPVKPA
Q480N9_COLP3          ------SNDTNPQGDKVSQGSRPMLANWCANEIVTLLASKE-----------QTGKVNPK
RECB_BORBU            ------------EEDIYQKTALTIKYLLAYGKIAENNK---------------IRNIKMQ
Q0SMM1_BORAP          ------------EEDIYQKTALTIKYLLTYGTITENNK---------------IRNIKMQ
RECB_CHLTR            -----------EETLWISKTASYLRSAYS---------------------------IPFG
RECB_CHLMU            -----------EEALWISKTASYLRSTFA---------------------------IPFG
RECB_CHLPN            -----------DQALWIFSEALRLQKEQK---------------------------IPLG
C6S650_NEIML          ------ANKDVLRRRAADYCADEIAHALNEAAGGRLNFKGC--------------PLQSG
F4HA58_GALAU          ---------SVTMEIMAQAFASHLQQLLIASQQGNAYFCADGQ---------EQQAVSAK
D0KVH3_HALNC          -----LLAAGHFVEQMAEHTAEAITSSLNAAQVGDCAFFDAEG---------AMTALRPQ
F6DBR3_THICA          ------WPNKASEPIIQQNLLAEISELLQH------------------------QSVLPK
Q5NF53_FRATT          -------NKSDIDTNLSLWTVNEITRLLNT------------------------QKVAEN
B2FP80_STRMK          -----AMSADASRDAATQACVAAIHQILVDARAGNAVLRG--------------RPVQPG
C1ACJ1_GEMAT          ----VPTPIGQARTLLFRACASRIASYIK-------------------------QEVPPG
F8E603_FLESM          -----LINEDEYNEAAALTTAREVARLLKLSAESKAYIKHKDK----------YEQLKPA
D4H410_DENA2          ------------PEEIALSTARHISELLNKSSYGSAHING--------------KAVKPS
C7PDT4_CHIPD          --------------ELSESVAAQVAALLRSGEYFIGDEDER-------------RPVKPS
                                                                                  

RECB_MYCTU            DIAVIVEHHKDARACRNALAEAGIPAIYTG-DTDVFASQAAKDWLCLLEAFDAPQRSGLV
RECB_MYCS2            DIAVITETHKDARACHAALLAAGIPAVYTG-DSDVFTSEAAEDWLYLLEAFDQPHRPGLV
RECB_ECOLI            DISVLVRSRQEAAQVRDALTLLEIPSVYLSNRDSVFETLEAQEMLWLLQAVMTPERENTL
A0A140NNW5_PROSM      DITVLVRSRREATLIRDALNQLGIPSVFLSNRESVFATQEARDLLWILQAVLSPEKERIL
Q8D2T8_WIGBR          DITILVRNRTEANFMKIACDKLSIPNIYLSDNSSVFHTLEAKDIIQILNAILFPENENIV
Q057F5_BUCCC          DIAILVKNKYEANIIKKEFKKYGIKTIYTSEKKNIFQTKEAKEILFIIESLSDLSNILKL
RECB_BUCAP            DIVILVRNRTEAQIIKESLKKVNILSKYSSPYESVFKTFDALELLSILKSILDPTDINLL
RECB_BUCBP            DIAIIVRNNLEAKTIQLELTKLNIQSLYLTSKNNIFQSKEILEILWILQAILNPNIERLL
Q493D5_BLOPB          DITVLVRNHEEASLICSALSKVNISTVFLSNHKNIFETMESYELSLLLRAILFPESHT-I
Q1LST8_BAUCH          DIVVLVRNRDEAALINDAMTALSIKSVYVSSFSSVFQTIEAREIMCLLQAIVEPEQHNKL
A1SUW1_PSYIN          HIAVLVRTGKEAQLIRNALFNENINSVYLSLKESVYATSHAKDLLRILQACLNPENERLL
Q87M84_VIBPA          DIAVLVRTGSEGRMVKQALADQGIASVYLSNRDSVFTSSVAQDLQRLLQAVLTPENDRAL
A6W0A9_MARMS          DVALLVTNFSQANALKDALRQRGIASVYLSDKGSVFETVEARELLIVLTAILSNGQESKL
RECB_HAEIN            NIAVLVRDKNEAALVKNELQKLGIASVYLSDQNSVFDSNVAKELAWVLKACLN-VAERPI
E1W5R9_HAEP3          NIAVLVRGYTEADLVKKELQALGIASVYLSDRGNVFESNTAKELALILQACLS-VTERPI
A6VNJ9_ACTSZ          NIAVLVRKGSDAEKIKSALQRRGIASVYLSDRTNVFDCAEARELAFILAACLNPFSERHI
B0BTM4_ACTPJ          DIAILVRSHSQATLIKSALAELGIRSVFLSEKESVYQSETAKELLWVLYACLNPYHQRHL
B7J9Q6_ACIF2          DIAILVRDRHEAASIRQALHHRQLRSVFLSEQDSVYASEEARELLLWLEAVAEPEDARRL
F9ZQ70_ACICS          DIAILLRDRKEAAIMLSALHRRGLPAAFLSEKQSVYHSPEAEELRLWLFALLHPEDEAAL
D6CML0_THIA3          DIAVLVRDGDEARAVRRALQRRGVASVYLSDRDSVFASPEAADLLRWLRAVAEPRDGRLA
C1D6T6_LARHH          DIAVLVRDWQEAAAIRRALDLCSVRSVYLSDKDSVFASQEAQDLVRWLDAVLYAEDNARL
Q5QUQ8_IDILO          DIAVLVNNFNEANAIKKALSDRGLKSVYLSDRESVFAQRVAKDLLALVSACAEPRDPSLI
A1TWK0_MARHV          DIAVLVNNRNEAAAVRDALGRRRIKSVYLSDRDSVLTSREANEVLCWLRAFAEPRQLAFI
D3RS60_ALLVD          DLAVLVNNRNEADAIRTELRRLDVASVYLSERGNVFDTQIARDLAVLLRAIADPFDDRLM
K0NNV1_DESTT          DMAVLVRDGMEARAVRAALEKRRVRSVYLSDRESVFDTQEAVCLLYLLQACMEPSNERML
K0CGD3_ALCDB          DVAVLVRDRTEAKAIRDALLARGVRSVYLSDQDSVFAQPEAQDLLLILRACASPESDVRV
E1SLY0_FERBD          DIAILVRDFREASAVRDALSERGVRSVYLSDKDSVFSSEEAEALQRILQAVALP-SERAI
G0A1X0_METMM          DIAILVRSGNEARIMRNALAERQLRSVYLSERESIYASAEADDMLIWLKALAEPRNERKV
Q1QYD3_CHRSD          DIAILVRKGSEALAVRRALAEGGIRSVYLSERASVFDTALAFELLQLFEAVAQPRQDARL
Q3IJ14_PSET1          DICILVRDRVEAQIMKKALSTAKIASVYLS-RESVFSQELSHHLLNFLTALHGQYDESLL
Q15V10_PSEA6          DCCVLVRDRNEADTIKQALAALGVDSMFLA-RKSVFASQTAVDLFAIIQALANPSNDRYL
A1S6V0_SHEAM          DIAVLVRDRNEAAFIKDALTRRNIGAVFLS-RDNVFATKEASELLHVLAALAQPRDEKRL
E8RCD0_DESPD          DIAILVRSHREAEAMQAGLRRRGVNSLASS-QASVFASEEARQLALVLAALVDPGDPARI
Q2SQD6_HAHCH          DIAVLVRDNKQARIMSEKLSAVGVSSVFLT-RESVYQSEEATDLLRLLRALLEPNDERRL
Q60AZ5_METCA          DIAVLVRRHAQGRLIRQALARLGVGSVELS-QASVFHTLEAEEIERILLAVLEPGRDRLL
Q74CY7_GEOSL          DVAVIVRSHFEAGLVQQALRERGIPSVVQS-ADSLFETREAGEVWTVMGAVAEPGNEGRV
B5EAR6_GEOBB          DIAVLVRANRQAKLMQRALTHRGIPSVLCS-AGNLFESDEAAELLRLLSAVAQPGHESLL
Q2LTC8_SYNAS          DVAVLVRSNREARLIQQALLEGSIPAVMHS-RDNLFDSLEATDMDLLLRAIEVPNDERRL
A4SEL9_CHLPM          DIAVIVRSHRQAARVRDALTLFAIPSVVRS-DRSVFASNEAREIAILLAALVDPSDEGKI
A8ZX09_DESOH          DMAILVRRNTEAILVQEALSRLNVHSTILK-AGDLFGSHEAFEMQVLLSAVAFAHDLSLV
B8FB94_DESAL          DIAVLVRSNMQAQAVRDGLRQAGVHSVLNR-TGDLFETPEAVEIRRVMTAAA-ANRLQNV
C7LVF7_DESBD          DIAVLVETHAQGEAIHQALGALRIPSVVTH-TSSVFASPEASELLSVLRGMAECQRPAAL
Q7NQR1_CHRVO          DIAVLVATHSQGDRVRSELRARGVASVALT-QESVFASREAGEMLALLHAWAEPANEGRL
I1XM81_METNJ          DIAVLVPSHAQAELIQQALRRRGINSVQQG-RENVFASRQAADLSCLMLALAQPDHHQRL
M1PKI5_DESSD          DIAILVRSNKQAESFQESLARGGIPAIVFS-RKTVFETPECRDLQRVAEAVAMPSDVRLL
Q6ANK1_DESPS          DIAVLVRSNSQAEAYQQAFLQVGVPAIIAG-RKTIFETDESHELLLLLQAIIDHDDLRLL
G4SWQ2_META2          DIAVLVRTNRQASEYQAALREAGVPSVLNS-TESVFATAEAADLFCLLQAIAHPGDTVLL
F5ZCK0_ALTNA          DIAILVKNRNEASVIKYVLQQQGLACVYLSDRSNLFATPEAKDVLRLLNGVWHNTDTSKV
Q480N9_COLP3          DIAILVRDGAEARDIKHALQQAGLDSVFLSDRANLFHSQQAKQLLGLLKGVLLPENERLF
RECB_BORBU            DIKVLCRGKNEINLIDKALKKEQIQTNKTQ--EKFLKTKEFSEIFYIIKCLDRKQSFKTL
Q0SMM1_BORAP          DIKVLCRGKNEINLIDKALKKELIQTNKTQ--EKFLKTKEFSEIFYILKCLDRKQSFKAL
RECB_CHLTR            NMAVLVQDYPQ---ALKLITHSTIPMAYCKEKRIFDRTESPYLLILLLEALLYPENQQKI
RECB_CHLMU            NMAVLVQDYPQ---ALKLITHSTIPMAYCKEKRIFDRTESPYLLILLLEALLYPENQQKI
RECB_CHLPN            NMVVLVSDSNQ---AFELISYATIPVSFSKNKSIFHLTETHILTTALLEAILHPENYEKI
C6S650_NEIML          DIAVLVRTHNEAVMVSAALKKRQVQSVLLS-RESVFASPEAAALSALIGFWLEPRRAGTL
F4HA58_GALAU          DIAILVRNGKESDIIRRALTQKGIASVYLSERSNVFTSVAAKDLYRILRACLTPFNERAV
D0KVH3_HALNC          DIAILVSTGDQAAVLQQSLIRRGIKSVYLSDRHRLFATEEAADFHRWLLAIAEPQRQDRL
F6DBR3_THICA          QIAILVRSNFRAESYRQALAQLGIPAVIKS-RESIYSTPQAEQLYRVIAAILEPNNSRLI
Q5NF53_FRATT          DIAILVENGKQAKIIQQALQAKNLSSVYLSQRDNVYHSQEAKEILALMEGINDLENKSML
B2FP80_STRMK          DIAVLVRSHREATLVQRALAAVGIPAVAAG-KQSLFATAEARDLRALLLALLQPADEGRL
C1ACJ1_GEMAT          RIAVLVRKGFEGVEMVQVLAEAGVRSVVSG-LGDVMQSLEMAELQRVLEAIAVPRDPSRV
F8E603_FLESM          DFAVLCRKTKEAFIVKKYLDQLGIANIISS-SKSIFDSEEAYEIHLLLNCISEPGNLNMI
D4H410_DENA2          DIAVLCRNKKEMTMVKEALTYCRVPAVVSG-SENVFSSDEAVEMVNILSAVISPFSQSHI
C7PDT4_CHIPD          DIGILVRTGRQGREVKAQLARLGIPAVTVD-DAKVLQSEEATYLLYLMEAMLAP-DRSSI
                         ::                  :          .                         

