CLUSTAL format seed alignment for MF_01486

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RECC_ECOLI        ------------------------------------MLRVYHSNRLDVLEALMEFIVERE
F7XY37_MOREP      ------------------------------------MLTVYHSNQLDMLKTITAALITGR
Q1LST9_BAUCH      ------------------------------------MFTIYQSNKLDVITSILISLISER
Q5E7C0_ALIF1      ------------------------------------MFTVYHSNQLDVLKSLVVELIRLN
C4L7B2_TOLAT      ------------------------------------MFRVYHSNQLDVLKSLLAHLIQLS
A8ZX08_DESOH      -------------------------------------MYFFTSNRMEMLSRAFCEALTAY
Q2LTC9_SYNAS      ----------------------------------MKGLNIIASNRMEVLAEKLADVLAG-
Q3B473_PELLD      -----------------------------------MAFNIHTSNRTEVLAADLASYFAAS
B5EAR7_GEOBB      -----------------------------------MPLKIYTSNRMERLVDELERVVRAP
B8FB93_DESAL      -----------------------MPNNRFDSVFGEECLRVYSSNSLQTLARQLADLLVKD
Q7NQR0_CHRVO      ------------------------------------MLFLYQSNRLEQLGELFCGMTQAM
I1YH96_METFJ      ------------------------------------MLNIVYSNNTQNLASHLAQQVLKA
E8RCD1_DESPD      ------------------------------------MFHLHQSNRLETLFAQLCTLMRE-
G4SZ17_META2      ------------------------------------MFILHSSNKTENLLEHLAAVIETR
M1P5P7_DESSD      ------------------------------------MFYLHLSNRTENLIHQLAEVLRLD
B0VLS2_ACIBS      -----------------------------------MGIHVIQSQRIDVLLQGVLASTSQP
Q6FF17_ACIAD      -----------------------------------MAIHVIQSQRIDVLLQGVWQSVHQP
A6W6P1_KINRD      ------------------------------------MLHVHRSESANTLVTALAGLLRDP
H6N573_GORPV      ------------------------------------MLRLHRAERTDVLADALADVLATG
I0HVQ4_RUBGI      ------------------------------------MLSLHFSNRFEALAALLGARLAVP
Q60AZ6_METCA      ---------------------------------MPSPLNIFFSNRFEILTQRLFDDLAQG
E1TB32_BURSG      ------------------------------------MLQIFYSNRYETLVGALLDDLGQA
E1SLX9_FERBD      -----------------------MSACLPPSEPLNNGLMMIHGNRMETLRDLVVEWIKSH
D0KY94_HALNC      -----------------------MPPTTPITDEITPGFLLIQGNRLELLQQVLIDWLKRH
C1D6T7_LARHH      -----------------------MTALT--------GFTILHANRAEMLRDVILAWLARD
I3YAG8_THIV6      ----------------------MDARKVAGAGDWPTGFMLIQGNRLEALRGLMVAWMRRH
C0QI08_DESAH      ----------------------MGTQPHDSRPGLLPGLSIIHANHLEDLRDVAVHWVRTH
Q5QUQ7_IDILO      ------------------------------MSELTPGFIVAHGHRLEDLTDVAVTFTQNY
Q1QYD4_CHRSD      ------------------------------------MFSVIHANHLEDLGTLALDVIRRH
B7J9Q5_ACIF2      ----------------------------MNHPEIEPGFIVLHGDRLEWLSDAVLEWLRAH