RECB_MYCTU            RAAACTMFFGETAESLAA----EGDALTDRVAGTLREWADHARHRGVAAVFQAAQLAGM-
RECB_MYCS2            RAAAATMFFGETAESLAA----GGDALTDRVADTLREWAGHARERGVAAIFEAAQLAGM-
RECB_ECOLI            RSALATSMMGLNALDIETLN--NDEHAWDVVVEEFDGYRQIWRKRGVMPMLRALMSARN-
A0A140NNW5_PROSM      RSALATGTLGLNAKEIDALN--YDEKAWEALVDEFSQYALIWRKRGVLPMLRVLMAERH-
Q8D2T8_WIGBR          RCALLTKMFGLTNVEIQKLN--YNKKIFKKIILEFILYRDLWDKFGIMQMMNYILDNKN-
Q057F5_BUCCC          QKLLMTKIFSKNIYDIYSIN--NKKKTYSSLIKKLKKYYLIWKKKNIFFMFKKIIFDFC-
RECB_BUCAP            KKSILTHILNKIAFQKIKEN--SKTKISHFLIQKLYEYNDKWKTIGIFYTIKTMILEYQ-
RECB_BUCBP            KRAMSTNIMSKNTKEIISIP--NNHSYWIKLSQEFNQYLIFWNNYGILYVIQQLIINYN-
Q493D5_BLOPB          CTALTTVFFGLNATDIESIN--NNESKQERIFEKFFEYYSVWKKKGVYLMIQKVIFDHK-
Q1LST8_BAUCH          RCALATSLLGGEVDVIESFN--INEKINNKWRGKFNLYHKIWQQHGILPMLRHIIIENH-
A1SUW1_PSYIN          RAAIACKLFCQTPYQVHQIL--LNTRLWEEKIGQFIEYRRQWRSVGILAMLHKLFHQQA-
Q87M84_VIBPA          RASLASELFALDAASLDALN--NDEVVWENAVNEFKEYRKLWVQRGVLPMLRAVISKRH-
A6W0A9_MARMS          RSALATSLVDWSLEDLDTLN--HDDVVYEKWGQAFRDYLELWDKQGLLPMLREFMQDVS-
RECB_HAEIN            LNAIATALFGLNAADIHQIQ--QNEADWQRWADSFAQYQQTWQRQGILAMLHQILLEQG-
E1W5R9_HAEP3          LNAIATALFGLNAAEIHQIH--QDEIQWQRWAEKFAEYQQIWQRQGVLPMLHHLLLAEN-
A6VNJ9_ACTSZ          MNALATGIFAFSMAQLQQIK--RQAELLDGWMTRFEDYQRIWRRQGVLPMLHRIFLDKGK
B0BTM4_ACTPJ          LSALGTTLWGLSATEIHQLK--NSELQWDEQVGRFITYQQIWQQQGILPMLHKLFMQEG-
B7J9Q6_ACIF2          RVALALPLLGQPLSALDAFH--QNETAWEAQLEQFQDLSRQWRRQGVLAMLHHSIHQFG-
F9ZQ70_ACICS          RCALALPLLGLTQHDLWRLD--TDEGLWAQEVERLREYARIWAHSGILTTLHRRLHQQA-
D6CML0_THIA3          RAAFAAPTLGATIDELAALA--TDDDVFENRLALLAELQTIWLRQGVLPMLRQTLHRLD-
C1D6T6_LARHH          RLALATATLGLDYAGLDRLF--NDEREWERTSERFRSYRQTWRQQGVLPMLLALLHDYR-
Q5QUQ8_IDILO          RSALATQILGLPLSELEHIH--SHEREWEQRVEQFLSYHDQWQRQGVLAMLHSLLHDHQ-
A1TWK0_MARHV          RAALATPTLGQSWQALDRLL--TDELILEREIERFQRYQQQWQSQGVLPMLRSFLMDFE-
D3RS60_ALLVD          RQALATRLLGQGLTDLDRLN--RDELHWETQGERLRDLNGRWRRQGFLPMLYRLIGEFR-
K0NNV1_DESTT          RTALATPVLDLPLKLLDKLN--RDEIAWEAELVRFKLFQKIWRNQGVLPMVRALLLEFN-
K0CGD3_ALCDB          RSALASGTLSLPYQELDRIN--RDEVRWEATVNRFHGYRAQWRQQGVLPMFRGLLMDFS-
E1SLY0_FERBD          KAALATAVLGFSWAALDAFN--HDELAWERELAQFRELKLCWQRQGVLPMIRRLLAHYG-
G0A1X0_METMM          RAAISTATLGWTYQTLLQLT--LDELAWEQHLERFIAYRQRWLQDGILPTLRQLMSDYA-
Q1QYD3_CHRSD          KAALATRLLNDNPAALETLL--ADELAWEREVERFADYHRQWQRRGVLPMLRAVMRDFR-
Q3IJ14_PSET1          RGVLAGPLFCLSYNEIYALA--DDEAQWQEHLNFFAQLSHIWNKQGAMAMLERLMSHNQ-
Q15V10_PSEA6          RGAIASELFCYDATTLDALF--SDEWQWQKLVEQFAYWHQLWQRQGLMMALNILMRHFK-
A1S6V0_SHEAM          RAAMATRLMGWSLSEIAAFN--QDEEARRQALECFERWHQRWQKQGVMPALMAFADDTK-
E8RCD0_DESPD          RTSLATDLFGCNAGQLHALN--SDERAWEIRLADVHRYRQLWQEQGIMPMLQQLLAQEA-
Q2SQD6_HAHCH          RAALVTLSWGWTAAELETLA--RDEQRWENMLTSLHQLREEWQDAGFMPMFQKWLQNFS-
Q60AZ5_METCA          RAALATEIMGCDALTIAGIS--ADEDRLLEIMLRFGEYRELWQLRGFGPMYRRLLHDEG-
Q74CY7_GEOSL          RAALVTALFGLNGNDLALLM--EQEAAWEARIAAFRDYRDLWREQGFMTMFRALLDREG-
B5EAR6_GEOBB          RGALATDLVGVSGTELARLM--DDEKGWEEILEEFRSYHDTWNSGSCMSMALQFMEKRE-
Q2LTC8_SYNAS          GAAMMTSLLGLSIGALYRLK--IDERQWENCLQRFRNYHRQWQEAGFMRMMRSLLRIED-
A4SEL9_CHLPM          RAALITDILGRSGNDIGAMM--DDESLWVPQLHFFARLHSLWIERGFMTMATVLLREED-
A8ZX09_DESOH          KGACATQMMGHDARRIAGLS--LEADTTDPVVERFLSYRDLWRRHGFMKMFSRLLRREE-
B8FB94_DESAL          KAALSVSFLGWTAEELDRLA--PGEEVVEKVLTLFSDLHEIWQKSGFMRMFTYFMHNKE-
C7LVF7_DESBD          RTALAAPMIGLTAPDLALID--EDGEKLEEWFERFLACRELWDRRGVMAAVRRLFAGQD-
Q7NQR1_CHRVO          RRALATELAGLDAARIQAEL--EDETRWERQLLKNADDHQRWREHGFMAAWRHYFARER-
I1XM81_METNJ          STVLAGPLFQYSAEELYAIQ--QDELRWNALMDQLQLLQQRWQQSGFMAMFRALLQLDN-
M1PKI5_DESSD          RSAMSSRWFGMNGPELYEQV--HDEQIMEGWLERFHDYNRLWQEKGFLAMMNSLFVRES-
Q6ANK1_DESPS          KTAMTISLFACTGDDIMAIW--QDEQAVAEWYNVFLQCYHLWSERGVLTMLYFLVDSKE-
G4SWQ2_META2          KQALTLDWFGLDGQTLYRTL--NQEAALDAWLSHFLNYYQHWQSQGLMAMMQRLLDQEQ-
F5ZCK0_ALTNA          ASSLASPLWGYTPQTLVNLLYHEDDALWDEAYDKVTSLRDMWLQKGCMSVLLHLMQENY-
Q480N9_COLP3          VAALSCGLLGFDAKKLHQLQ--QDEMAYQTLKFAFVDYRTQWQRQGFITMAINLMHNLL-
RECB_BORBU            NYILSSKILNVPWNLQRILIKQDKICLIEEFIENIIVLLEKNEITLINAINKITFEKNLW
Q0SMM1_BORAP          NYILNSKILNVPWNLQRILIKQDKIHLIEEFIENITALLEKNEITLINAINKITLEKNLW
RECB_CHLTR            QAILMSRLFQLSSTEIHQHL--------KTFSSLFFTLNRHLYHYSLLATFYKLMGENVL
RECB_CHLMU            QAILLSRFFHLSATDIHQHL--------KIFSSLFFMLNTYLHQYSLLATFYKLMGETVF
RECB_CHLPN            SKILFSSLFGLSLDEVTTKK--------EDFTIYFQSLHSYISHHGLLATFYRVM-----
C6S650_NEIML          RFVLTSSIFGYNAQQLHDFN--QNESEILHWAESARTALDNWNQYGIFAAMQQFSQTHG-
F4HA58_GALAU          LAAVGCTLWGLTADQIYQLK--QNETEWAALIERLLHYQTVWQTQGVLPMLYQLFQAEQ-
D0KVH3_HALNC          RAALGSSSFARHWGELDAVR---NDARLDEDTSRFMAYQRITRHQGILAAVYQLMHDYH-
F6DBR3_THICA          KPLLGLDWFGLNSDQVHHIL---NSDELEHWFELMQSLNQRWHKTSFIAALYTLLEQKA-
Q5NF53_FRATT          KRALSTSLLGGRADKFISYIDENDVSAWDDEIEKAKSLRQQWHKYGFMTFIMQIIHENF-
B2FP80_STRMK          RAALATVLLGQRASAIAAME--REGDLQRGFQAQLLHWRERWQRGGPFAVIADVCAAQG-
C1ACJ1_GEMAT          RAALATTLWGATHEDLVRLASPEGEREWEEILTEVASLRELWATQGTLQLLERLFESRA-
F8E603_FLESM          KNFLITDLMGFKPHHVKNME---ESEGLGGYSIKLRGYKELLISRGIMHCVNEFLKDEQ-
D4H410_DENA2          KTALASSAFGYTAKEIYHIT---ETDQWDDITEEFRNYNDMISLRGFAPMFFHMASVRK-
C7PDT4_CHIPD          NRALLSPFTGLKLESVLTLD-------DEVTLGLFGNYKNRWQQDGIYTAMMDFVTDFN-
                                                                                  

RECB_MYCTU            -------GRRVLSQRG-------------GERDLTDLAHIAQLLHEAAHRERLGLPGLRD
RECB_MYCS2            -------GKRVLSWQG-------------GERLMTDLAHMTQLLQDTAHREGFGLAALRD
RECB_ECOLI            ------IAENL-------LATAG------GERRLTDILHISELLQEAGTQLES-EHALVR
A0A140NNW5_PROSM      ------IAESL-------LSAVE------GERRLMDLMHIGELLQEMSLQLEG-EHTLVR
Q8D2T8_WIGBR          ------YFTMF-------NKFKK------DIKYFSNIIHIVEILHETSKKIKN-KHELLK
Q057F5_BUCCC          ------FQKKN-------IKLKI------NNINIYNIIQLCEILEEKNKSIKN-KFLLTI
RECB_BUCAP            ------KYANN-------FEMYK------NQQRNINFLHIAELLQEKSQNCYK-ENSLMR
RECB_BUCBP            ------ISNNN-------NLLHN------FSPNIKNILYIGELLEEKSITIKN-KFLLIN
Q493D5_BLOPB          ------VPEKL-------LSTRV------GESSLINILHLGELLQDAARQLQD-EHALME
Q1LST8_BAUCH          ------IAEFW-------LSSYS------GERCITNVLHLGELLQQASVQFDN-EYALVR
A1SUW1_PSYIN          ------ISAYL-------LKDTQ------GERLLTDVLHLAELLQKNSVDHDG-EFALLR
Q87M84_VIBPA          ------IAERL-------LEEGASSQGENGERVLTDLMHIGELLQQASNELDS-DHGLLR
A6W0A9_MARMS          ------LAANI-------LSHTG------GERRLTDFLHLTEKLQQKSLELDS-KEGVLR
RECB_HAEIN            ------ISERL-------LSQA------TGERDLTDFLHLAEILQQAATLHES-EAALLS
E1W5R9_HAEP3          ------ITEKL-------LSRP------DGERKLTDLLHLAEILQQAAALNES-EAALLR
A6VNJ9_ACTSZ          RGEQADIVGQI-------AAQA------NAERRLTDLLHLAELLQEAAVLHES-ESALLS
B0BTM4_ACTPJ          ------IIERL-------RANPR-----DSDRRLTDLLHLTELLQNAMPSLEN-ESALVR
B7J9Q6_ACIF2          ------IAARLLTQPE-------------GERRLTNLLHLGELLQQASATIDG-PEALVR
F9ZQ70_ACICS          ------TAARILARPD-------------GERRLGNLLHLGELLQRASQHLEG-REALLE
D6CML0_THIA3          ------LPARWLSEED-------------GERRLTNVLHLAELLQTASGTLDG-EQALIR
C1D6T6_LARHH          ------LPARLLARRDEG-----------GERQLTNLLHLAERLQADAAGIDG-EVGVLR
Q5QUQ8_IDILO          ------VPAKLLEDRIH------------GERQLSDVLHIAELLQQQSLVLDG-IPALVN
A1TWK0_MARHV          ------VPGRLLQRPD-------------GERRLTDILHIAELLQQDSLQLDG-EHALVH
D3RS60_ALLVD          ------IAARLLGTTD-------------GERAMTDLLHLGELLQRASEELDG-EQALVR
K0NNV1_DESTT          ------VGARLLSTPS-------------GERQLTNLLHLAELLQTAAATLDG-EQALIR
K0CGD3_ALCDB          ------VPARLQRSLD-------------GERAFTNLLHLAELLQQAATQLDG-EQALIR
E1SLY0_FERBD          ------VAQRALADPRY------------GERRLTNLLHLAELLQGASAQLDG-ELALIR
G0A1X0_METMM          ------LPARLQTLPD-------------GERRLTNLLHLAELLQQASSHLEG-EQALIR
Q1QYD3_CHRSD          ------VAERMGARDD-------------GERALTDLLHLGELAQTVSARLDG-EHALLR
Q3IJ14_PSET1          ------LSAKWQGLGYN------------VERWLTDFRHLGEILQQKQIELEG-TLRLLR
Q15V10_PSEA6          ------IAERLVGQYHD------------GQRRLTDLRHLVELLQVQSQLMSG-ESQILH
A1S6V0_SHEAM          ------LLERLGGDKE-------------ADRRLTDFRHLCELLEQAGASLDG-ISALLG
E8RCD0_DESPD          ------VTRRLSARVG-------------GERSLTNFLHLAELLQQSP-AGRHGMAALLR
Q2SQD6_HAHCH          ------VAARLLGLPE-------------GERRLTNLLQLAELLQQAG-RDYPTPERLLA
Q60AZ5_METCA          ------VARRVLAQPD-------------GERRLTNLLHLGELLHQAQ-AGLTSPDALLR
Q74CY7_GEOSL          ------VRERCLPLPD-------------GERRLTNLRHCAEVLHQAAVERRLGPDALTA
B5EAR6_GEOBB          ------VRKRLLAEPM-------------GERRLTNLLHAIETIHQAQVNERLGMEAVIS
Q2LTC8_SYNAS          ------IRSRLLSQPD-------------GERRLTNVLHLAEVLHRESLERNRGMRGLIR
A4SEL9_CHLPM          ------VRRRLLSLAE-------------GERRLTNLLHCIELLHQKEHEEGVGPEALAS
A8ZX09_DESOH          ------VLPRLMAFPD-------------GERRCTNLFHLAELLHRTALEAHYGPERLVR
B8FB94_DESAL          ------LPSAVLTLPE-------------GERRLTNIMHLAEVLHQAEKERKLGVSGLIK
C7LVF7_DESBD          ------VRKRLVSLPD-------------GERRMTNVLHCLELLHSRERESGAAMHALLT
Q7NQR1_CHRVO          ------AAERLLPLPD-------------GERRLTNLGHLAELIQQESEGRQGMAPLLAW
I1XM81_METNJ          ------GLQRLLEQAD-------------GERQLTNFLHLAELIQAESARQNNHIEAVNQ
M1PKI5_DESSD          ------VFETLCALPL-------------AERQISNIQHLVELLQEKESADNLHLFHTLQ
Q6ANK1_DESPS          ------LFANLVQFSQ-------------PERRIANFTHLFEVLQQAETAANLGPRQSLL
G4SWQ2_META2          ------IRLQLSATRL-------------AERRLTNLHHLIELVQQAAVDEHLGIGKTLD
F5ZCK0_ALTNA          ---------TPYGSEV--------------ERALTNYQHLAETLEKAGATHQR-PEQLLD
Q480N9_COLP3          ---------DVPQNNK--------------DRCLTNVLHLFEILQAASVRLSQ-GQELLH
RECB_BORBU            IKIANITKDQKIIEWAKNKINYKGLLIKEGKLENLKTYETTLEIISKIYHKEQNIQSLIS
Q0SMM1_BORAP          IKIANSTNDQKIIKWAENKINYKGLLIKEGKLENLKTYETVLEIISKIYHKEQNIQSLIS
RECB_CHLTR            ---SQTIGETLLQTPL-------------GDIIFQELEALCLYLDKTTENPHHKLLHLIN
RECB_CHLMU            ---SQTIGETLLQTPL-------------GDIIFQELEELCLYLDKTTENPHHKLFHLIN
RECB_CHLPN            ----TTQGNVLFSSPR-------------GDLIFQEMEKLCGYLDTISSYPYHQLLHLKN
C6S650_NEIML          ------IETRLLSRNN--------------GRSLTNYFQLLELLAAEDAQNRN-PAALHK
F4HA58_GALAU          ------IPLRLQQFDF-------------SERYLVDLLHLSELLQQAMNQQQN-EEALLN
D0KVH3_HALNC          ------IPARLLAAPLP---------DRSGERRLTNLLHLADWAQNEQAQLAGLDALLQR
F6DBR3_THICA          ------VFEHLTEFSD-------------AERRIANIQQLAESIQSDIHQHHLTPAKTLE
Q5NF53_FRATT          ---------TQRADSK--------------ERIITNILHLAELIKVAENKYKH-SNQLIK
B2FP80_STRMK          --------ERLLALID-------------GERRLTNYLQLGELLQEASAQALG-MHGLLD
C1ACJ1_GEMAT          ------VVSRYLTYTD-------------GDRRLTNLRHAQELLHGAAEQDALSIEGTLR
F8E603_FLESM          ------IISRLIHSPY-------------GKRKIANINQLSEILHKKESENALQLHELIN
D4H410_DENA2          ------LYKRLAKLPS-------------GERKLTNLIHITELAQQFEANRKAAPQDILR
C7PDT4_CHIPD          ------VRNVLLHAHTE-----------SGERIISNLFQLTELVHQIQSRKNLSMTELVS
                                                         .                        