F9ZQ71_ACICS      -----------------------------MSGLPRPGVVVLHGDRLEDLLTAIRQWLGAN
B1XZ24_LEPCP      -------------------------MRDDSGSGPTPGLLILHGNRLELLLETVLQWLAAH
F4HF17_GALAU      ------------------------------------MFTVYYANQLENQKHLLVRLLEVQ
B8F7F2_HAEPS      ------------------------------------MFRVYYSNQITEQKNLLTAILAKD
A6VQ90_ACTSZ      ---------------------------------MMSDFFIYHSNDLDVQAGILISLLQ-Q
C7LVF8_DESBD      ----------------------------------MEGFLLHASNRLENLAELLAEVLKTP
F2JZ46_MARM1      ------------------------------------MFQLYTGNKLEDLSVLLAKILSVS
A1S6U9_SHEAM      ------------------------------------MFTLVQSNHMERLAKRLADELNQA
D6Z1F6_DESAT      -------------------------------MPVERRLILYRSNRLEALLDCLAASLQDD
E6WXK8_PSEUU      --------------------------MPEPRTDASPDFRLYHSNSLEILAGILAQVLRQP
RECC_BUCAI        ------------------------------------MFTIYKSNSLNTLLLKAYHIIEEK
RECC_BUCBP        ------------------------------------MFTLYKSLKFNLFVKSAFKVILNE
Q8D2T9_WIGBR      ------------------------------------MIYIYQSNQIDLIQKILSKILKNF
F8E602_FLESM      -----------------------------------MSLNVYYGVQLENVFDLFAYSLEKN
Q480N8_COLP3      ------------------------------------MIHLYPANKMENLLLLLNKISQLS
G4QGN0_GLANF      ------------------------------------------------------------
D7GDA0_PROFC      ------------------------------MALLDPSPAAIRMVRCPDWASVCAGVDAYL
C7PDT3_CHIPD      -----------------------------------MALYLRVSNSLENLSMGLAQTLKAS
J9ZF24_LEPFM      ------------------------------------MLVLHVSNRMERLTDQLFSVIRDD
A5GU99_SYNR3      ------------------------------------MLRLISSNSIEDLATALASELDRH
F8L520_SIMNZ      -----------------------------------MKPTLHVSNDFRALRKQLAHQLFLT
A9BB00_PROM4      ------------------------------------MLTIYRSNRAEWLANVLAEQLRAN
Q6MFB7_PARUW      MFLLKFYVGFNKTVCKEGCKLLTLTVDTPKSEPFVSDLEVFFSNQLSILYEQLKNNLFGF
                                                                              

RECC_ECOLI        RLDD--PFEPEMILVQSTGMAQWLQMTLSQKFG------------IAANIDFPLPASFIW
F7XY37_MOREP      PLRD--PFQPEVIIVQSNGIAQWIQLELAANFG------------IAANLEFPRPASFIW
Q1LST9_BAUCH      KLRE--TLQPEIILVQNHNITQWLQVELAMSLG------------IAANIRFSTPTIFIY
Q5E7C0_ALIF1      PLDN--PFEQEQILVQSPGMSQWLKIELAKELG------------IAANLTFPLPATFIW
C4L7B2_TOLAT      PLQP--ALAAETILVQSPGMAQWLKQALAQDLG------------VAANITFPLPSSFIW
A8ZX08_DESOH      PLDN--PFARETIVVQSMGMKRWLSMEMARHTG------------ICAHNRFLFPNAFLN
Q2LTC9_SYNAS      PLSS--PLTPEIIVVQSRGMERWVSMQLAAFHG------------ICANVRFPFPRRMIQ
Q3B473_PELLD      PPA--SPFSREVVVVQSRGMQRWLSMELARRLG------------VWAGARYPFPNAVVS
B5EAR7_GEOBB      RPAPCTPFDKELVVVQNKGMQRWLSMELATRIG------------VWANGDFLFPNKFVE
B8FB93_DESAL      PLP---PLEQEIVLTQNPVMGRWLYLELAKING------------ACANLRVTLPNAYMH
Q7NQR0_CHRVO      PLAD--PFAAETVIVQSRGMGRWITLDVARKAG------------IAANIDFALPAAFAW
I1YH96_METFJ      PLS---PFEQETILVQSNKLSRWLTLFLAQQHG------------IAANLVFPFPSAYIW
E8RCD1_DESPD      PPAD--PLTPEIIAVHNQGMAQWVHRQLALATG------------IAANLRFPLPGRLVW
G4SZ17_META2      PLSS--PFVKEVFLIQSQGMERWLSQQLASRLG------------VWGNYEFLFPGRFFS
M1P5P7_DESSD      DDRD--PFSPEYFLIQSQGMERMLSQNLAQRFV------------SWCNYEYMLPTRFFA
B0VLS2_ACIBS      STHPLQVLKAQHFIVPSPAIEQWLIQKLAEQQG-----------MSANYQFHQRVRGFQW
Q6FF17_ACIAD      TRQPFDVLATQHFIVPSPAVEQWLTEKLSELQG-----------ITANYLFHQRIRGFQW
A6W6P1_KINRD      APGA-DPFAPDVLAVGARGTERWIAQRLSHHLGAGDPAAGGGDDGICARVDTSSPAHLLD
H6N573_GORPV      LP---DPMASEIVAVPARGIERWLSQRLAVRLGSSPELG----DGIAANIGFCSPGELTD
I0HVQ4_RUBGI      RE---DLFVADEIVVPSAALRRRLTLEFAQVEG------------VCAHLRFDYLAQWLW
Q60AZ6_METCA      PA---DPFVAEQVIVPSLAVRRRLELDHADRFG------------VCANVEFSYLAHWLW
E1TB32_BURSG      PS---DPWTAQPVIVPSAAVRRRLELDIAARQG------------ICANVSFGYLAQWLW
E1SLX9_FERBD      PLA---PLENEVFLVQSNGMAQWLKLALA----------ADSGIGIAAALQMQLPSRFIW
D0KY94_HALNC      PLA---PLENETFLVQSNGMAQWLRLGLARP-RSA----QDGGLGIATGIEMILPARLQW
C1D6T7_LARHH      PLSS--PLDDEVFLVQSQGMAQWLKHALA-----------ESPAGIAAALDFQLPQGFLW
I3YAG8_THIV6      PLH---PLENEVVLVQSNGIAQWLKLALAANPEDD----LTGGCGIAAALEVTLPGRFIW
C0QI08_DESAH      PLG---VLETEQFIVQSKGMAQWLKLAVAAD----------DGCGISAGIETQLPGTWVW
Q5QUQ7_IDILO      PLA---PLEQETVLVQSNGIAQWLKINLA------------QASGIAAMIDVTLPARFQW
Q1QYD4_CHRSD      RQP---PLVPETFLVQSNGMAQWLRLTLA------------EADGIAASVDFPLPSSFVW
B7J9Q5_ACIF2      PLR---PLEEEIFLVQSNGIAEWLQWTLAAH------------EGICAAVRVALPGRFLW
F9ZQ71_ACICS      PLP---PLVEDTFLVQSNAVGEWLQWQLAEG------------DGICAGIRVSLPARFLW
B1XZ24_LEPCP      PLA---PLEEEVLLVQSNGIAEWLKMSLAQR------------VGVCAATRVELPARFLW
F4HF17_GALAU      PLQD--PFAENVILVQSPGMAQWLQLQLAEHFS------------IAANFAFPMPSSFIW
B8F7F2_HAEPS      PNPD--PFSQEIVLVQSLGMAQWLQMQIAQEIG------------VAGNMQFPYPTSFLW
A6VQ90_ACTSZ      RSTD--PFQSETILVQSPGMAQWLQLKIAEADG------------IAANLRFPMPASFIW
C7LVF8_DESBD      LD----PMEPETILVQSGGMQRWVSMQLARRHG------------VCANTRFPFPVGFAY
F2JZ46_MARM1      PPKN--VFQSECILVQTPGMAQWLNIRLAELMT------------VSAGVDFPLPSSFVW
A1S6U9_SHEAM      SGNV---LATEQILVQSPGMATWLRLEIAAHNG------------IAAALSFPLPSNFIW
D6Z1F6_DESAT      PPP---PLSSECVVVQSRGMATWLGQSLAQRFG------------IWAHPDFPHPRRFIE
E6WXK8_PSEUU      APGQ-SLLAPEVVLIPQVAMRRWLQATLAAEHG------------VAANIEFLTPGEFVG