RECB_MYCTU            WLRRQAKAGAGPP--------EHNRRLDSD----AAAVQIMTVFVAKGLQFPIVYLPFAF
RECB_MYCS2            WLRTQRSERGGES--------ERNRRLDSD----AAAVQIMTVWVSKGLQFPVVYLPFAF
RECB_ECOLI            WLSQHILEPDSNA-------SSQQMRLESD----KHLVQIVTIHKSKGLEYPLVWLPFIT
A0A140NNW5_PROSM      WLTQQIAHPDHQS-------NAQQMRLESD----KHLVQISTIHKSKGLEYKIVWLPFAS
Q8D2T8_WIGBR          WLYYQITFNDVQN-------ENHKIRVFD----EDKAVKIMTIFKSKGLQFPIVFLPFLS
Q057F5_BUCCC          WLRKKILKKNIEK-------NKSKNLIQNKNINDKKFIKIITIYKSKGLEYPIIWIPFFS
RECB_BUCAP            WFEKKILEKNNIS-------ENEYIKNFA----ESKIIRIITIHKSKGLEYPIVWIPFIV
RECB_BUCBP            WLKKNITQDFYLT-------KPKYIKPNYE---KNNYIKIVSIHKSKGLEYPITIIPFAT
Q493D5_BLOPB          WLILKITQPKNKK-------TSDQNLRLGS---DHQLIKISTIHKSKGLEFPLIFLPFIA
Q1LST8_BAUCH          WLSVKITDP-NDK-------DKNQQLWLEN---HHNLVHIITIHKSKGLEFPLVLLPFAS
A1SUW1_PSYIN          WFGEQIKQGNSGE----------SEQKQRLE-SEKDLVQVSTLHKAKGLQYDIVFMPFTG
Q87M84_VIBPA          WLAQSISDAENGL-------GGSDDQIQRLE-SERNLVQIVTIHKSKGLEYDLVFLPFVF
A6W0A9_MARMS          YLRLAIQNPNGNS-------DEQKIRLETD----AELVRIVTIHKSKGLEYPIVYLPFAL
RECB_HAEIN            WFEKQIQGEARQ--------EAQIRLESER-----QLVKIVTIHKSKGLEYDLVWLPFLA
E1W5R9_HAEP3          WFEKQIQDEGRQ--------EAQIRLESER-----QLVKIVTIHKSKGLEYDLVWLPFLG
A6VNJ9_ACTSZ          WFERQIQGKDRQA-------EQQVRLESER-----NLVKIVTIHKSKGLEYDLVWLPFLG
B0BTM4_ACTPJ          WYERQLAKIDSTE-------EHILRLESEE-----ELIKIVTIHGSKGLQYPIVWLPFIG
B7J9Q6_ACIF2          HLHQAIAAGSDQ-------SDAHILRLESD----AGLLRVVTIHAAKGLQYPLVFLPFIA
F9ZQ70_ACICS          HLQREQDSEDNP-------ADSHVLRLESD----AHCIRIRTIHSAKGLQYPLVFLPFIA
D6CML0_THIA3          WLQEQMAGQS---------TEEQVVRLESE----ADLVRVVTIHKSKGLEYPLVFLPFAT
C1D6T6_LARHH          HLERLTEQPD-A-------AQESVLRLESE----DARVRVVTLHKSKGLEYPLVFLPFLA
Q5QUQ8_IDILO          HFAEQVNERHGFGSNSRTQSDEQQLRLESD----DELIKIITIHKSKGLQYPLVFMPFVA
A1TWK0_MARHV          HFTQILRAAD-------EEDEHRTLRLESD----AGLVKVITVHKSKGLEYPLVFLPFGT
D3RS60_ALLVD          FLEEAIADSDAATG---ETAEARQLRLESD----ARLVRVVTIHKSKGLEYPLVFLPFIA
K0NNV1_DESTT          WLAGQIEQSAGGV-------DDEILRLESD----RDLVRVVTIHKSKGLEYPLVFLPFIC
K0CGD3_ALCDB          YLEDAVNDQRGSN-------NDNILRLESD----DDRVKVITIHKSKGLEYPVVYLPFIC
E1SLY0_FERBD          FLAEQREDSTLG--------DEQVLRLESD----AELVKVITIHKSKGLEYPLVFLPFIA
G0A1X0_METMM          HLAETIAADQAG--------EESVIRLESD----ANLIKIVTIHKSKGLEYPLVFLPFIC
Q1QYD3_CHRSD          WWHRALVEGTRQLD-----AEAVSQRLESD----EDLVKVVTIHKAKGLEYPIVLLPFVC
Q3IJ14_PSET1          WFAQKVSQ---------QDGETVQVRLESD----ANLVKIVTMHASKGLEYPLVFMPFAS
Q15V10_PSEA6          WFQAHLAEPD-------NDNEGQQIRLETE----QNLVQIITQHTSKGLEYPLVFIPFAS
A1S6V0_SHEAM          WFEQALLDP--------GSDEAMQLRLESE----QNLVQIVTIHKSKGLEYGLCYIPFLS
E8RCD0_DESPD          WFRQQIDHPDNTAA-------DQLIRLEND----EQLIRIVTIHRAKGLEFPVVFLPFPW
Q2SQD6_HAHCH          WYQGQLEQADGRGD-------EHQLRLESD----EALVKIVTIHSSKGLEYPLVFLPFLG
Q60AZ5_METCA          WLQSRRRDS-AAQE-------DAQLRLESD----QNLVQIVTIHKSKGLEYPVVFCPYLW
Q74CY7_GEOSL          WFGERVSV-PPPGE-------DYQIRLESD----DRAVRIVTVHVSKGLEYPVVFAPFMW
B5EAR6_GEOBB          WLACRITE-EPKKD-------EYEIRLETD----EAAVQLVTIHKSKGLEYPIVFLPFCW
Q2LTC8_SYNAS          WLAEQRDPGKMRSD-------EHQLRLESD----ARAVRIVTIHKSKGLEYPVVFCPFVW
A4SEL9_CHLPM          WFTQNMVEGGQRDE-------EYQLRLETD----EPAVKIMTIHVSKGLQFPVVYCPFLW
A8ZX09_DESOH          WLMRQRTGLQGRNE-------EHQLRLESD----DSAVKIITIHKSKGLEYPVTFCPYLW
B8FB94_DESAL          WLDRQMDLSSPRKD-------EHQLRLESD----AQAVQVVTMHGSKGLEFPVVFCPFMW
C7LVF7_DESBD          WFARRLGTEGTEES---------QLRLDTD----RDAVQIVTIHKSKGLQYPVVFCPFIF
Q7NQR1_CHRVO          FAARVADPPRGED---------AVLRLESD----AALVKIVTVHTSKGLQYPVVFCPFLW
I1XM81_METNJ          WFARQQEASATEDE-------TAQLRLESD----AALVKIMTIHSSKGLEYPIVFCPFNW
M1PKI5_DESSD          YLATEMESAETH--------EHAQLRLESD----EQAVKVVTMHAVKGLEYPVVFCPYLW
Q6ANK1_DESPS          WLRSALTGKQKN--------DAFELRLESD----EEALQIVTMHSSKGLQYPVVFCPDLY
G4SWQ2_META2          WLRARIADTADGKV----SLEEQCMRLESD----DEAVKIVTMHRSKGLEYNIVFCPSLW
F5ZCK0_ALTNA          WLHKQIHQPESDE--------EMTLRLESD----SQLIRLVTQHGSKGLEYPIVFVPFAT
Q480N9_COLP3          WFEQQCHLETNDV--------EAELRLESD----GDLIRLITQHGSKGLEYPYVFIPFAC
RECB_BORBU            TLESLIINEEPEE------IEEKINNINND----NESIELMTIHKSKGLGMNIVFLLNTT
Q0SMM1_BORAP          TLESLIINEEPEE------IEERINNINND----NESIELMTIHKSKGLSINIVFLINTS
RECB_CHLTR            ILITGKYDEELSFS-----------SQSND----ENMIKITTVHSSKGLEYDVVFCSCLN
RECB_CHLMU            ILDTGKYDEELSFS-----------SQSND----DNVLKITTVHSSKGLEYDVVFCSSLN
RECB_CHLPN            FSETGRWEEELAIS-----------SYSED----LETLKITTIHSSKGLEYDIVFCPGIE
C6S650_NEIML          WLRDQISLAGNNGG------DNRSIRLESD----EDLVKIVTMHASKGLQYPLVYCPFAW
F4HA58_GALAU          WFELQLSGNSDNE--------ENRLRLERE----QNVVSIITIHKSKGLEYPLVCLPFIL
D0KVH3_HALNC          YAQAVSDNE-----------AEHELRLEQD----EHLVRIITIHSAKGLQYPVVYLPFLP
F6DBR3_THICA          FVAQQLSNPDTDDA--------HIVRLDRD----DEALQIVTIHASKGLEYDYVFCPDLW
Q5NF53_FRATT          WYRHQLNNTATSEG---------ELRLESD----DNLIKIITIHGSKGLEYSVVFIPFAC
B2FP80_STRMK          WLQGQMASADQDDE-------QQLLRLESD----ARRVQIITLHKSKGLEYPLVFLPFVG
C1ACJ1_GEMAT          WLDAARREPAETRG-------VRELRLESD----DDAVQIVTVHRSKGLEYDLVFCPTLW
F8E603_FLESM          WLSNQRSGNLLKEE-------EYELRMETD----EDALNIMTIHKSKGLQFPVVFAPFLL
D4H410_DENA2          WMKEKISNAEMRDE-------ESELKMDSD----ENAVTIITIHKSKGLEYNIVYTPFLM
C7PDT4_CHIPD          WLKRGIDGMATEGD-------EYEQRMESD----EEAVNIVTIHKSKGLEYKIVMAPYLD
                                                           : : :    ***           

RECB_MYCTU            NRNVRSDD---------ILLYHDDGTRCLYIGGKDGGAQRRTVEGLNRVEAAHDNLRLTY
RECB_MYCS2            NRYVPEPD---------LVLFHDDGQRCLHVGGAD-----PAVARAGRAEAAGDDSRLTY
RECB_ECOLI            NFRVQEQA--------FYHDR-HSFEAVLDLNAA-----PESVDLAEAE-RLAEDLRLLY
A0A140NNW5_PROSM      NFLPQSKA--------LYHDR-ENYGTHLDLDDS-----EENVALADEE-RLAEDLRLLY
Q8D2T8_WIGBR          SFRTKKHV--------LFHSK-KKYKLILDLKST-----LKNRKLSDKE-RLSEDIRLFY
Q057F5_BUCCC          SFQKKKNQ--------IIYCK-KTLKKIVNLKNE-----KKNIISLEKE-RLSEDIRLLY
RECB_BUCAP            DFNVSKSY--------FYHEK-KTLKIFFDNNKS-----SETLKKSDEE-RLAEDLRFLY
RECB_BUCBP            ITFNKT----------VSTVE-KICFNLNNTKIK-----KQKTLKIEKH-KFSEDIRLLY
Q493D5_BLOPB          DFNYVKNP--------FFHDR-KSYKTHLNFNTS-----KSHLTLADEE-RLSEDLRLLY
Q1LST8_BAUCH          NFRSKKHS--------MFHDR-QLYPAGLDLSIA-----PNSMNLTEDDKRLAEDLRLLY
A1SUW1_PSYIN          LYQKPQAC--------LYHDPDQNNALIFDLQNT-----KNNAALAEKE-QLAEDLRLLY
Q87M84_VIBPA          SYREASEA--------KYYDA-ANDRTVLDITGN-----DASMKQADKE-RLAEDLRLIY
A6W0A9_MARMS          TPYRDQDS--------SALYHDAQQQLWIAIDPD-----EAQTELHKEE-LYAAEIRLAY
RECB_HAEIN            APSKDPSK-----KYINIYYSKERDETLWDIE-------NRNLNALCEE-TFAEELRLLY
E1W5R9_HAEP3          NEAKDPTKSGKQKKLFNLYYDSDEEKTLWDMQ-------DQHLDELTEE-VFAEELRLLY
A6VNJ9_ACTSZ          FDDVKNRD------EISIFHDKDAE-ALWDMN-------ARHQDISAKE-KLAEEMRLLY
B0BTM4_ACTPJ          KKNQGAKA-----SNLAIYRDEQGLAHWYFGKPS-----EQVQALMDRE-ELAEDLRLLY
B7J9Q6_ACIF2          TCKAARANP---FTVIHSAE--GQ----PAIHWE-----SGDTTAAERA-RLQEDLRLLY
F9ZQ70_ACICS          ATRKDGNIP---PWQVVTGD--DQ----STLSWQ-----SPSAELMDRE-RLREDLRLLY
D6CML0_THIA3          AFKEAK------------------------------------DGADDRE-RLREDLRLLY
C1D6T6_LARHH          GGRALPDGR---NGIFWHDG--DGRLHVDLTGQD-----ADGLAAMQRE-SAQEDMRLLY
Q5QUQ8_IDILO          YTQAEAYRI---KPPAVYHD--ENGELQVLWSKD-----DDNKQRLSNE-ILAEDLRKMY
A1TWK0_MARHV          AFRAENPKQ---AYVRYHDD---TGKLVTVFDPT-----PEDIERADQE-RLGEDIRKLY
D3RS60_ALLVD          DCRRTQSKD---RPLKTHDA---AHRLQVHLGGD-----DALVAQADRE-RLGEDLRKLY
K0NNV1_DESTT          SFRNLTARN---TPMVKIHD--DKGNFRLEVNPG-----EEELELADKE-RLAEDLRMLY
K0CGD3_ALCDB          SFRAAEKSK---PPLRYHRKGPDDAHLVVSLEPD-----DDIERLADHE-RLAEDMRLLY
E1SLY0_FERBD          GYREASDRG---GVLFYRDA---DGNKSLTFEAD-----DDARAAADRE-RLEEDLRLLY
G0A1X0_METMM          SFREVGGRN---LYYRFHDA---EFNLSIDLHKS-----DDNKAISDKE-RLQEDLRLLY
Q1QYD3_CHRSD          DYRPAEPER---GTGLLEWRD-PRHGRALVHGAD-----DEQLAAAERA-RLDEDVRLLY
Q3IJ14_PSET1          GYRETK------EALYHN-----NGALIYDLSKG-----DDALQKAEQE-RLAEDLRLLY
Q15V10_PSEA6          RCREMK------EAIYHNE----KDGLVIDFLGA-----DENLALADHE-RLAEDIRLLY
A1S6V0_SHEAM          LARDSRGKP---SPLLYHK----DDRLVWDLLQT-----DEGVECYDAE-RLGEDLRLLY
E8RCD0_DESPD          AG-RGLDADQ-----PLSFHERDSLGLTLDLGTGQ----EEHQRWAEQE-QLAEELRLLY
Q2SQD6_HAHCH          FG-RSGKDDY-----LMCHDPEREHRLVLDLSGG-----DRLREQAERE-RLAEDLRLLY
Q60AZ5_METCA          EGNRGARGKQ-----EGIEYHDESGVPVLDFRPEA-KNDPGIKWQRRQE-EDAETLRLIY
Q74CY7_GEOSL          GGLRDDGDL------TLCHEEGYR--LVADFGT---DRRDERQRRARTE-ALAENLRLLY
B5EAR6_GEOBB          AEYAGKDEG------ALFHDEDGR--VVLDIGS---EQMGEHKAQAARE-ALAESLRLLY
Q2LTC8_SYNAS          EGAKDVSKNDA--LTCHGGDENSF--LLCDLGL---PHQALHELRAYRE-GLAERVRLLY
A4SEL9_CHLPM          NGSP--AARDV--AAFHDEGDK----AVLDFGS---EDFEHHLVLSHEE-QLAEDIRLLY
A8ZX09_DESOH          TGTPRTAGGDG--VACHEPREDGSLSMVLDLRSGDAEGVADRRERWYRE-TLSENMRLLY
B8FB94_DESAL          QESE-PRKGTP--LTFHDPDQDER--LTLDLRAE----DSPHREQAKLE-NVAENVRLAY
C7LVF7_DESBD          GRARCPEDR----------ALVHEDGLLLDLGT---EELPRRIGQALSE-AQAERVRLLY
Q7NQR1_CHRVO          NGALERRGAGF--WSYHD---GDEPWLAPEAAAD-----DGIRQAARSE-MLAEKLRLLY
I1XM81_METNJ          TAKSNRTKTDI--VEFHDPQNQHQPSVALAEPLL-----SEAQSVAEQE-QQAESLRLLY
M1PKI5_DESSD          YRPGFLKQEKH-----CISYHDDQNRRVADLGSAH----FQKRRETALSEELAEEARLLY
Q6ANK1_DESPS          GRSARIKNEKN-----VISCHD--GGAVIDFGSEH----FSERRERACREELAEDLRLAY
G4SWQ2_META2          QRSSRLSTGRT-----LIQCHE-QGRIVADLGSED----FERRRAQAIDEELAEDLRVCY
F5ZCK0_ALTNA          GYRDPAKSGK-SYSQIFTYYDEQSQELQLQLGRT-----NTAIERVRKE-GDAEEMRLAY
Q480N9_COLP3          RHKDPLKFG--NKSVSYLEYHDANGKLCLSLDGS-----KEAKKAMSNE-AYAESIRLLY
RECB_BORBU            PIENSNFFSKK----NQFYKFYQDGKIEYDFFKLE------ENKKYARLKILSEEKNIFY
Q0SMM1_BORAP          PIENSNIFSKK----NCFYKFYQNGKIEYDFFKLE------ENKKYARLKILSEEKNIFY
RECB_CHLTR            KAKE-KTPSV--------------------------------------------HMREMY
RECB_CHLMU            KVKE-KSPSV--------------------------------------------HMREMY
RECB_CHLPN            KSKKNKSSSE--------------------------------------------LLREMY
C6S650_NEIML          DAQDTGPSD-----WQILHQSANRTELLAKAQLS------EDEQKQYADEEMAERLRLLY
F4HA58_GALAU          NSASNRKE-------TFGFYHDEQKQLVWDLHHQ--------QTEKVEQEAKAEEMRLLY
D0KVH3_HALNC          LIRPKEANKNS-----TATPWRTSTGRGMSLGEF------PEAIAAEHEAQMTESVRLIY
F6DBR3_THICA          QGKAKANKPTD------PVRVYENGTWLLDLGSDD----YEKNYDKAYQEQQAENLRLAY
Q5NF53_FRATT          YASTKKFETSN----FTKYYDGDLKQTVYKIGKD------DSVKQQADKEVIEELMRLFY
B2FP80_STRMK          IDGGAPNTASH-----CTVHVGGQRQLHWKLDKDE---AWEAANAQREREQRAEDARLLY
C1ACJ1_GEMAT          GVRRVEPDA--------PVLVHEQGRVVYDHGSPR----LAERTAQAERERLAEDCRLVY
F8E603_FLESM          AGSLMHSFK-------PFIYHDDDLEIHLQLESD------EETQSKYALECLSENLRLAY
D4H410_DENA2          FSRGNNKRPD-------YAKYHKEDKFILDVAGT------DEAIEKTQQEEQQEKLRIAY
C7PDT4_CHIPD          FVENKYIAF--------FSFRDPLTGDYVGVEKKR---MTDEQQASYARQAEQENRRLLY
                                                                              .  *