RECC_BUCAI        PFSN--IFEKEIFIYDNKVLFQYLNIFIAEKKG------------ISANFKFYHPNDFIW
RECC_BUCBP        PLLN--PLTKEIFIVNNKETEQWIKIFIAKKYK------------VCTNIKFFKLKHFIL
Q8D2T9_WIGBR      PINN--PMKKEIIITSSSNISEWLKLNITLNIN------------ILANVEFISLNSFIW
F8E602_FLESM      RSVD--PLESEFVVVQTEGMKKWLSLMLAQRFS------------VCSNIKFFTPNGIIN
Q480N8_COLP3      PLGV---FNQEVIVVQNAGMQHWLNLAIAQERG------------ISMNMRYALPAQFLW
G4QGN0_GLANF      -------------------MQHWLNLQLAEHAG------------IAMNIEYPMPTRFVW
D7GDA0_PROFC      DSFVHDPFVLPTVVVPGAAHRRALSQHLASRPTDP-------QHKIRAGIDMVTLGQLRR
C7PDT3_CHIPD      NSQ---VFEQHLIVTQTEGMNNWLKLQLAEYLG------------IAANCRFLKPNDLIH
J9ZF24_LEPFM      PPP---PWSPVTILPQNPTIGRWLTYRLADVQG------------VAMNIATPLPGAWIR
A5GU99_SYNR3      KPAN--PLTPQRVLISTNAMSRWLALALSERIG------------ICAGIEFDFAGRHLR
F8L520_SIMNZ      PSA---PFEQKVVLLPDLKQKNELLLHFLKDVD------------VVMGVDFMELGAGLQ
A9BB00_PROM4      PPG---LSENVEIVVNTWPTGRWLGEEIAKING------------ISALVRFPFPAAQLK
Q6MFB7_PARUW      KQT---PFKKRLVIVYGPAMQTWLTLKMAQDPD----------LGIAAGIEFLYLNQAFE
                                         :                                    

RECC_ECOLI        DMFVRVLPEIP--KESA---FNKQSMSWKLMTLLPQLLE---------------------
F7XY37_MOREP      QMFTRILPNIP--EESA---LAKSNITWRLMALLPRLCQ---------------------
Q1LST9_BAUCH      KLLSSILPEMN--LEMF---FSRSLISWKIRLILPHFYD---------------------
Q5E7C0_ALIF1      DLFTQVLDDVP--KRSA---FHKEAMTWKIVTLLPELLK---------------------
C4L7B2_TOLAT      QMFHQVLPEVP--QENP---YTKPAMLWRLMQLLPQCMD---------------------
A8ZX08_DESOH      QMLQTAFADAVPVSPD----VGVEAMTWAVFPVLADVF----------------------
Q2LTC9_SYNAS      DIFHAVLP-GWEAEQD----FNPELAAWRIMSLLTVAS----------------------
Q3B473_PELLD      ELFRHVFPSKE-DEAGR---YDPECTTWSIMRLLPSML----------------------
B5EAR7_GEOBB      EVFAYVLPESP-ADAPL---FAPEVMTWRILELLQQSA----------------------
B8FB93_DESAL      ELFASVIPPMENEEQSP---FSPWAMTWRIMDALARFM----------------------
Q7NQR0_CHRVO      RLMQKVMPDLP--RKSA---FVPEVLAWRLLALLPSLS----------------------
I1YH96_METFJ      SVFRQLWPDIP--LDSP---YSKSALVWRIYALLPRYS----------------------
E8RCD1_DESPD      ELLHRLTDEKP--EEDL---FRPSVLRWRVAALLPSLD----------------------
G4SZ17_META2      TLAQRIDSRLN---DEA---FNRHVLHWRFEALLREL-----------------------
M1P5P7_DESSD      LMADRLGVESG---PEE---YARDRICWHLENIFRDLSP---------------------
B0VLS2_ACIBS      YAYQQVLTVHKEQVRKA--NIPRLIFKWRVHQALQEFIQLD--VMSIDSSHPLHSIVQRI
Q6FF17_ACIAD      YAYQQVLSEHKDDVRKA--NIPRLILKWRVYQALYDFIQPD--QILITQDHPAYSIIARI
A6W6P1_KINRD      GVLAAALERTRPGTGDAVERWAPSSLTWDVLEVLDEIAPADGGPAPDGRPEFALLRHHLR
H6N573_GORPV      AVIDALDTDAQTATA-----WRADALVWPVLAVLDDLVDDP--QMAMLARHIGSASTATA
I0HVQ4_RUBGI      RQIAAVVPGIDAERSP----FAPEVLAWRVWRALGDRD----------------------
Q60AZ6_METCA      VQIGQVIEVGAS--SP----FAPATLTWRVFRMLGEEA----------------------
E1TB32_BURSG      AQIGGVIEVPRH--SP----FAPDRLVWRCYRLLGSADPAL-------------------
E1SLX9_FERBD      QLYRQVLGADAVPKDSP---FDKPLLRWRLLRLL----------------------PGLL
D0KY94_HALNC      QCYRAVLGTDFVPAEAP---LDKDKLVWRLMRLL----------------------PNLI
C1D6T7_LARHH      RCYRAVLGEDSVPAQSP---FDKAPLSWRLYREL----------------------PAWL
I3YAG8_THIV6      QAYRRVLGD--LPESSA---FDKAPMTWRLHRLLGDLAALA---------------APLP
C0QI08_DESAH      TAYRAILGNDTIPTDSP---YDRERLVWRFFSIL----------------------PTLL
Q5QUQ7_IDILO      KAYRAVLGDD-IPKTSP---FDKDRLTWRLMRLL------P---------------ELIE
Q1QYD4_CHRSD      RAYRAVLGDD-IPEQSP---FDKTPLAWRLMALLERCLDPE---------------TSPD
B7J9Q5_ACIF2      ESYARVLGTGIVSARSP---LDKAPLTWRLMRLL----------------------PELL
F9ZQ71_ACICS      ESYRRVLGPRGVPDDTV---WSKAALRWRLLRLL----------------------PRLA
B1XZ24_LEPCP      RCYRAMLGRAGAPARSP---LDKGPLAWRLMRVL----------------------PALA
F4HF17_GALAU      KLYKQNIAEIS--EQNP---FNKSAMVWRLMRIIPTLL----------------------
B8F7F2_HAEPS      QQYRVLFPDLP--KENS---FDRQSMLWRLMRIIPQFL----------------------
A6VQ90_ACTSZ      QQYADNLPDVS--EQSP---FGKEAMTWHLMALLAILP----------------------
C7LVF8_DESBD      ALCRELRADLPREYPLS-----QERMLWRITHLLRGLLD---------------------
F2JZ46_MARM1      RVFQSALDDIPAQSAFN-----KPYLTWRLMRILERFED---------------------
A1S6U9_SHEAM      SLCYALLPGVP--KENA---FTKDAMTWKLMALLPRLIE---------------------
D6Z1F6_DESAT      RLLRAAAGEEAATATSF----SRELLTLAILELLPQLLS---------------------
E6WXK8_PSEUU      RALAANLPAPRDEQGRKLDELDVETLHWHLYAALTDRAL--------------------L
RECC_BUCAI        KLFKIILSKKE--LKNI---FTHSMIIWEIIKILD-------------------------
RECC_BUCBP        NILKQNTPKLYSKSE-----FSKYSIMWKIINIP--------------------------
Q8D2T9_WIGBR      KLVILTTKNVPFDNFAF-----RLMLSWYIAQIIPKINK---------------------
F8E602_FLESM      HLAGRITGEQIKADKKK--------LAWVIYSTLPLHFE---------------------
Q480N8_COLP3      KLIRSLASDEKVPEQSP---YSREVLCWRIHALLALDSVVE-------------------
G4QGN0_GLANF      QLCRDILGHDKVPMQST---YKREVMLWRIERLLSSDAF--------------------T
D7GDA0_PROFC      RCEQACLGVDP--DDDP---WRLPAMTMHIAQLAQAHLDSG----------------EDS
C7PDT3_CHIPD      QIYFLMDGQYSEMLSGR-------NLTWLLYKLLGEDIF---------------------
J9ZF24_LEPFM      DFLETGFGRSGQVVHFE-----RNALFLRLLRILPALRD---------------------