RECB_MYCTU            VALTRAQSQVVAWWAPTFDEVNGG-------------LSRLLRGRRPG------------
RECB_MYCS2            VALTRAQSQVVAWWAPSYDEPNGG-------------LSRLMRGRAPG------------
RECB_ECOLI            VALTRSVWHCSLGVAPLVRRRGDKKGD---TDVHQSALGRLLQKGEPQ------------
A0A140NNW5_PROSM      VALTRAIYHCSVGIAPIIKGNRKKSGE---TDLHLSALGYLIQKGEAG------------
Q8D2T8_WIGBR          VAITRAIYHCSIGICSLSIGNQTKSVM---SHTHRTSIGYIIQKRKKS------------
Q057F5_BUCCC          VAITRSIIHCCIGLAVIK--NKKNEKY---TNFHKNCLGYLIQKGKKK------------
RECB_BUCAP            VALTRSIYHCSIGISYLVKKRKKNKKS---SDIHKSSLGYIIQNGK--------------
RECB_BUCBP            VALTRSIIHCSIGISLAQTITQKKKIQKEKSKFKINVLRYIIQSGK--------------
Q493D5_BLOPB          VAVTRSIYHCSIGIGPIV--RRYKKKSNTNNDLHHSALGYLIQKKTSG------------
Q1LST8_BAUCH          VAVTRSIYHCCIGIAPIY--HGYSKIT-STSDLHLSALGYLIQQGNAG------------
A1SUW1_PSYIN          VGLTRSVYRCYIGIGNYKKGREKNSP------LCKSALGYICLQAGKGL-----------
Q87M84_VIBPA          VALTRAVYACFIGASPLRNGRSTKEPT----GVHRSAIGYLIQNGQE-------------
A6W0A9_MARMS          VALTRSKEACFIGSMEVGKSSNKTRGA--VSDVHLSGVGALIGEGESLE-----------
RECB_HAEIN            VALTRAKYQMAFALPAQFDKK----WNALHYVLSQGEIGKEINLSDSK------------
E1W5R9_HAEP3          VALTRAKYQMAFVLPKAFDKK----WNALLYVLTQGEIGRKLDLPNNW------------
A6VNJ9_ACTSZ          VALTRAKYQVAMALPAEFGGKKESYWNPVWYALSRGEIGDGMKITGKA------------
B0BTM4_ACTPJ          VAVTRAESQLNLILPQRFEDG----WNAVHYLLSNG----EIGLDKSY------------
B7J9Q6_ACIF2          VALTRAEHALWLGLAAPKTA-----GT---PIFAGSAIAHLLGSER--------------
F9ZQ70_ACICS          VALTRAEYALWLGLAAGKTA-----ST---PLWWRSAVGRLLGAD---------------
D6CML0_THIA3          VALTRARHALWVGIAALKVGKG---SV---CMLHRSAIGYLLGGDTPC------------
C1D6T6_LARHH          VALTRARHALWIGLSPLSGT------G---DLLAGSAIGRLLQLDS--------------
Q5QUQ8_IDILO          VAVTRAQYATFIALEAVKEHR-------------NNPLFYLLNGGES-------------
A1TWK0_MARHV          VALTRARFATWVGAAAVDN-------------WYQSGLGYAIAGTP--------------
D3RS60_ALLVD          VGLTRARHANWLGLGAISD-------------LEHSALGYLLGLDGQTVEWSG-------
K0NNV1_DESTT          VALTRSCFACWLGIGVMGKTTKKSGET---TTLHQSGMGYLLSGGR-----MV-------
K0CGD3_ALCDB          VALTRACHSCTLGLAPYAKGRAQQ------NQLPRSAIGRLLFGPQ-----GV-------
E1SLY0_FERBD          VALTRPRHGCFLGLAPVKLSRRGKRGE---PDIHRSALGCLLGAGE-----AL-------
G0A1X0_METMM          VAITRARYACWLGIAPIKIGQSKT------SHLHKSAMGYVLGWQA-----GM-------
Q1QYD3_CHRSD          VALTRAAHACRLGVAHLGRGRG---TS---GCLHETALGRLLGCEA--------------
Q3IJ14_PSET1          VALTRAVHFCAIGMYNIGQG--QSSR----LAIQSSALGHVLFAGLEI-TSSQ-------
Q15V10_PSEA6          VALTRAVHYCFIGLWNNSHP--QRKKE---SQLMQTALGRVLFNQGTQ-VSDA-------
A1S6V0_SHEAM          VALTRPVYGCRLGLANHSRML-KAGIS---SEVYKTALGFLLGIDSKD-CDIN-------
E8RCD0_DESPD          VAVTRAKSCCLFCWGRVNGLERSG-------------LAYLLHRARCPESDA--------
Q2SQD6_HAHCH          VALTRAKQLCVWAWGAVNEFQYAA-------------MAWLLYGGATGSLTD--------
Q60AZ5_METCA          VALTRAVQRCYLFAGVYRTKREASASC-------GESTRSMLNWLACGKDHS--------
Q74CY7_GEOSL          VALTRARCRAYLVWGKFRGAETSA-------------PGWLLHGSRPDGGGDP-------
B5EAR6_GEOBB          VALTRGKHRTYLTWGVFKDAGDSA-------------LHYLLHPGETPVKGQ--------
Q2LTC8_SYNAS          VALTRAKHRCYLVWGHFNGAGGSA-------------PAYLFHDRTSKWDENNPEEAIAA
A4SEL9_CHLPM          VALTRAVYSCSVVVAPIRKTQTAL-------------NHLLQSGTRE-------------
A8ZX09_DESOH          VALTRAKNQCYVSVVPEKADGSPL-------------AALLGTGEAG-------------
B8FB94_DESAL          VALTRAKDRCYMLWGAINKAQTSA-------------PAYLLHGGAVNDGR---------
C7LVF7_DESBD          VALTRAKCRCYAIWGRINEAETSG-------------AAWLFHGHRADENS---------
Q7NQR1_CHRVO          VALTRAQYRQYISWGWVRELKTAA-------------LSWLLHAPGARDLAAL-------
I1XM81_METNJ          VALTRARERCIIVWGNVRDVQKSA-------------LYQLLHGDSS-------------
M1PKI5_DESSD          VAVTRASSRCYVFWADVRGSRFDMPSS-------ESALAWVLSLQECR------------
Q6ANK1_DESPS          VALTRAELRSYTYWADISARGAGVDASL------NSALGHLLFAGDDI------------
G4SWQ2_META2          VALTRAKYRSYLAWADVRSK--DVPNQ--------SALAWLLDFEDCD------------
F5ZCK0_ALTNA          VAVTRAAHRCYMGVLPLDGHEKTALAHALNINDDEGRDWGTMLDAIAR------------
Q480N9_COLP3          VAITRAERRCYVLCCAFDAYHLSPLGKTLQFQEQESIIKPLQVLKASA------------
RECB_BORBU            VGATRAKFALFIIKINSITSK-------------------LLEIAKIF------------
Q0SMM1_BORAP          VGATRAKFALFITKTNSITSK-------------------LLEIAKIF------------
RECB_CHLTR            VACTRAKKFLFIPFSPIEKRSLSTKKL--------SALANYANVTKHH------------
RECB_CHLMU            VACTRAKKFLFIPFSSIEKRLQSNKKV--------SALANYANITQHD------------
RECB_CHLPN            VACTRAKKQLYLPISTQPP---SLQRS--------SALTNYVKLEGTQ------------
C6S650_NEIML          VALTRAEEQLNIYAAYSSDTADNPLAYLIEGLPQDSRETVRRAYACEKD-----------
F4HA58_GALAU          VALTRAKYQLIVGVPATFNAINNKSRK--WDSKKLTALDYLLLGGQQ-------------
D0KVH3_HALNC          VALTRAESACTLALGPVKFGAGKQPNQ------HESGLGHVLRLQGNDE-----------
F6DBR3_THICA          VALTRAKIRNTVVTGDQLSGFDIS------------PLGYLQQQGQ--------------
Q5NF53_FRATT          VAVTRAEHRCYIGVAKYNNSEKSP-------------LARFLGYQKDDD-----------
B2FP80_STRMK          VGLTRAEHALWIAVGDLAGLGRTR------------------------------------
C1ACJ1_GEMAT          VALTRARFRTYVAWGPIGNAPNGSEQS---------ALSWLLFDGAAAPDRDGP------
F8E603_FLESM          VALTRAKYRCYTALAKTRNAGTSAFAYLFSGVNIFSKEWKKEFKDITSMENFV-------
D4H410_DENA2          VALTRAKSVCFTAWGEGTGHDKSA-------------LAYLINGEQSK------------
C7PDT4_CHIPD          VAITRGVYKCFVFRNNYHKKSTLL-----------TFLEALVAAAPSP------------
                      *. **                                                       

RECB_MYCTU            ---------QSQVPDRCTP-RVTDEQAWAVFAQWEAAGGPSVEESVIGARSSLEKPVPVP
RECB_MYCS2            ---------EAIVPDKCSPPKISDEDALERLRAWEAAGGPVIEESVIGAVSPVPPEPAPE
RECB_ECOLI            --------DAAGLRTCIEALCDDDIA--------------WQTAQTGDNQPWQVNDVSTA
A0A140NNW5_PROSM      --------DFSLLNKGLAELAGTAIS--------------VERIEYTESISMSFDQDDNE
Q8D2T8_WIGBR          --------DWNTLKKYLENISFYSK---------------GNI--SVNLKKNLCKKILKT
Q057F5_BUCCC          --------KFKNFKKNLYDLQIPGL---------------IEIKKSNKVKKKFFKKKKRK
RECB_BUCAP            ---------CMNYKELLYELKILN----------------KKLYIEVKYQAMNCKSLTIK
RECB_BUCBP            --------NHISTKKLYTELSILKKN--------------KNIEIISEIPNIIKKNFQIP
Q493D5_BLOPB          --------NAATLKKHLKKLSVYSN----------------GDISFRIISKSQELFSHAS
Q1LST8_BAUCH          --------NAIFLRSQLEKLLVRAE----------------GDISLCEINKSP-LSHTIV
A1SUW1_PSYIN          --------LAGDTEQLNKQLQKMADN--------------SLNISIRPTPLLDETHYQAR
Q87M84_VIBPA          ----------GGINDLHQGLTKQQDE--------------LDCVVVADPPQQLEDKYVAP
A6W0A9_MARMS          --------AGDLYPSLERLCERYQDGQ-------------MQLLDLPDEPQRLPRFKMAA
RECB_HAEIN            --------DTETLLQTFKEKMQDNVEI-------------CTKPNLEALPTLSINTKND-
E1W5R9_HAEP3          --------DTQPVLEKFKQLLPNDVAI-------------ELTDVLQASEPLTLNVSQE-
A6VNJ9_ACTSZ          --------EKQTAVLLSAHLEAENYTL-------------ETIPETVSGDKWLPQTNAEV
B0BTM4_ACTPJ          --------KAEISTSEYLQQKGIDCQA-------------VELDEKIANDKWRPAPFVSE
B7J9Q6_ACIF2          ---------TARDLATLLEDCARLSPEIV---------VETLPDSIPTTLFVRPR--NNA
F9ZQ70_ACICS          ---------EGKTPDQCLETWKRHPACRV---------LAA--DTIPSAPAPRSAEPSEP
D6CML0_THIA3          --------EGAAIPGLLRETFGDSPAVQI---------VDA--AQEAELQRLQAAHPAPA
C1D6T6_LARHH          --------DPGRLAGRLHALAQAGSDIRL---------DDT--PPADPPPRYCDSTPAPV
Q5QUQ8_IDILO          --------LTDELYTEVNERWQQAPHTQL---------TRLE-DDEPLVRALEQEQTTPK
A1TWK0_MARHV          ---------EQPISQALASLAQGRPE------------IRITPLPEAGNTIFTE-TAPEA
D3RS60_ALLVD          --------DDQPETEGSGSEAQGTSNGDLSARLRRLSCVTLIDPPAADPAPYQA-EAEVE
K0NNV1_DESTT          --------QTAELSSILTDFKADCLD------------MTIEPLPVPSLNVFQPGPEPPD
K0CGD3_ALCDB          --------ANDQLLSALGPLSDDA--------------ITVTPAPPSNDEVYQPVNTASR
E1SLY0_FERBD          --------EPATIRAALEALAQHP-G------------VVLATPPEPTGTLLLATETEQA
G0A1X0_METMM          --------AATELTSRLQALKADCAA------------ITITELPESGPDNYRPSATEPA
Q1QYD3_CHRSD          ----------DDQAHDVRERLAAA--------------LSVEACPAPPGHRLRVRHALPA
Q3IJ14_PSET1          --------IWRNHLADFCSEHTGMDYQQFTSED----------LLAQGTLSFNNSADAQQ
Q15V10_PSEA6          --------VITQRLDDL-SQTIDVDYLGFTAQDAERKATEFKQFLLSQDSKESLQTNSNA
A1S6V0_SHEAM          --------VLRQAAERVSSHAHGSEIIGVVDII-----------QHDLTVLESAQHESTE
E8RCD0_DESPD          ----QLC--QELEQLGGAQPLVGLRPFPE--------RFG-------HHRFQSD--IDLP
Q2SQD6_HAHCH          ----WLTSLKNLDDTQLAEPLTRLAAQTD--------FYWSPAPEPVHQRHQPG--EGAG
Q60AZ5_METCA          ----PEQWQDAKTRLDPAHIEAGWRALPD--------AIGVAPMPAIVVPAMAGPSSGLE
Q74CY7_GEOSL          VALLEGTLKKATDQTLLERLDHLATASGG--------GIAVTEDPCPDRLPRFRPAMGEA
B5EAR6_GEOBB          --------VTLSDADIRKRLDTLAASSAG--------RIEVLDLPAADLAPYRAHDKKAP
Q2LTC8_SYNAS          AASFRNFYNELTGPEILRDLDRIADSAHG--------SISIADLPVPTAVTPLPNEHWKG
A4SEL9_CHLPM          ---------TLHEQLNHLIARGDGAVGMR--------TIDQPGASVQPAALHEAFRRENG
A8ZX09_DESOH          ---------ISADALERVAGQSGGSIHVT--------RVGPADLHAAPLSAEDGG--AEA
B8FB94_DESAL          ------VEIRLNYKTLFEDLEELAKGAEN--------AIALTLPPEEIYPAAFAAGGANP
C7LVF7_DESBD          -------TLSWETVDEDMVCADLRVLAND--------DIEVAELPDAEPKQGPPQFTHAP
Q7NQR1_CHRVO          --------EALELDGGTVAAQLRAFLDQR--------GGAARWLEAEGRQALAGGRDPGR
I1XM81_METNJ          -------------EGMREDLQHLAASSAG--------SIAVTQYQPQPPVVYQSAQSRTA
M1PKI5_DESSD          --------GISKQTEGFRQLCVDDSVELQ-----------SVSALIEDEPWHVAAAKPPD
Q6ANK1_DESPS          --------DYEEQQERLKVLARESGALFQ-----------HVSAEPATCSSYGAERRVKS
G4SWQ2_META2          --------FAAQQTILIDYCSRDPKAFEY-----------RLLELPAMPKGRYEKPLDET
F5ZCK0_ALTNA          --------EPDAHATHISADSMAHEYSSF-------------DSTETVVPLNTLTFAGTS
Q480N9_COLP3          --------EHAIGIREVSLDCSIDLYLE--------------KNDEAALHQPKNSPQEFA
RECB_BORBU            --------TIDDIKHDFNIHEFIG--------------------QKRFNKKKYNTNVNTK
Q0SMM1_BORAP          --------TIDGIKHDFNIYEFIS--------------------QKKFNKKKNNTNTNTK
RECB_CHLTR            ----------SVPH-LVETLTSSSPE---------------LFSSSFQPPESSLTPDRER
RECB_CHLMU            ----------NIPH-LVETLTASHPE---------------FFSSGTQPPESNISIFSEP
RECB_CHLPN            ----------SSAYDLAIHLHQEHPD---------------LFSYSL-PKDHGHATTVLN
C6S650_NEIML          --------GIAMLKRNWQRVADNAPSGTN----------FSFTEDAPPPAVYCGNAGQTA
F4HA58_GALAU          --------HAEQKEVSYTTLLTKTLVDNY----------EIQKVTEADDMRFQMKVVTPS
D0KVH3_HALNC          --------FIASFEAALTDLDAQAGVTIE--------------PPPSITHARFVAPVEDS
F6DBR3_THICA          --------MVNQASSEADNKTSQANNLFI----------QRELSLSTEAIIYQPQVVARD
Q5NF53_FRATT          --------WLEKIQSITANPANQSLLINI----------ADMREFSLKNLSSKDKNSDYD
B2FP80_STRMK          ---------LAPLLGDLQALRAHADVHID-------------DSEAPAALPQLAAEVEGD
C1ACJ1_GEMAT          ---AAVADQLRAAPDAWQGMLRSLVDAHPSLMALDMVDTWQPIAPVAAAPQAPPLTGHAR
F8E603_FLESM          --------TEALDNEAFDFIDILPAKPES----------ADINSDFEPSESAEELSGEEK
D4H410_DENA2          -------FDSGRLHSFFRGSNVAIK------------------PLPDTAVQTYKGSEIQP
C7PDT4_CHIPD          -----------DIIRFEEGMPVAPE----------------------QQAGNKVLPLAPV
                                                                                  