A5GU99_SYNR3      QLILELDGRLPAGHRDP---WDPSQLRWQLAQLIPALPQ---------------------
F8L520_SIMNZ      FLCKLLAGQTLQLPPLD-------LLTLHLLPLVQEFQS---------------------
A9BB00_PROM4      TLVRKFLGIEVINDDDP---WEANQLIWPILNSLPELLQ---------------------
Q6MFB7_PARUW      TLIHYFQLKNEKIPSILELSLAIEKELLTVLQDYHRLSDEE-------------------
                                                                              

RECC_ECOLI        -REDFTLLRHYLTDD---------------SDKRKLFQLSSKAADLFDQYLVYR------
F7XY37_MOREP      -QPDCEVISEYLRDD---------------HDHRKCFQFATRLAELFEQYMVYR------
Q1LST9_BAUCH      -QPNCSLIRQYLHND---------------VDKRKQFHLSEKIADLFYQYFLYR------
Q5E7C0_ALIF1      -QEEFAPLQRYLEND---------------KNQLKCYQLAAKIADIFDQYLVFR------
C4L7B2_TOLAT      -DVLFAPLAGYLAED---------------HDGRRCYQLCQRIADLFDQYLVYR------
A8ZX08_DESOH      AHPALSPLQAYLQD----------------GDVIKRYQLAARIADTFDQYLVFR------
Q2LTC9_SYNAS      SRPGFEPLAAYLHDD---------------SQGLKRFQLSRQIARLFDQYLIFR------
Q3B473_PELLD      RDEPFAILSRYLSGS---------------SAPLRLYQLATKIADSFDQYTLFR------
B5EAR7_GEOBB      GRAGFEEVAGYLADD---------------GDGLKRMQLARRISDTFDRYTIYR------
B8FB93_DESAL      EEPPFTEIQRYLQDD---------------PDGRKQFGLSRRIAGVFDGYMLFR------
Q7NQR0_CHRVO      GEP-FGPVLHYLE-----------------GGEAAAFELAGKIADIFDQYLVFR------
I1YH96_METFJ      DVAGFESVSTYLGET---------------NEPLKRYQLAERLADNFDQYLMFR------
E8RCD1_DESPD      TRPPFHELAAYLRDD---------------ADGIKAYQLAGRISEVLDQYLVFR------
G4SZ17_META2      DNEIFAPLNNYLVGE---------------TAALKRYQLALQLALIFDQYQIMR------
M1P5P7_DESSD      EDEKFAAVGRYVSGD---------------TNGMKRYQLAQQLANIFDQYQIMR------
B0VLS2_ACIBS      YDSADRLEQGIEKQL---------------KKQKMLYWVAEQVADLFSNYMVYRGQCQRG
Q6FF17_ACIAD      YDSADRLENGFEKQL---------------KKQKMLYWVAEQVSQLFSNYMIYRGHCQKN
A6W6P1_KINRD      HHPGDDGPGGPGGPG---------------TPPVRRTAAAARVAGLFARYGAAR------
H6N573_GORPV      AGAGTNTTEGDGPDG---------------ARLGRRYATARHIADLFERYARQR------
I0HVQ4_RUBGI      -WVGAHPRLAGYLAQ---------------ADEVMRWELAERIAATVEQYVTYR------
Q60AZ6_METCA      -LVSAHPRLKSYLAR---------------ADGAMRFDLAQRVAHLLEQYLTYR------
E1TB32_BURSG      -PWNESPRLRTYLDA---------------ADPSMRYELARRVATVLDHYLTYR------
E1SLX9_FERBD      DRPAFAPLQRFLEDD---------------PDLRKRDQLAEQLADLFDQYQVYR------
D0KY94_HALNC      HTPSFLPLRHYIVTDQ-------------RPDDRRLYQLALRVADQFDQYQVYR------
C1D6T7_LARHH      HEPVFAPLARFVEAD---------------ADPRRLYQLAHQLADLYDQYQSYR------
I3YAG8_THIV6      NPDCLAPIQGFLDGD---------------ADPRRRYQLALRLADLFDQYQVYR------