RECB_MYCTU            GFEVRHFHRRIDTTWRRTSYSDLVRGSE--AVTVTSEP----------------------
RECB_MYCS2            DLAARKFFRAIDMAWKRTSYSGLLRAAETAGVGVSSEP----------------------
RECB_ECOLI            ELNAKTLQRLPGDNWRVTSYSGLQ-QRGHG------------------------------
A0A140NNW5_PROSM      SLSARDITRFFDYHWRVTSYSGLSYSSGHSGSGNEQAI----------------------
Q8D2T8_WIGBR          NFSFFNIKKN--IISNK-KEDYFFKSISFSYIKKNN------------------------
Q057F5_BUCCC          KKNIFFFNKK--IKQYSWTNTSFSKIIKYNQLKKNI------------------------
RECB_BUCAP            KDDLYILSQP--QFLLK-EIKLYSQITSFTKIKQENKH----------------------
RECB_BUCBP            TLNTNSQSLM--HYQVSRKFNYNYNFTSYSQLKKNIKP----------------------
Q493D5_BLOPB          SVASNQLLCG--KKWKTSPNVIPWSITSFSALQHTDVG----------------------
Q1LST8_BAUCH          SIPVANLELS--ARHLPINLFDRWQITSYTELQKNTAV----------------------
A1SUW1_PSYIN          QSDQPLQAPLVLGKQVERNWWISSYSSLSRFHTQTNTQ----------------------
Q87M84_VIBPA          QEEIHDLSAKELQNPIDRNWRITSYSGLVKQGSHHAEH----------------------
A6W0A9_MARMS          FNKVQDELIEPHAREFTGRVERDWWVGSYSSLVVEDKERHDESV----------------
RECB_HAEIN            DFKASEFTGNIEQDWRITSFTSIEQAHR--RQNYFTESAGKKHA----------------
E1W5R9_HAEP3          NLSAETFRGEIEQDWRVTSFSGIEQTHQ--RKAYLNESAVKKSL----------------
A6VNJ9_ACTSZ          SLSAATFTGKIEQNWGVTSFTALSRMHEQNRRFHGEESAVEFTA----------------
B0BTM4_ACTPJ          TLSAYHFSGQIQQTGLVTSFSALHQQHE--WAMQHHTGYSMPKA----------------
B7J9Q6_ACIF2          HNPPPEYTASFEKHWGVASFSHLVREL---------------------------------
F9ZQ70_ACICS          RRTPPVYTARFERDWSIHSFSRLSQSL---------------------------------
D6CML0_THIA3          LIEPPNYHAQFERNWSIGSFSALVRDL---------------------------------
C1D6T6_LARHH          LFPARRLTRRIARRWRIASYSALLTGP---------------------------------
Q5QUQ8_IDILO          LTPRSMPADRKLERWWVASYSALKYEG---------------------------------
A1TWK0_MARHV          LGPALISNREAKEDWWIASYSTIEYTGMAGTGITFTGEV---------------------
D3RS60_ALLVD          LEGARPAPDWRPRAWWISSYSALSRGAHLADSEDLAAGVWAA------------------
K0NNV1_DESTT          LSQAAVFEGIIPRNWRITSYSGILSGAAMPRQEKHFADYLNEVN----------------
K0CGD3_ALCDB          LRQQITFPRRPRTPWWIASYSAL-------------------------------------
E1SLY0_FERBD          LVPPKPYQRQLQRPWWIASYSALLTGM---------------------------------
G0A1X0_METMM          TDAARLSAAAIGDNWWIASYSALQTDH---------------------------------
Q1QYD3_CHRSD          VASARRFNGGIDDDWWIASYSALIVDA---------------------------------
Q3IJ14_PSET1          TLSINNVTANIERNWRATSFSALSFKKHIDHLAPGR------------------------
Q15V10_PSEA6          MLRAAVLPKPVTRRWRLTSYSAISSQQHHEFVAPGQDEGADKLDVISAYASANTQSKTEP
A1S6V0_SHEAM          PPSPRKPNRIGEESWRVGSYSALIAQGAGHTEHPGD------------------------
E8RCD0_DESPD          MPQPRLFRGRVVPGWTITSYSRLASGSDAALE-TDRDE----------------------
Q2SQD6_HAHCH          QWRARSAQRTVEQNWRLSSYSQLAAGGGGRHS-EEPLD----------------------
Q60AZ5_METCA          RLAAQTPPAWIPPGWSTGSFTSLVRAMEAGGEGRDHDA----------------------
Q74CY7_GEOSL          PLVCRDFRGDIDAGWRVASFTSFASGHREPAELPDRDQTP--------------------
B5EAR6_GEOBB          DLAPLPFTGAISRDWRVASFTSLSSHKHHTAELPDRD-----------------------
Q2LTC8_SYNAS          TLSRRNFTRKLEQSWRFTSFSSLVFGTYVPQEGADRD-----------------------
A4SEL9_CHLPM          EAVRKVFTGRIDRSWRIASFSFFTRGSYAHPELPDRDE----------------------
A8ZX09_DESOH          KLSCRRFPGTIAADWRVASFSAMRRSFSGTEADHVAAD----------------------
B8FB94_DESAL          ALEALEFKARPDLTWSVTSFSALSMDQPGRNE-PGADEAA--------------------
C7LVF7_DESBD          DLRCRNWDRVLGSGFGLASFTGLTRGMEHGARPGLDEV----------------------
Q7NQR1_CHRVO          AYAALPFERRLYAPWKIASFTSLTHDAGSHLAEAPDYD----------------------
I1XM81_METNJ          IYQARRFKGEIHKPWRIGSFSLLSR---GHVSEQPDYD----------------------
M1PKI5_DESSD          LSCRVFSRTSLPGEWLMTSYTALAGSGHLLAGGVPEEK----------------------
Q6ANK1_DESPS          LATRPHRPRLLATDWQMTSYSALASLGDH-APVVQFDR----------------------
G4SWQ2_META2          RLSARSRQRSLRTDWQMSSYTALSALSLQDAPELPEDK----------------------
F5ZCK0_ALTNA          SEDWRLYSFSAISRMTVMSASQAVKDVSQTVPSIPVMQ----------------------
Q480N9_COLP3          NTEVSKFIGKIERDWWLSSFTALSRNIRHAGVSNPDRD----------------------
RECB_BORBU            LIPPKPIIKNMFKKEYTSSFSSLTAQAHHKEFYENYDF----------------------
Q0SMM1_BORAP          LIPPKPIIKNMFKKEYTSSFSSLTAQAHHTTFYENYDF----------------------
RECB_CHLTR            LPQQTYFSLPHLPSRTIHSFSSTVENLHFSEPIQELSP----------------------
RECB_CHLMU            LPEQEFFSLPILSSQPIYSFSSTTESQYFTEPFQEISS----------------------
RECB_CHLPN            LPLLETFALKVTPPKTIFSFSSTKFLLDTHKDSQSIPY----------------------
C6S650_NEIML          EFAASDIPKRGFRFIRHTSFTALSRQTQTPDGGEEDAC----------------------
F4HA58_GALAU          HLSARQFHQNIEKNWRVTSFSALQAKLQALYGEHLSDN----------------------
D0KVH3_HALNC          LPPARTAKRRVDSHWRISSFSGLTHALHESDVAVPETAK---------------------
F6DBR3_THICA          YQACSLQRKTIDTRYRLFSFSGLVKAGHSLASLGAQVSA---------------------
Q5NF53_FRATT          TLKANYISKLENDSWEMLSFSKISKSKVQNTALEKEID----------------------
B2FP80_STRMK          LPAVRALTRRVPHDWWVYSFTQLAHADAGAGSDIEAAAT---------------------
C1ACJ1_GEMAT          QLPSVPSLRERFSTFSIASFTSLTAGVYESLRAEMSEQVAR-------------------
F8E603_FLESM          NLRVREFQNKAPERWRISSFSSILRKMNPHETFTTFMD----------------------
D4H410_DENA2          TGKNRTFTSEITPPWQINSFSRLIHSSSS-------------------------------
C7PDT4_CHIPD          DPDMPVRFVLKEQNWRKMSYTMLAAKAEHNLRTRASQK----------------------
                                                                                  

RECB_MYCTU            ---------------AAGGRADEVEIAVVAAPGSG-------------------------
RECB_MYCS2            ---------------EVTERDDEFDDIPVVAPAEG-------------------------
RECB_ECOLI            -------------------IAQDLMPRLDVDAAGVASV--VEEP----------------
A0A140NNW5_PROSM      ---------------SAEQLATSLAPKIDVEASLDATLPEIDEF----------------
Q8D2T8_WIGBR          ---------------FNKLNYIYEHEKENKEKIYD-------------------------
Q057F5_BUCCC          ---------------INIKKENFINKINYNKKTSQ-------------------------
RECB_BUCAP            ---------------FNNIQYNNIESYFFKEKDKK-------------------------
RECB_BUCBP            ---------------STMYSTLNTKKLFELNVKKKHCFENKI------------------
Q493D5_BLOPB          ---------------VTTYLNLEKQLDISEHIQ-----SQENEI----------------
Q1LST8_BAUCH          ---------------TSIRFNDKAQQQLYSNINVDLLNHQQYIT----------------
A1SUW1_PSYIN          ---------------VASVTPTVMPIDNISNEQTEVSPAILTSP----------------
Q87M84_VIBPA          ---------------DATIEITGFDIDS-SEEQDE---ADLVEP----------------
A6W0A9_MARMS          -------------PGLDEMTRFVDPLLDNMEVPESPLELAQKEP----------------
RECB_HAEIN            -------------VFDDAKDYD----SQNAIEISTALLNEN-------------------
E1W5R9_HAEP3          -------------IFDDAKDYDASISTENIPENLTALAHDN-------------------
A6VNJ9_ACTSZ          -------------IFDDALDYDEQQDVFSPTDEEANALWRNLPA----------------
B0BTM4_ACTPJ          -------------FESAGQDYDQQQVLTLETDNLFALDNEE-TN----------------
B7J9Q6_ACIF2          ----------PADPAAPP---------------TPRRAQAGAP-----------------
F9ZQ70_ACICS          ----------QTSVGPYP---------------SPDRVDPGAQA----------------
D6CML0_THIA3          ----------TPRSTQQPALQAALQDELWATEPSMEQPSPATLQ----------------
C1D6T6_LARHH          ----------AQAGPPAAEDSAAAN----RIDDTAMPDSPVLPI----------------
Q5QUQ8_IDILO          ----------AVTKSVQAPQSPDEMNLLDERDDDEAEVASAAEP----------------
A1TWK0_MARHV          ------------------EDAQTQNLLEESAQDD--TDEAPPVP----------------
D3RS60_ALLVD          --SETSRPVSPADAVETADDETVREELAETRTPE--TEMQTRSL----------------
K0NNV1_DESTT          -EANQANQANQANEEIDSPDSAAQDQLLEGETQI--NLAPRIMA----------------
K0CGD3_ALCDB          ----------RQVEEPLAPADARADQLAEAEPEP--VQKPMMET----------------
E1SLY0_FERBD          ----------SADHSLSGLPERLMEVQDETAPVQ--AQPQELEP----------------
G0A1X0_METMM          ----------AADSHISEPLAEAENYRDDKHSDERDSLPLPAAP----------------
Q1QYD3_CHRSD          -----------RLAPAGEEASMTWDAPATLDVEVSREQDPVPRP----------------
Q3IJ14_PSET1          -----------SDEDHEKDEFAVQ------------------------------------
Q15V10_PSEA6          EAGEYIAPQMAAEATQDNPSVEVHNDSEQMLLDDETALPQANEPNRVLDDIHGISDIDEV
A1S6V0_SHEAM          ----------IARTHEETTAAAIPGAGDESFSVLELPLPDEPEP---------------A
E8RCD0_DESPD          ------------------PAMAPSEE----AASGC-------------------------
Q2SQD6_HAHCH          ------------------EAEATLEVQPRLQPDVS-------------------------
Q60AZ5_METCA          ------------------LSLAPALGPPPAALPEN-------------------------
Q74CY7_GEOSL          ------------------PELPPDAASDTAAPPEG-------------------------
B5EAR6_GEOBB          -------------------EGSPVEERPVHDVEPT-------------------------
Q2LTC8_SYNAS          ------------------------REEEYRPLKSS-------------------------
A4SEL9_CHLPM          -------------------MQRNVPDGAKHPGP---------------------------
A8ZX09_DESOH          -------------------DGGVTPDPELLSAPYT-------------------------
B8FB94_DESAL          ------------------APGPQVEIEDEPEEEAA-------------------------
C7LVF7_DESBD          -------------------------DASGQAADEW-------------------------
Q7NQR1_CHRVO          ------------------RAAAPAPAEPAAD-PVR-------------------------
I1XM81_METNJ          ------------------AELVTIDIEMVIQRSSK-------------------------
M1PKI5_DESSD          -------------------VPVSENESPK-------------------------------
Q6ANK1_DESPS          -------------------DALADAPRIA-------------------------------
G4SWQ2_META2          -------------------ARESASLDAEPALSAV-------------------------
F5ZCK0_ALTNA          -------------------TVRDEEITSDDGFEVNSAEVVSQNQ----------------
Q480N9_COLP3          -------------------TTDIANRQLDTDSEHTDIELLSAEQ----------------
RECB_BORBU            ----------------KNINYEKETELD-YEPGLE-------------------------
Q0SMM1_BORAP          ----------------KNTNYEKETDLDDYDPTLE-------------------------
RECB_CHLTR            ---------------------SLL------------------------------------
RECB_CHLMU            ---------------------SSL------------------------------------
RECB_CHLPN            ---------------------SKLPI----------------------------------
C6S650_NEIML          -------------PSLDAAETSVAAMPSETPTASD-------------------------
F4HA58_GALAU          ---------------AQDYSDNAIEIDDEETAPSVMPLSIYPPH----------------
D0KVH3_HALNC          --------------QEQLRDVLSQTGTVEESLDLPQTHRFDPQS----------------
F6DBR3_THICA          --------------ELEPANEAPTDKAQELSLLVQSDNEQTDHRFD--------------
Q5NF53_FRATT          ----------------------EAEDDKTQASDRK-------------------------
B2FP80_STRMK          ---------------ELPAPAADEPAGPELPLEPALPEPTAVVE----------------
C1ACJ1_GEMAT          ------------------DRDAQPDATPVTTVTND-------------------------
F8E603_FLESM          --------------------DEVFGVSEISEEKRD-------------------------
D4H410_DENA2          -----------------VRDTDQFTMKDETSDSSG-------------------------
C7PDT4_CHIPD          ----------------------------EDPYETF-------------------------
                                                                                  

RECB_MYCTU            --ADLTSPLAALPSGASFGSLVHAVLETADPAAPDL------------------------
RECB_MYCS2            --ADVPSPMAHLPTGAAFGSLVHAVLETADPFAEDL------------------------
RECB_ECOLI            -----TLTPHQFPRGASPGTFLHSLFEDLDFTQPVD------------------------
A0A140NNW5_PROSM      -----TLTPHLFPRGTAPGTFLHELMEEMDFSQEIP------------------------
Q8D2T8_WIGBR          ------FNTSFLPKGKIFGKFIHKIFEKLNFTKNID------------------------
Q057F5_BUCCC          ------INLHSFPLGKEFGIYLHDVFKKIKFFKTKK------------------------
RECB_BUCAP            ------KTIHNFPHGNKAGIFIHYILKTIKFNNTFN------------------------
RECB_BUCBP            ------LTPHTFPSGKIYGTLLHKILKNISFHKSIN------------------------
Q493D5_BLOPB          -----PLTPHTFPKGKVCGSFFHSIFQVLDFRKLVD------------------------
Q1LST8_BAUCH          -----ELTQHTFPCGKLAGKFLHSIFETIDFSKQID------------------------
A1SUW1_PSYIN          -----EKTPFSFPRGAKHGTFLHELFELTNLENMET------------------------
Q87M84_VIBPA          -----ERSIFTFPRGARPGTFLHSLFEEIEFTQPAT------------------------
A6W0A9_MARMS          -----EKNRFTFPKGAKPGTFLHDTLEGKALHDVSA------------------------
RECB_HAEIN            -----ESNILDLPRGKQVGTALHRHFENCYFSDLAN------------------------
E1W5R9_HAEP3          -----DEMVLDFPRGTQIGTLLHRYFEKVPFAQLAE------------------------
A6VNJ9_ACTSZ          -----EYSPLALKGGAKFGVILHRFFEKHDFSQPIE------------------------
B0BTM4_ACTPJ          -----AYSSYQFPHSTKVGNILHSFFEHSDFQQAVD------------------------
B7J9Q6_ACIF2          --------WHRYPQGMNAGTFLHDQLQRLAQNGF---------------AQIGQDQ----
F9ZQ70_ACICS          ----AGQGWHTFPQGPGAGRFLHELLQWLWRDG------------------RWPED----
D6CML0_THIA3          ----PSAARHRFPRGALVGKFVHEQLAWLGENG----------------FALSAQQ----
C1D6T6_LARHH          ----AGRTLAGFWRGPQAGIFLHGLFEWAAQQGFG-------------RTCELAAE----
Q5QUQ8_IDILO          ----SPDSIHHLPKGAGPGTFLHNLLEESANIGFA-------------QIAGDAAE----
A1TWK0_MARHV          ----AVRNHHHFPKGAGPGTFLHELLEWCTA-----------------QGFQRVVD----
D3RS60_ALLVD          ----GTGRLHDFPRGGRYGTFLHGLLEWAANLRAPTRPTGPA-----RPGFAAALE----
K0NNV1_DESTT          ----DARSIHCFPRGPEPGTFLHDILEWAAT-----------------HGFDRVAQ----
K0CGD3_ALCDB          ----AAAGVHAFPRGALPGTLLHDLLEHAAN-----------------QGFRACLD----
E1SLY0_FERBD          ----AEGSIHAFPKGAMPGTFLHDLFEWAAL-----------------QGQARYGAGFAK
G0A1X0_METMM          ----LAHGIHALPRGAGPGVLVHALMEQSAH-----------------LGFSQVQS----
Q1QYD3_CHRSD          ----AVRTLRDFPRGPRPGTFLHGLLEAVDLDRL--------------REPAYRDE----
Q3IJ14_PSET1          --EGEAPSVYSFPKGAKPGSCLHEIFEQIDFTSPIEH----PVNKEH-------------
Q15V10_PSEA6          GAEQEVLDQFTFVKGAQAGSFLHGVLESIDFTNPI-------------------------
A1S6V0_SHEAM          SQDTGALSRFSFPRGANAGSFMHQVLELIRFDAVAE------------------------
E8RCD0_DESPD          -------SPFTFPRGAASGTCLHTLLQRLECN-HPV-----------------------E
Q2SQD6_HAHCH          -------DIFQFPKGAWAGQCFHHILENMPFQAESA-----------------------E
Q60AZ5_METCA          -------DILRFPRGAAAGTCIHHLFEQADFTDPAG-----------------------W
Q74CY7_GEOSL          -------SMFAFPRGPRAGIFLHGLFEQLDFAVAGD-----------------------D
B5EAR6_GEOBB          -------GIFAFPKGAKAGIFLHKIFEDLDFTRVGE-----------------------Q
Q2LTC8_SYNAS          -------DWQVLPPGTQTGNLLHEFLEQLDFKERDE-----------------------M
A4SEL9_CHLPM          -------SIVTFPGGAQAGIFMHSIFETLDFSRPFD-----------------------D
A8ZX09_DESOH          -------GIAQFPAGARAGLFMHEVFEYLDFTNADP-----------------------V
B8FB94_DESAL          -------DIFAFPRGIGPGIMLHDIFENLDFLDHAP-----------------------K
C7LVF7_DESBD          -------SMANFPCGAAAGSCLHRIFERIDF--ADE-----------------------I
Q7NQR1_CHRVO          -------DRFSFPRGAKAGVCLHEIFENIGFGDAE------------------------D
I1XM81_METNJ          -------DRFGFERGRQAGNFLHKCLENIEFDSADI-----------------------T
M1PKI5_DESSD          --------IHPLPLGAGLGNVVHGLLEDYSFSML--------------------------
Q6ANK1_DESPS          --------FAELPKGARFGNAVHDLLEKCAFADLVLH-----------------------
G4SWQ2_META2          ------GMQEALPKGAHTGNVVHDLLEHLDFAYL--------------------------
F5ZCK0_ALTNA          -------IRFTLQKGASAGNLLHDLLELNDFSAPDWN-----------------------
Q480N9_COLP3          -------ICFKLSKGAHTGNLLHDILEQTDFSEPDWQ-----------------------
RECB_BORBU            ---------ETLPKGKDIGNILHAAMEEIIFSTAKDTFDNFK-----------------K
Q0SMM1_BORAP          ---------ETLPKGKDSGNILHAAMEEIIFSTAKDTFDNFK-----------------K
RECB_CHLTR            -----------FPGGSLTGTLIHKLLESLAGNFAAC------------------------
RECB_CHLMU            -----------FPGGSLTGTLIHKLLESLSGNFNAS------------------------
RECB_CHLPN            -------SKQQLPLGEKTGILIHKILESIQFSLLQD------------------------
C6S650_NEIML          -----GISIHNFPKGTQAGLCLHEILEDFKFGQAAAG-----------------------
F4HA58_GALAU          ------FTPFDLPKGAGVGSVLHAFLEKLDFTQPLK------------------------
D0KVH3_HALNC          ----LSARISHLPRGTTFGTLLHSLLERAGEAGFNQS-----------------------
F6DBR3_THICA          -------PNRDIARGAHFGNVVHDLLEQQPFVDLANTAI--------------------G
Q5NF53_FRATT          -----LAFRFTASKGADMGNILHNVLEHTDFSLDEID-----------------------
B2FP80_STRMK          ----DSAPIDPRFMGSRFGNVLHEAMENVDFAAWGDWK----------------------
C1ACJ1_GEMAT          -----PHDFRTFPAGAVPGTVLHAIFEHAHFDGSPAA-----------------------
F8E603_FLESM          ----ADYSMFSLPGGVNTGNALHDLLEHTDLNTVTES-----------------------
D4H410_DENA2          -----RLDIFTFPKGAKAGTCLHECMEETDFENFSAL-----------------------
C7PDT4_CHIPD          -------IFHTLKRGAKTGNLLHFLFENINFSEDSR------------------------
                                    .   *  .*  :                                  

RECB_MYCTU            --AAELEAQVRRHAPWWTVDV----DHAQLAPELARALLPMHDTPLGPAA----------
RECB_MYCS2            --TAELATHIDAHSQHWPVEV----ETA----ELAAALVPMHDTPLGPLA----------
RECB_ECOLI            --PNWVREKLELGGFE-----------SQWEPVLTEWITAVLQAPLN-ET----------
A0A140NNW5_PROSM      --LEWLVEKLQGAGFD-----------TKWADMLQAWLAAIVDAPLA-DD----------
Q8D2T8_WIGBR          --KNIIKENLVKYEFD-----------LSLTNDLAEWIKNIIKKPLN-ED----------
Q057F5_BUCCC          --TKKILKKTNFLSFS-----------NILIKKLYLWINIFLKFPLN-NE----------
RECB_BUCAP            --IDWFYTILKKYEFS-----------EKWAKTLMFWINNILNFKIN-NL----------
RECB_BUCBP            --SNWLLKKLSEYNLD-----------KRWCLILKNWMYSILYKNLDKNY----------
Q493D5_BLOPB          --MKWLYAHMERYNID-----------PIWGFVVREWIYIVLNTPLN-N-----------
Q1LST8_BAUCH          --STQLSLELTKHNID-----------QCWLLVLQQWLHKVITAPLN-NS----------
A1SUW1_PSYIN          --ETLNELLFEQLLLRHYPDP------ELWAPVLTAWIEQILGHDLAAGA----------
Q87M84_VIBPA          --TEENTQIILGLMESEQLD-------EEWLPILQQLIDTVLVTPLD-GK----------
A6W0A9_MARMS          --NPSFKDLLKTSHHKLMANFYERQGFDEWQDVLSEWLPDIVNTELM--A----------
RECB_HAEIN            --TEEIDKLRQSLQLD-----------ETFTESLQNWLQQISHTPLSNEI----------
E1W5R9_HAEP3          --KENIEKLCQDLNLA-----------EEQFVAVQYWFAQILSTPILPND----------
A6VNJ9_ACTSZ          --DAELLALCQGLQLD-----------ETWIQPLKMWLEAVLTTPLSA------------
B0BTM4_ACTPJ          --FEQILTICEQLGLD-----------ENWHEPLQKWFEKVLATPFSET-----------
B7J9Q6_ACIF2          ----FVEQLHKACTQAG---------LGDWVGETAEWLQAIVHSPLA-------------
F9ZQ70_ACICS          ----WREDFLHRCDERG---------YAPWGPVLVHWFAVLRASPLG-------------
D6CML0_THIA3          ----TQDSLLQRCARQGW--------DAPRSADLLEWLSEVLVTPLP-------------
C1D6T6_LARHH          ----RRDLLARRCQRRE---------LAGWIDFFDGWLPWVLTRPLPLNDAS--------
Q5QUQ8_IDILO          ----RAELVQGFCVSPY---------WQEHQNSLEHWLDAYLHNEFPIND-S--------
A1TWK0_MARHV          -NPELLHEQLSRRCGTRG--------WGDWIEPLQHWLLELIRKPLRLDRNG--------
D3RS60_ALLVD          -AAQARRRMLTQRCASRR--------LSDWVEPLDAWLIELLDRTWHLDALAP-------
K0NNV1_DESTT          -DRTVILKRIAMLCARRG--------WDGWAEVLTDWLMEFVTVVLPLPDSP--------
K0CGD3_ALCDB          -APEEMDKRVGQQQEARH--------WQDHHTTVKQWWRQTLTTPLPLQQER--------
E1SLY0_FERBD          IDRAQLAAELSSRCERHG--------YQDHTEVLLAWFEQALALPLELPTGT--------
G0A1X0_METMM          -RPELARQLVDTLFKPPA--------WDGRQEELNQAFQQWLTLPL-LTTSE--------
Q1QYD3_CHRSD          ----LQRLVSTRLHLGGF--------EPEWAPLLLDWLCTALPTPFPGHAGT--------
Q3IJ14_PSET1          ---NLAEVIKRSLEKYHI--------SEHWQDITEQWILDVLACPLNDDSNANINTSGND
Q15V10_PSEA6          ---NLMDVIIEKGTWYGI--------EQKWFAVVDKWLRDVLQSKLTAES----------
A1S6V0_SHEAM          ---TLPEVLPDAMAHFGI--------DTQWQPVLDTWYQDLMGAPLQDEK----------
E8RCD0_DESPD          GQQQLVAEVLEQGGI-----------EARWQATAVRWLDAVLAVELPG------------
Q2SQD6_HAHCH          ILHELTSHSLQQHGF-----------GEEWVACVAEQLWQVVNTPLRQNG-V--------
Q60AZ5_METCA          DDAIGRALALRPQGS-----------ETAAPAMLKSLLADVLATDLGD------------
Q74CY7_GEOSL          TVRDLVRRELERNGH-----------GAQWLDPVSRMVGNVLNVPLGGEG----------
B5EAR6_GEOBB          -LSPLVKEQLDKHGF-----------APDWSQAVRDMVQNVLQAPLGD------------
Q2LTC8_SYNAS          VLQQRASEALSSHGF-----------DSRWKTALLTLIRNVLALSLSGGGNG--------
A4SEL9_CHLPM          STEEGIKNALERSGY-----------HQQWLPVISSMVRTVLSVSLGMEDGS--------
A8ZX09_DESOH          YREELVSRELSRYNF-----------DRQWRGPVCDMVDRVLSTPLPPVSGG--------
B8FB94_DESAL          KVLDLVQDKLEVYGF-----------EDQWAQPVAGMVQNVLFCPLEKER----------
C7LVF7_DESBD          TIPAAVTEALAAYGF-----------DPAWHQTVHDMVKRVLHADLGE------------
Q7NQR1_CHRVO          DIRAAVQRALARHGF-----------GEEWLDAGCDLILGALNAEIAP------------
I1XM81_METNJ          QISQTVSRLLPQFGL-----------DLQWTEVVTDWLQAVLQTPLNTDN----------
M1PKI5_DESSD          AGETDYETECQGQCSRFGV-------MAES-DQLMNLLRDVTRTPLQRPDGK--------
Q6ANK1_DESPS          ADDLHVQGMMEQKCEEYGL-------QLDQ-ELFTQLFVQACSTPLFAGG----------
G4SWQ2_META2          ADMPDIAELRDNTCRRYGL-------QTEHPEAIDRLLQAVVTTPLAEDD----------
F5ZCK0_ALTNA          ---ENGAELAVRFG-----------LEASRTDDLYNWLDEVLATPLGTKQAPSHLT----
Q480N9_COLP3          ---ESLEKPLLAYGELNASNANSI-STSFTSDDLIQWLEQVISAPFISSHHSALTTD---
RECB_BORBU            NNIEIIEKQIQKINSNLN--------TIEIQNSLAKMIYNILTYNIR-------------
Q0SMM1_BORAP          NNIKIIEKQIQKINSNLN--------TIEIQNSLTKMIYNILTYNIR-------------
RECB_CHLTR            --FEEIFNKAQTLLKNTP--------LEGYESIIAEKICTVFSTTLPFSS----------
RECB_CHLMU            --LEEITHKAQTLLKNTI--------LEGFESIISEKIYTAFSTKLPFVS----------
RECB_CHLPN            --TEYLMSTIMRFIKHTH--------LEGFEETILKLLSKTFFSPLTFSS----------
C6S650_NEIML          -QETLIADKLKKYGFE-----------EIWLPAVAEMAEACRKTPLTGAY----------
F4HA58_GALAU          --TPSLQTLCQYLGLD-----------EQWLEPLRIWFSNILQQPLPEMG----------
D0KVH3_HALNC          ANFEFSLNLVRQLASTLTE---------DQQSTLAELVLRILTLSLVTTP----------
F6DBR3_THICA          VDAELRQRLCQKYGLKLN---------ATQEQALDDLMRRIVTTPLSSED----------
Q5NF53_FRATT          --GNLLQEQMDRYKVVAAEDFD---NLKLWLEECLEAHIPYIDTSFSSSNESIQYGLFDI
B2FP80_STRMK          PGREAPEGQADVLRKALHDEGYADVDLDDGVAVLVPLVGHTLTVPLPEGG----------
C1ACJ1_GEMAT          -WQEIADRELLVLGFDEDE-------HELRTASTVRMMQRLLQAPLPGLG----------
F8E603_FLESM          GLNEIVRKTLNLYHID-----------AKFKNAVCENINNLRGKKLGGEK----------
D4H410_DENA2          SVAETVEERLKAFSFD-----------TDFTPAVTQNILTILNKDMHGTC----------
C7PDT4_CHIPD          -WEKWITETVRRFVPGQQ---------DLYGPMLRQLLEHVLQTDITVDG----------
                                                                                  

RECB_MYCTU            ----------AALTLRQIGVRDRLRELDFEMPLAGGDLRGRSPDVSLADVGELLASHLPG
RECB_MYCS2            ----------PGLTLRQIGLRDRLCELDFEFPMAGGDLRG-GRFARLSDVGELLREYLPA
RECB_ECOLI            -----------GVSLSQLSARNKQVEMEFYLPISEPLIASQLDTLIRQFDPL--------
A0A140NNW5_PROSM      -----------GLCLSALAPQDMLDELQFYLPIDNLLQAEDVDRITHRYDPL--------
Q8D2T8_WIGBR          -----------FLSLSRIKQKNKLTELKFYLSINSKIKEKEFNFLIKKYDPI--------
Q057F5_BUCCC          -----------NLSLEKIRKKEHQKETKFIIPIKKKINIKKFNLIIKKFDPI--------
RECB_BUCAP            -----------NITLSSLKKTQYIKELEFFLPIKNTLYCEDLNQIIQSIDLI--------
RECB_BUCBP            -----------NLRLSKLDSKNYIKELKFLLPIKKKLTALKLNNIFQTHQCS--------
Q493D5_BLOPB          -----------NLTLAQIIPENKKTELKFYLSINTYLTSEELDHLCKKYDPV--------
Q1LST8_BAUCH          -----------NLSLSKLDHRNYCTELPFLLPINTTLRAQDMDKLCKNYDPL--------
A1SUW1_PSYIN          -----------DIKLGDLSAQQKKIEMQFFIPMQELQ-ANEVNNLLKKYDPL--------
Q87M84_VIBPA          -----------SLLLNQKAPSQRLVEMEFLLPIEVLS-APALNRVIQRHDPL--------
A6W0A9_MARMS          -----------GMSLGSLVPSACRKEMEFFIPVTGMN-ALQLDRISREHDGV--------
RECB_HAEIN            -----------GIALADLANKDCIKEMPFYLAIREHFDVEAFNHTLKAHHHL--------
E1W5R9_HAEP3          -----------DFTLAQINEKQCLKELAFYLNITSHFDVTGFNRALSTLHHL--------
A6VNJ9_ACTSZ          -----------GFKLTDIRPQHCLKEMQFYLNLDRTFDVKAFNLLLRQYHPL--------
B0BTM4_ACTPJ          -----------EFALKDVPITKRLNEWQFYLRLKNSDGLRKLNQLLKQYSAV--------
B7J9Q6_ACIF2          -----------PLTAALCDLSDTLSEMAFWFPSDALRSDDLDRLCQQHIFPG--------
F9ZQ70_ACICS          -----------SLGTTFAELRGARTEMPFWFPSQHLPTNQLDTLCRRYLLPG--------
D6CML0_THIA3          -----------PLGVALPEIDTLLAEMEFWLPVERACAAEIDALCQRHILPG--------
C1D6T6_LARHH          -----------PVTLAALPPRSARAETEFWLGNPQLATTALDAAVSVAVWPG--------
Q5QUQ8_IDILO          -----------GESVSLSALEQYKAEPEFWFGASEVNAQRLDALVREHILPG--------
A1TWK0_MARHV          ------EDTASLAQLESLRP-----ELEFWFESRNVSIHTLDKLVTRYTLNG--------
D3RS60_ALLVD          -----PDGAVPQLRLADLDPRRYQVELEFWIEASRVDLCALDRVIIRHTLDG--------
K0NNV1_DESTT          ------------MRLSDLVLNNCRAEMEFMFAAHDVDVCVLDSLVTNNILQG--------
K0CGD3_ALCDB          ------------ICLADL--DRPVAEMEFLLPAEQVSVTRLDALIREYLYPG--------
E1SLY0_FERBD          ------------VSLSGL--DQVQAEMEFWLAVDQLDVVELDQWVRASVWPG--------
G0A1X0_METMM          ------------VGLCHLPPSHYQAEMEFLLGVDNPDAAVIDSLVCKHMFAG--------
Q1QYD3_CHRSD          -------------EIRLDGLAAWRPELEFWLPAHQAWSAPLDALVSAFEPLP--------
Q3IJ14_PSET1          TSANSSSVNSNGLSLSQLAPSDCLVEMEFNLPLKSLSAPQLNEILIKHFG----------
Q15V10_PSEA6          ---SNIQQNGEHLSLSALAKNQVLVEMEFYLPLLEVKAQTFNHILNQHIP----------
A1S6V0_SHEAM          ----------GQFALGDLSPAQLLVEMEFYLPVSRLKPGALGDLLALYG-----------
E8RCD0_DESPD          -----------ACSLNQVPVRDRINELGFLFPLEKVDLRRFNRLLDGAG-----------
Q2SQD6_HAHCH          ----------TPFSLSQLDKANMQVEMEFLFPVTLIQQARLARFLADYSG----------
Q60AZ5_METCA          -----------GLRLSEIGRGQRLSELAFRLPAEGLDPVRLNALLRDHG-----------
Q74CY7_GEOSL          ----------NSFRLADLAPGSWLAELEFYFPLRFVRDAQVATILAG-------AGVLPQ
B5EAR6_GEOBB          ----------GEIALAQVGLERRLTEMEFFFPLSHVTSDRLREAAARFTAGHGTAGVAGL
Q2LTC8_SYNAS          ----------QSFRLSDICCGDRISELAFYFPLKRLTRDNLRILFQEIS----REDPGMV
A4SEL9_CHLPM          -----------SFTLSDLKPGEWVTEMEFFFPLRFLTPDHLSSLART-------ALHPA-
A8ZX09_DESOH          ----------EGVRLDSVPMDCRINELEFFFPLRSVSPESLAAAYRQ-------AGAGPG
B8FB94_DESAL          ----------PDFTLSRIPMTARSNEMEFYFPIKKITPKAFEGIFGNGLP----------
C7LVF7_DESBD          -----------GLQLGGIEQKDKLVEMEFLFPLRPVTRETLAAVYRD--------SAGLL
Q7NQR1_CHRVO          -----------GARLRDVADHKRLIELEFTLPVKKLDVAALIAALQKPAHGL--------
I1XM81_METNJ          -----------GLRLCDLLASQRINEMAFYFPVAGLNMAGLKKALQQTAKD---------
M1PKI5_DESSD          ----------KMFALSDLHEKDVLKEMPFYFHLREGSTEGINKLLQFSTVVQPVQ-----
Q6ANK1_DESPS          ------------FSLADLSRSRCLKEMEFYLRLAHINLAEINTILADEPTVQAIS-----
G4SWQ2_META2          ----------PAFLLMNIADELCLKEMPFYLAMQPMNAAHINAILSDSPVYQALN-----
F5ZCK0_ALTNA          --------------LSDLSLPQTLREAEFYFPMNESKWSELKHILFEHRKSVAKQLALDN
Q480N9_COLP3          --------SENAGCLADIAFNRTLRESEFYFPMQGEGTNALANLLTDHRNRAERTDTGNS
RECB_BORBU            -----------AINTRLCDIEELQKEMEFLIKINPEFQKQKYLFDKHFEDLH--------
Q0SMM1_BORAP          -----------AINARLCDIEELQKEMEFLIKINPKFQKQKNLFNKHFEDLH--------
RECB_CHLTR            ----------GSFALRNVHPHNIRAEETFLLQ----------------------------
RECB_CHLMU            ----------GSFALKDVHPYNIRVEETFLLQ----------------------------
RECB_CHLPN            ----------QTFSLSQVLPNKIFRETSFLFL----------------------------
C6S650_NEIML          -------------CLSDIPPECRCPEMGFTLHTEDFGLKRLRDWFARDDIRL--------
F4HA58_GALAU          -------------CLANVASTDKLTEMQFYLKLGNLFNQQQFNQILSQYHPL--------
D0KVH3_HALNC          -------------SRRLADVSRYQIEQEFWLPVAQTQTSSIDALLCAHVHPG--------
F6DBR3_THICA          ----------TDVTLAQLSPNKVLKEMAFYYRLASSSTQQLNDAMPKDVPFLALK-----
Q5NF53_FRATT          K--------DKGFCLKTIPNSKTLKEAEFYFPVKNENLYKTNILEILQEYRELTKLKTYS
B2FP80_STRMK          -------------ALHSLGEGERRAEIDFHFAIEPTTVPALLQVLHAHGVSS--------
C1ACJ1_GEMAT          ------------FALAAVPASRTRREWQFLLPLASADHVMTRQALAAVFAQHGGAH----
F8E603_FLESM          -----------DFQLKNVPYKDTLREMEFYFPSRSIDSRLIRDVFIRNAGEG--------
D4H410_DENA2          --------------LKDLKQGDYIHEMEFQIATKPFRPEPVSEIFRNSGQND--------
C7PDT4_CHIPD          ----------RTFPLAAIIWHKRIPEFEFDFPVSAFFPDMLNGLSDDRTSVV--------
                                               *  *                               