C0QI08_DESAH      TDDIFSPLNRFLEND---------------TDQRRQYQLACRLADLFDQYQVYR------
Q5QUQ7_IDILO      HNPHFAPLKHYTSDD---------------SDGRKLYQLSGRLADLFDQYAVYR------
Q1QYD4_CHRSD      DPTCYAPLRDYLQGEALEASPL--PGAAEEARERRRWHLAVRLADLFDQYLIYR------
B7J9Q5_ACIF2      AHADFAPLRHFIG-----------QSQRPDGALERRWQMAAQIADLFDQYQVYR------
F9ZQ71_ACICS      HEADPGGAPLLRY-----------LATTDSSALERRWRLAGLLADLLDQYQVYR------
B1XZ24_LEPCP      GRPGFEPLAQFLAGPGG-------PTPDAAPDLPRRLQLAQRLADLYDQYQVYR------
F4HF17_GALAU      HLPAFSRLNDYLGSAP---------------EQNKLFYLAEKIADLFDQYLVYR------
B8F7F2_HAEPS      EQPAFEALASYLNQG----------------DQLKQYQLAEKIADLFDQYLVYR------
A6VQ90_ACTSZ      LPRLNEYWRDHALGN-----------------QEKRYQLARQIADLFDQYLVYR------
C7LVF8_DESBD      -EPEFAPLARYVQED----------------SELRSVQLAERIAYHFDQYLIFR------
F2JZ46_MARM1      -NDAFSDLSNYLAED---------------GSQVRRYQLCATVADIYDQYLVYR------
A1S6U9_SHEAM      -KPHFEPLRDYLSSD----------------SPLKLFQLASRVADIFDQYLVYR------
D6Z1F6_DESAT      -RPEFAPLRRYLEGA----------------DDWKSLQLAERIAYVFDQYLVYR------
E6WXK8_PSEUU      AQPAMQRIAAHVGGD----------------DPLRAWSLAGELANVFNKYQAWR------
RECC_BUCAI        ---NKKFFENCSKKK----------------DMIKKFKFSFLMASIFKKYILYR------
RECC_BUCBP        --DIQHLLTKIVSKN---------------NTYSTLFKIASSISNLFQLYLKYR------
Q8D2T9_WIGBR      ----NIKIKNVYKNL----------------NQFQIFYLSYKLSELYNKYLIFK------
F8E602_FLESM      -NRYFDEIKRYTAFD---------------RSGVKQYQLSEKIADIFDQYQVYR------
Q480N8_COLP3      -DDDFSQATHYWRGENTTDEEDNNTVNDSKHAQLKRYQLATQLADLYEQYLIFR------
G4QGN0_GLANF      QQNFEAALIDYWQEESS------------TAAEYKRVNISRLIADTLEQYLMFR------
D7GDA0_PROFC      ATDWFALARHYLQGASGTETD----------RPGRVIAFADSFASLISGYRRHR------
C7PDT3_CHIPD      -RETYPAVATYYHTTEP-------------DSDLKRMALAERTADLFDQYQIYR------
J9ZF24_LEPFM      -DPVFSEFRHYLGEG---------------DPSRRLVSLSDELSELFDRAMLYR------
A5GU99_SYNR3      -TELWEPLQQLWHQGPQQQDN---------GLDTQRLQLILQLSDTLDQYGLYR------
F8L520_SIMNZ      --------------------------------EKKAYPLAAALAMEFLRYGKFG------
A9BB00_PROM4      -KEEAGVLQKWLERDLS----------QSGKLSRDEWQLAKTIAYTFDEYIMYR------
Q6MFB7_PARUW      -QQDWLTLIYYLKLNSKQ---VGENLKLTRKMEKRLTGLSYHLAKIFQEYGKYA------
                                                             :                

RECC_ECOLI        --------PDWLAQWETGHL-----------------VEGLGE-AQAWQAPLWKALVEYT
F7XY37_MOREP      --------PDWLENWQRGKL-----------------IANVHEKTQRWQASVWRVLIDDT
Q1LST9_BAUCH      --------PDWLEIWQQGKR-----------------VASLGP-DQNWQALLWRALIEEN
Q5E7C0_ALIF1      --------PEWIQQWEAGEE-----------------VVELEG-EHPWQPTLWRALYDQT