RECB_MYCTU            D-------------DPLSPYADRLGSAGLGDQPLRGYLAGSIDVVLRLPGQRYLVVDYKT
RECB_MYCS2            D-------------DPLAVYAERLSTGILGVQPLRGYLSGSVDAVLRV-GEKFVIVDYKT
RECB_ECOLI            -------------------SAGCP--PL-EFMQVRGMLKGFIDLVFRHE-GRYYLLDYKS
A0A140NNW5_PROSM      -------------------SAACP--PL-NFEKVQGILKGFIDLTFLWK-GKFYLLDYKS
Q8D2T8_WIGBR          -------------------SSKCF--CLKNINNINGILTGSVDLVFLWK-KKYYFLDYKS
Q057F5_BUCCC          -------------------SKKCS--NI-FYKNFFGILNGSIDLIFLWK-KKYYIIEYKS
RECB_BUCAP            -------------------SSISQ--KI-FFNPVIGILKGFIDLVFIFN-KKYYILDYKC
RECB_BUCBP            -------------------SLENK--LC--FHPIQGILSGSIDLVFLWK-TKYFLVDYKS
Q493D5_BLOPB          -------------------SRKSS--SL-TFLDITGMLKGFIDLIFRWN-HRYYLLDYKT
Q1LST8_BAUCH          -------------------SLRCP--TL-DFTPVKGMLTGVIDLVFCWQ-NRYYLLDYKS
A1SUW1_PSYIN          -------------------SARAG--EL-QFRTVQGFLKGFIDLTFEKN-GQYYVLDYKS
Q87M84_VIBPA          -------------------SAKAG--DL-GFQTVQGMLKGFIDLVFEHQ-GKYYVLDWKS
A6W0A9_MARMS          -------------------SKVAP--MI-QDRPLKGMLKGFIDLLFEYQ-GRYYVLDYKS
RECB_HAEIN            -------------------PSE-----SLQFEQIQGMVRGSIDLVFRHN-GKYYLVDYKS
E1W5R9_HAEP3          -------------------PSE-----PLQFDDIQGMVRGTIDLVFSHQ-DKYYLLDYKS
A6VNJ9_ACTSZ          -------------------YQQ-----PYLLDDIRGMLRGFIDLVYRHD-GKYYLLDYKT
B0BTM4_ACTPJ          -------------------SAKL---PDLNLPQLEGYLRGFVDCIVQVN-EKFYLIDYKS
B7J9Q6_ACIF2          -------------------ADRPRLP----QRVIHGMMRGFMDLVFEQG-GRYYVLDYKS
F9ZQ70_ACICS          -------------------RERPILG----EQNLHGLFHGFMDLVFAVD-GRYYVLDYKS
D6CML0_THIA3          -------------------RARPELT----ERTLHGMVMGFADLVFHHA-GRYWVLDYKS
C1D6T6_LARHH          -------------------HARPALL----PQSLQGLFKGFIDLVFEHE-GRFYVLDYKS
Q5QUQ8_IDILO          -------------------HERPALE----PNVLNGMLKGFIDLVFEHN-GKYYVADYKS
A1TWK0_MARHV          -------------------ADRPRAE----ANRFNGMLKGFIDLVFEHK-GQYYVLDYKS
D3RS60_ALLVD          -------------------RERPELA----GSYLNGMLKGFIDLVFEHQ-GRYYLLDWKS
K0NNV1_DESTT          -------------------RVRPLLQ----ENLVNGMLKGFIDLVFCFQ-GRYFVLDYKS
K0CGD3_ALCDB          -------------------QPRPRLE----ADTLNGMLKGFMDLVFEHR-GRYYVLDYKS
E1SLY0_FERBD          -------------------EPRPQLR----PNQVNGMLKGFIDLTFLHE-GRYYVADYKS
G0A1X0_METMM          -------------------RPRPRLL----ANQLNGLLKGFIDLVFTVN-GQYYVLDYKF
Q1QYD3_CHRSD          -------------------EPRPRLA----PRKLNGMLKGFIDLVFEAEDGRWYVLDWKS
Q3IJ14_PSET1          -------------------FEHSKLE----FSHVKGLLKGFIDLIFCHQ-GKYYILDYKS
Q15V10_PSEA6          -------------------QRQHHYQ----FEQLNGMLKGFIDLTLQYQ-GKFYVLDYKS
A1S6V0_SHEAM          --------------------YRSDFG----FDTLNGMLKGFIDLCFSHD-GRFYIADYKS
E8RCD0_DESPD          -----------------------LRPLTTPVTSLQGLMKGFIDLVFRFQ-GRYWIVDYKS
Q2SQD6_HAHCH          ----------------------SEAPVNLNVAANEGLMHGFIDLTFQHE-GRFYIADYKG
Q60AZ5_METCA          -----------------------YAMGKLDFRLLSGYLQGAIDLVFRHR-SRYYLLDWKS
Q74CY7_GEOSL          ------------------GADLGAVARRIAFGEARGMVRGFVDLVFRHS-GRYYLIDWKS
B5EAR6_GEOBB          ------------------PVDLADLFSRLSFAPVQGMLLGFIDLVFEHG-GRYYIVDWKS
Q2LTC8_SYNAS          ------------------PDSWDLEMERLSFSSVRGWLRGFIDLVFVID-GRYYLLDWKS
A4SEL9_CHLPM          ---------------------------QLDFAPVRGMLIGYIDMVFQAG-GRYWLLDWKS
A8ZX09_DESOH          ------------------NDRFSHALKALAFSPARGVMRGFVDLVFFSA-GRYFIVDWKS
B8FB94_DESAL          ----------------------KDRPDRLHFSPVKGFVHGFMDMVFCFD-GRYYIVDWKS
C7LVF7_DESBD          ------------------PPDLPERMGNLRFEPRRGFMTGFMDLVVRSG-RKFYLLDWKS
Q7NQR1_CHRVO          ------------------AEPFRRAAAGLDFASVQGFLKGFVDLVCEAG-GRVYLIDYKS
I1XM81_METNJ          -------------------SIWQKLAADLHFHELTGFMKGFIDLVFEYQ-GRFYVADYKS
M1PKI5_DESSD          ------------------------------EKSLQGYLTGFIDLVCRHR-GKYYVMDYKT
Q6ANK1_DESPS          ------------------------------AKKMRGYMTGFIDLVCQHE-GKYYVVDYKS
G4SWQ2_META2          ------------------------------SKQMCGYLTGFIDLICEYG-GRYFVIDYKT
F5ZCK0_ALTNA          -------SGESATILSISEPITAEPVPSLMMSALEGMMHGFIDLIFTYE-GKYYVADYKS
Q480N9_COLP3          IS-----TGRNSGISKTLNNTLKYPVMLPSYKKLSGMMHGFIDLIFEYQ-GKYYLCDYKS
RECB_BORBU            ------------------------------IKLSDGYLKGIVDLIFKAN-NKIYILDYKT
Q0SMM1_BORAP          ------------------------------IKLSDGYLKGIVDLIFKAN-NKIYILDYKT
RECB_CHLTR            --------------------------------EEGELWQGIVDLFFEHK-DRFFIIDWKT
RECB_CHLMU            --------------------------------ENGELWQGIVDLFFEHN-NRFFIIDWKT
RECB_CHLPN            --------------------------------ENQELWQGVIDLFFEHE-GKYYIIDWKT
C6S650_NEIML          ------------------PEVCRAAAETLDFHTVNGFLNGFADMVCQDPDGNICVIDYKS
F4HA58_GALAU          ----------------------YDQQHPVQIEEIQGVIRGFVDLVVRQN-GKYYLIDYKS
D0KVH3_HALNC          -----------------------QMRPLLTAQYLEGQIKGFMDLVFEAD-GRFYILDYKS
F6DBR3_THICA          ------------------------------PQQLVGYLNGFIDLVFEHN-GRYYLLDYKT
Q5NF53_FRATT          HSYVGGNLPTNYQDLRDTRLREYGNLTNVSNQKIFGMLHGFIDLIFEYE-GKFYVADYKS
B2FP80_STRMK          -----------------------GRRGFGQRRRLEGLMTGMIDLTYVRD-GRWYVLDYKS
C1ACJ1_GEMAT          ------------------GAAYADQLRRLSFNRLHGYLTGFVDLLFEHE-GRWYVVDWKS
F8E603_FLESM          ----------------ETESIIAGSMGEDVSEKIYGFMKGYIDMIFRYN-GRYYIIDWKT
D4H410_DENA2          ---------------------YADAASTLSFDAMQGFMNGFADLIFCQR-GQYYVLDWKS
C7PDT4_CHIPD          ----------------------VRRFHEQGSSELEGIMNGKMDLFFEHE-GRYYILDWKS
                                                             *  *        .  . ::* 

RECB_MYCTU            NHLGD-----TAADYGFERLTEAMLHSDYPLQALLYVVVLHRFLRWRQ-RDYAPARHLGG
RECB_MYCS2            NWLGTGDGTLTAADYGRRRMVEAMLHSDYPLQALLYAVVLHRYLGWRL-SGYDPATHLGG
RECB_ECOLI            NWLGE-----DSSAYTQQAMAAAMQAHRYDLQYQLYTLALHRYLRHRI-ADYDYEHHFGG
A0A140NNW5_PROSM      NYLGD-----DAASYTQSAMAEAMIDHRYDLQYQLYSLALHRYLKQRL-PNYQYDVHFGG
Q8D2T8_WIGBR          NWLGE-----NSSFYNKKNMTLEMIKHRYDIQYQIYSVAIHRYLKYKI-KKYDYNKHFGG
Q057F5_BUCCC          NWLGP-----DSSYYNSKNIKKEIIKYRYDIQYQIYSLVLHCYLKKKL-KNYNYNTHFGG
RECB_BUCAP            NYLGN-----NDNCYSSKNIKKEIIKNRYDIQYQLYTLALHQYLKKKV-KQYHYKTHFGG
RECB_BUCBP            NWIGN-----SNQSYSQQNIKKIIKKHHYNFQLQLYSLVLHRYLKQHI-KNYSFYNHFGG
Q493D5_BLOPB          NWLGD-----NNKDYVGSKIRQEMIKHHYALQYQLYTLALHRFLRNRL-VSYNYEKDFGG
Q1LST8_BAUCH          NRLGE-----DSSAYTKEAIEQAMIQHRYELQYQLYTLALHRYMRHRL-VNYDYQRDFGG
A1SUW1_PSYIN          NHLGD-----CLQDYNQTSMEQALIEHRYDFQYQLYTLALHRLLKSRL-ADYDYETHIGG
Q87M84_VIBPA          NHLGD-----DVTHYHGEALKSAMADHRYDLQYQIYALALHRFLRSRL-ANYQYEQHFGG
A6W0A9_MARMS          NYLGD-----DFADYEPEKLVHAIAEHRYDLQYQLYTLALHRLLKQRL-PNYDYNKHVGG
RECB_HAEIN            NFLGS-----TLADYNQEALKKEMLHSHYDWQYLIYTLALHRYLQSVV-PHYDYARDFGG
E1W5R9_HAEP3          NFLGE-----ILKDYDQAALKKAMLEHHYDWQYLLYVVALHRYLKTRL-PHYDYKRDFGG
A6VNJ9_ACTSZ          NL---------LPAYSEERIRTDIQQHYYDLQYLLYSLALHCFLQRRL-PAYDYETHFGG
B0BTM4_ACTPJ          NFLGY-----LAQDYSRQNLEKTIGQYRYDLQYLLYTLALHRYLRVRLGEQYEYERDFGG
B7J9Q6_ACIF2          NVLGS-----EDADYHAKALRDATLGHRYELQSSLYQLALHRLLRQRMGSRYRPETHLGG
F9ZQ70_ACICS          TRLGE-----NDAAYGDTAIGEDVLEHRYELQAALYLLALHRHLRQRLGRQYRTEQHLGG
D6CML0_THIA3          NVLGT-----DDADYTQQALEAAVLEHRYDVQCALYMLALHRLLQARLRTAYDPQTQLGG
C1D6T6_LARHH          NWLGD-----TPGSYHPDALRDEMLAHRYELQGMLYLLALHRLLRARLGADYDPATRLGG
Q5QUQ8_IDILO          NWLGE-----DDHAYTEQAMREKILHSRYDLQYVIYTLALHRLLKARLGSDYDYDTHVGG
A1TWK0_MARHV          NALGE-----DDAAYTDQAMGQAILDKRYDLQYILYLLALHRLLKARL-PGYDYDQHIGG
D3RS60_ALLVD          NWLGP-----DDSAYSPEAMRAAIAERRYDLQYVLYLLALHRQLKARL-PDYDYDRHLGG
K0NNV1_DESTT          NHLGE-----TQDAYGTEAMAHAMLEHRYDLQYVLYTLALHRLLKARL-NNYDYDRDVGG
K0CGD3_ALCDB          NWLGP-----DDDAYGDEALIKAFLEHRYEVQYALYLLALHRLLRSRLGDDYHPDTHLGG
E1SLY0_FERBD          NYLGA-----DERAYTVDAMREAMLEHRYDLQAVLYTLALHRLLSARL-PDYDFDRHIGG
G0A1X0_METMM          NALGN-----DASAYSPANLEQAMLSKRYDLQAVLYIVALHRLLKTRLGDAYDYDADIGG
Q1QYD3_CHRSD          NHLGD-----APADYRPEALAEAMVEHRYDLQYVLYVLALHRLLTARL-DDYDYDTHMGG
Q3IJ14_PSET1          NYLGS-----NAADYEHDMLEQAMSSHQYHLQYLIYTVALHRLLKQRI-ADYSVETHLGG
Q15V10_PSEA6          NYLGA-----EFADYHGEAMANAMEEHDYYLQAILYTLALHRWLKSKK-SDYAYADDIGG
A1S6V0_SHEAM          NHLGD-----TLDHYHRDAMHTAIQDHHYDLQYLLYTLALHRLLRSRL-AQYDYDKDVGG
E8RCD0_DESPD          NHLGP-----SLAHYTPEALAECMDSHQYHLQALVYTLALHRFLDARI-ADYRYEQHVGG
Q2SQD6_HAHCH          SWLGE-----KRESYAPDNLRNEILAHRYDLQYLIYTLALHRYLQRSL-PAYDYETHFGG
Q60AZ5_METCA          NHLGY-----TREDYGPPALAETMAAEGYHLQYLLYTVALDRYLARRL-PGYAYTSHFGG
Q74CY7_GEOSL          NHLGN-----RAEDYGPERLCREMERSLYPLQYLLYTVALNRFLERRL-PGYRYEEHFGG
B5EAR6_GEOBB          NHLGN-----TPGNYGQAALKKEMEENFYPLQYLLYTVALDNYLRLRI-PGYDYDRHFGG
Q2LTC8_SYNAS          NFLGA-----DPSGYSPEALKSVMVRKHYILQYHLYALALHAYLKQRL-PGYRVERHFGG
A4SEL9_CHLPM          NHLGE-----SLDSYTKERMEAVMGFHHYDLQYLLYTVALHRYLSVRI-PDYRYQTHFGG
A8ZX09_DESOH          NLLGP-----NPESYSQTRLREVMEKEFYLLQAHLYAVALNQYLSARL-PAYDYASDFGG
B8FB94_DESAL          NHLGN-----APEDYGPESLAHAMVHHKYDLQYLLYTLALDLHLAQRI-KDYDYEKHFGG
C7LVF7_DESBD          NWLGP-----TPGHYTPDALHAAMAGSHYFLQYHLYCLALKRHLALRK-PGFDYEKEFGG
Q7NQR1_CHRVO          NHLGD-----ACDDYRDDSLVHAVAREHYYLQYLIYLVALRRYFAARG-ADWD--GRFGG
I1XM81_METNJ          NHLGA-----ELSQYQGEALQNAMLSHGYPLQYLIYSLALHRHLQQRL-PDYDPEQHFGG
M1PKI5_DESSD          NYLGP-----YVSDYGEKQLVAAMYDHNYGLQYWIYTLVLHRYLLTTL-SGYEYERDFGG
Q6ANK1_DESPS          NYLGE-----LQSDYSGDSLVQVMAAHNYGLQYYIYSLVLHQHLQTFV-EGYSYEEHFGG
G4SWQ2_META2          NSL---------PDYRPETLTDAMREHNYGLQYWLYTLVLHRYLGQRL-ADYDYEKHFGG
F5ZCK0_ALTNA          TWLGD-----SVSHYMPQALNANNQHHLYDLQYLIYCLALHRYLKNAI-VDYTPEAHFGG
Q480N9_COLP3          SHLGD-----SFQDYQFDALLDNVEKNYYDLQYLIYSLALHRYLKQTL-VDYDVNQHFGG
RECB_BORBU            NYLGK-----NKEDYNITNLENTIKKEYYDLQYKIYALGIKKILFKNK---KEYNQKFGG
Q0SMM1_BORAP          NYLGK-----DKDDYNITNLENIIKKEYYDLQYKIYALGIKKILFKTK---REYDQKFGG
RECB_CHLTR            SFLGD-----ETSCYSPDQLHLYIQRQGLDRQERLYRKAAKRFLHQFN------SLLQVE
RECB_CHLMU            SFLGD-----EPSLYSPDKLLLYIQRQGLDKQGVLYKRAAKKFLHQFN------SSLQIE
RECB_CHLPN            SFLGE-----TNSDYSKSNLSIYIKQEKLDYQGRIYVKAVRKFLNQFE------IDDDVE
C6S650_NEIML          NHLGA-----DASAYTQQAMDEAVAHHHYYLQALIYAVAAMRYFKLRG-----QPPAAVS
F4HA58_GALAU          NFLGD-----GIEYYQPEKLAKAISSQRYDLQYLIYSLALHRYLKWRD-PNYRYATDFGG
D0KVH3_HALNC          NWLGD-----SPEDYAPEHLVDAMLAARYDLQMVLYLTALHRHLQDRL-PNYDPAVHLGG
F6DBR3_THICA          NYLGS-----NSADYTPDRLFEEMQHHSYGLQFMLYSLALHQYLSHRL-PNYDYEQHFAG
Q5NF53_FRATT          NYLGD-----TLEDYNQQAMQEKNQSSFYDLQYLIYSVALDKYLRQNI-ESYNYEKHFGG
B2FP80_STRMK          NRLPG---------YSQDLLAIAMRHSEYDLQALIYTVALHRWLRFRLGAAYDYERDMGG
C1ACJ1_GEMAT          NQLGA-----DNGAYKSSALQTVMDDHHYTLQYHLYLVAAHRFLAQRV-PDYDYDTHIGG
F8E603_FLESM          NYLGS-----TYEDYREDSLNQAMLKYQYFLQYHIYTVALTLHLNSKM-ENFDYERHFGG
D4H410_DENA2          NHLGM-----TPENYSMERMHAEMLGSHYYMQMHIYTLALHMHLQRYL-KGYSYDKHMGG
C7PDT4_CHIPD          NYLGG-----TPEDYTPTAVSAAMNENNYHLQYLIYTLAAKKYLESRL-HAFDYETQFGG
                      .             *    :           *  :*       :                

RECB_MYCTU            VLYLFVRGMCGAATPVTAGHPAGVFTWNPPTALVVALSDLLDRGRLQS------------
RECB_MYCS2            VLYLFVRGMCGAGTPVVDGHPAGVFSWEPPADLVVALSKLLDAEAP--------------
RECB_ECOLI            VIYLFLRGVDKEH------PQQGIYTTRPNAGLIALMDEMFAGMTLEEA-----------
A0A140NNW5_PROSM      VYYLFLRGIDRVE------SKNGIFIIGQKRHLSTNWTDYFVTHKREVSHDESAV-----
Q8D2T8_WIGBR          IYYLFVRGINNLCR----KTKNGIYFIKPNYSLINKINKHFL------------------
Q057F5_BUCCC          IFYLFLRAFDN-------KNNTGTYFIKPSYLLIKNLENLIYGN----------------
RECB_BUCAP            VFYLFLRGINV---------KDSIFYILPDYLLIKKLTKLILQKK---------------
RECB_BUCBP            TYILFIRSINEIP------SQNGIFYSIPNIEIIKKLEQIF-------------------
Q493D5_BLOPB          VYYLFIRGMDGTP------LSNGIYFFRPLSTFINKLDNLFSKNNLNIIK----------
Q1LST8_BAUCH          IFYLFIRGIELNL------PIESIYTYRPDISLINKLDQMFNGKM---------------
A1SUW1_PSYIN          VFYTFLRGMQGEQ-------EYGVYFVKPSFSLIDGLDKLFSGQKNSAKSTVEPIC----
Q87M84_VIBPA          VYYLFLRGMDGQS-------DHGIFAAKPTLDFLREMDRLIDGQVLETRSTQAGQMELL-
A6W0A9_MARMS          VVYLFLRGMQPEQ-------QTGIFQSRLTLEHVNALDALFSGDSLDKAQNDSSNEGAVQ
RECB_HAEIN            VFYLFLRGMNGEP-------QSGVFYDRPSVELITELDGVF-------------------
E1W5R9_HAEP3          VVYAFLRGMNGSP-------QSGIFFDKPDWQLIQQLEELF-------------------
A6VNJ9_ACTSZ          VIYAYVRGMDGSG-------KTGVFTTRPAARLIRGLEELLHA-----------------
B0BTM4_ACTPJ          VAYLFLRGMNGTQ-------NSGVFFEKPCKQLIEGMDELFG------------------
B7J9Q6_ACIF2          TLFFFLRGLQGP--------ERGVLHLPADLALLDALDGLFGWPQRATQP----------
F9ZQ70_ACICS          AWLWYLRACATA--------GGGLLYLAADPQLLDALDSAVGRS----------------
D6CML0_THIA3          AIDLFLRGVRGP--------QSGCVHIPPDGVLLDALDALFAQREEAA------------
C1D6T6_LARHH          FVCWFLRGTDGP--------GAGIVHLPADLALLDRLDHLFACETPDADA----------
Q5QUQ8_IDILO          AVYLFLRGHRAE--------TGGAFCDRPPRKLIEQLDTLFAGKNLSDKEPV--------
A1TWK0_MARHV          AVYLFLRGVNSA--------SGGAFTDKPPRMLIEQLDALFDGEPVSGEVAA--------
D3RS60_ALLVD          AIYVFLRGGQAA--------SQGLFMDRPDRALIETLDRLFAGD----------------
K0NNV1_DESTT          VVYLFLRGVTAS--------GQGLYADKPSKKLITILDILFQKDELLKKGELLQENELFQ
K0CGD3_ALCDB          AVYVFLRGLGAP--------SAGTVFSAAPTALVEALDRLFLGDAHAK------------
E1SLY0_FERBD          GLYLFLRGMSHEH------PGHGVVTVPVSRQLIEQLDARFRGVAAEPLTHE--------
G0A1X0_METMM          SVYLFLRGVQNE--------SAGRLFSKPPKILIETLDRLFCGESATGMAA---------
Q1QYD3_CHRSD          ACYLFLRGVDGTP-------GQGVFQRRPERRLIEALDAWLEGDTGPVEALRATLEESAA
Q3IJ14_PSET1          VYYTFLRGMPA---------GQGVYFKKLTTEQVTILDGLFSQGAML-------------
Q15V10_PSEA6          AYYTFLRGMHSEK------SGNGVFYLMPAQALIEDLDALFNGEYQVNSEPQLASSTAAK
A1S6V0_SHEAM          CFYLFLRGMSASS------PGTGVYFDKPPKLLIQALDALFEGKEIRL------------
E8RCD0_DESPD          VYYLFLRAMDPAH-----PPGSGVHAFRPDAALIEALDDCCRGGAGR-------------
Q2SQD6_HAHCH          VYYLFLRGMHSQQ-----QPELGVFFDRPSREAVAAFAEILQGEPA--------------
Q60AZ5_METCA          VYYLFVRGVRPAW-----R-GAGVYFQRPAEDCIAALDALIGGRRGA-------------
Q74CY7_GEOSL          VFYLFLRGIDPE------RPALGVYHDLPRPDLVRALTDCLAGREGGAP-----------
B5EAR6_GEOBB          VFYLFLRGVD--------GTGNGVYADRPPRELIAHLAEVLLPESARPSRIDEPSPSPLP
Q2LTC8_SYNAS          IYYLFLRGIDPSR-----GEKTGVYFDRPSEARLTALYDGLIEKNPAERRNADVA-----
A4SEL9_CHLPM          VIYVFLRGVDESS-----GESRGFYRARPSEELVNSLTEILIETGG--------------
A8ZX09_DESOH          VYYVFLRGVDPAA-----GPDYGIYRETPSVELMRALTRCLLETVSAKKGEGR-------
B8FB94_DESAL          IFYIFLRGVDKSL-----GPEYGIFQDRPGLDMIQRLKGALL------------------
C7LVF7_DESBD          VRYVFLRGIDPQ------TPGQGVHANRPDPRFLDALDKALIDTEKR-------------
Q7NQR1_CHRVO          VRYLFLRGMGE--------PGCGVWADMPSTALLDALDALLAGSGTKRGPGSSTQ-----
I1XM81_METNJ          IYYLFLRGMQPE------WSQTGVFYDRLDRTLLEAVDQLMAGVQ---------------
M1PKI5_DESSD          VFYLFARGMRPDC------PGNGLFSDRPSLDVLDKLYDCLGAK----------------
Q6ANK1_DESPS          VMYLFVRGMDPDI------AGSGVFATRPARGLIEALDRLIGGGEE--------------
G4SWQ2_META2          ALYLFVRGMQPEQ------PMSGVYRDRPDLRRIEALSEIFGGTEALAPKL---------
F5ZCK0_ALTNA          VYYLYLRGMHPSNTN-----GEGVFFTPIDSATLQALDRLFSGSEIAPEIADEGIDVIDD
Q480N9_COLP3          VYYLYLRGMTTEPEHK----GAGVYYRKITEQEINNLDALFSNKESNEKCNEEA------
RECB_BORBU            IIYLFTRAFEDNIECLKSKFENGIYFNLPKFNDVDLDKIILELGIKRHL-----------
Q0SMM1_BORAP          IIYLFTRAFKDNIDCLQSKFENGIYFDLPKFNDVNLDEIILELSIKRHL-----------
RECB_CHLTR            MAFVFIRGLDDKG--------NGFLQPGR-------------------------------
RECB_CHLMU            MAFVFIRGIDDKG--------NGFLQPSP-------------------------------
RECB_CHLPN            LGVIFIRGIDTQG--------NGFFALNSSEDIPNFNPKAIQKCQAYH------------
C6S650_NEIML          VRYLFLRGFDGKG--------GGVWRWDIDAAALEQIK----------------------
F4HA58_GALAU          VFYLFLRGMAVQN-----NAQTGVYFTKPSVELIEKLDQLWGE-----------------
D0KVH3_HALNC          ALYLFVRGIDSPG--------QGVYFSPANPTVIAAMDALLMDDVSPNGAHPVRMEAWA-
F6DBR3_THICA          VVYGFVRGMNGKN------ADTGIYHYRPNLADIERLASCLNSVTANQQGAA--------
Q5NF53_FRATT          VYYFYLRGMKDGY---------GVYRARPNLEIINKLASLFNGDDNV-------------
B2FP80_STRMK          IRYLFCRGLDGTG--------NGVHVDRFPLALVDALDALFAGGEQAQAELAARARGASA
C1ACJ1_GEMAT          AAYAFLRGFADASV-----DGTGWFVHRPPAALIRALSAALGA-----------------
F8E603_FLESM          VYYLFLRGIDAGEN-----SRNGIFFHKPAQSVIAGLIESFQIEPVFSNGGTSGNP----
D4H410_DENA2          GIYVFMRGIHEKG-------NEGIYFHRPEKDTICRLEELVKR-----------------
C7PDT4_CHIPD          VIYCFVRGIRKGQ-------STGIFTTKPPLSKILQLESSLSPNVNRKQPPQQKLFDIY-
                          : *.              .                                     

RECB_MYCTU            -------------------------------------
RECB_MYCS2            -------------------------------------
RECB_ECOLI            -------------------------------------
A0A140NNW5_PROSM      -------------------------------------
Q8D2T8_WIGBR          -------------------------------------
Q057F5_BUCCC          -------------------------------------
RECB_BUCAP            -------------------------------------
RECB_BUCBP            -------------------------------------
Q493D5_BLOPB          -------------------------------------
Q1LST8_BAUCH          -------------------------------------
A1SUW1_PSYIN          -------------------------------------
Q87M84_VIBPA          -------------------------------------
A6W0A9_MARMS          YGLF---------------------------------
RECB_HAEIN            -------------------------------------
E1W5R9_HAEP3          -------------------------------------
A6VNJ9_ACTSZ          -------------------------------------
B0BTM4_ACTPJ          -------------------------------------
B7J9Q6_ACIF2          -------------------------------------
F9ZQ70_ACICS          -------------------------------------
D6CML0_THIA3          -------------------------------------
C1D6T6_LARHH          -------------------------------------
Q5QUQ8_IDILO          -------------------------------------
A1TWK0_MARHV          -------------------------------------
D3RS60_ALLVD          -------------------------------------
K0NNV1_DESTT          EGDSHDTDC----------------------------
K0CGD3_ALCDB          -------------------------------------
E1SLY0_FERBD          -------------------------------------
G0A1X0_METMM          -------------------------------------
Q1QYD3_CHRSD          PRAQRHDIEAAMTQASSATRSSP--------------
Q3IJ14_PSET1          -------------------------------------
Q15V10_PSEA6          NSKDSGDDAPAAQGQLDLW------------------
A1S6V0_SHEAM          -------------------------------------
E8RCD0_DESPD          -------------------------------------
Q2SQD6_HAHCH          -------------------------------------
Q60AZ5_METCA          -------------------------------------
Q74CY7_GEOSL          -------------------------------------
B5EAR6_GEOBB          SPAGRGGVGKKPRKTEIEGQLSLDLFD----------
Q2LTC8_SYNAS          -------------------------------------
A4SEL9_CHLPM          -------------------------------------
A8ZX09_DESOH          -------------------------------------
B8FB94_DESAL          -------------------------------------
C7LVF7_DESBD          -------------------------------------
Q7NQR1_CHRVO          -------------------------------------
I1XM81_METNJ          -------------------------------------
M1PKI5_DESSD          -------------------------------------
Q6ANK1_DESPS          -------------------------------------
G4SWQ2_META2          -------------------------------------
F5ZCK0_ALTNA          KEEEKEPSGKTVSSEALSNKQGLNDPSADAVQGELDL
Q480N9_COLP3          -------------------------------------
RECB_BORBU            -------------------------------------
Q0SMM1_BORAP          -------------------------------------
RECB_CHLTR            -------------------------------------
RECB_CHLMU            -------------------------------------
RECB_CHLPN            -------------------------------------
C6S650_NEIML          -------------------------------------
F4HA58_GALAU          -------------------------------------
D0KVH3_HALNC          -------------------------------------
F6DBR3_THICA          -------------------------------------
Q5NF53_FRATT          -------------------------------------
B2FP80_STRMK          -------------------------------------
C1ACJ1_GEMAT          -------------------------------------
F8E603_FLESM          -------------------------------------
D4H410_DENA2          -------------------------------------
C7PDT4_CHIPD          -------------------------------------