C4L7B2_TOLAT      --------PDWIVDWESGG-------------------AQGAE-TQLWQPVLWRKLVALT
A8ZX08_DESOH      --------PDMLLQWEAGAL-------------------PADP-HEKWQAHLWRLLISQG
Q2LTC9_SYNAS      --------PEMILNWEKRIS-------------------DGD--EYSWQADLWRLFVEEG
Q3B473_PELLD      --------PEMLALWEAGEG-------------------TAG--PDGWQSILWRRLNAEL
B5EAR7_GEOBB      --------PKELLRWEQGE-------------------------EEHWQAQLWRALNDRA
B8FB93_DESAL      --------PEMILNWDHGK-------------------------GGHWQAILWREISQGF
Q7NQR0_CHRVO      --------PDWIRAWEAGEL-------------------LGLGEDEAWQASLWRRLAESD
I1YH96_METFJ      --------PDWIRQWEKGQ-------------------------TDNWQSQLWYALTEHD
E8RCD1_DESPD      --------PDLLARWERGE-------------------------DGHWQAVLWRALVKEG
G4SZ17_META2      --------PDMLAAWQQGET-------------------LYDTETERWQRALWQRITENA
M1P5P7_DESSD      --------FAMIEGWENGKT-------------------ATNNPAEVYQMELWNMLRDGI
B0VLS2_ACIBS      CENMCTCPNNWLAAWGQGRSLDIEKYIAHKDKEVSAFTLQQTQELERWQRWLWQQHFHDD
Q6FF17_ACIAD      CAGNCGCASNWLSAWGENRELDIEQLIVQGNKEISAFQLQQAQELEAWQRWLWHRYFHQD
A6W6P1_KINRD      --------PQLLADWAAG---------------RDDAPGAPLPADLRWQPEVFRAVRERV
H6N573_GORPV      --------PGMLADWAAGG--------------QSNGAGAALPDDMAWQPRFWRAVRERV
I0HVQ4_RUBGI      --------PEWLAEWLAGR--------------PVAFPGGAAPADAAWQADLWRRVVAET
Q60AZ6_METCA      --------PDWLAAWLEGR--------------PASGLPEASREDEAWQAAFWRTLVDEL
E1TB32_BURSG      --------PEWLLQWQKGGSIFASGAADDTG-PRLVGASEAAREDERWQAALWRAVLTEL
E1SLX9_FERBD      --------ADWLAAWARGEDELIN----------ATGFRNPLPSEQLWQPELWRAILADM
D0KY94_HALNC      --------ADWLRHWQEGHDDL-------------PAHETRLPDEQRWQPPLWRALLADI
C1D6T7_LARHH      --------ADWLTGWENGHDDI-T----------RHGRPAPLPEGERWQAELWRRLAGQL
I3YAG8_THIV6      --------ADWLAAWQAGEDVLIR----------PDGRREPLPDAQRWQPALWRCLLRDV
C0QI08_DESAH      --------ADWLKQWAGEKDQLLT----------GGGQWVDIPPQHAWQAELWRRLRARV
Q5QUQ7_IDILO      --------ADWLDNWVRGQDMLE--------------QEQPVEDEQLWQPELWRAVSNDI
Q1QYD4_CHRSD      --------PEWIEAWERG-----------------EHAPADLPDDQRWQPALWRALIEDA
B7J9Q5_ACIF2      --------GDWLADWTTDQSLLRR----------GDGERVTLPADQRWQPRLWQALRQDL
F9ZQ71_ACICS      --------ADWLKDWAAGRWTLRD----------GRGVLRDLPQDQRWQAQLWQWLCREV
B1XZ24_LEPCP      --------ADWLIDWAAGRAVLTNPC--------TGAAPVALDAEQRWQALLWQALIRDL
F4HF17_GALAU      --------PEWINQWQTADWQQMTTSFVQQLSPRFKPIADNIMNDISWQVLLWQALVADI
B8F7F2_HAEPS      --------PQWLVLWEKGQSQAVVDEIMRAVSFKQKN-AKEIATNVAWQSILWNALVADI
A6VQ90_ACTSZ      --------PDWIDAWEKGD-DRYIENQLRYALADNPVLLAQIKQDIRWQGQLWRELVAAV
C7LVF8_DESBD      --------PEWAARWENHEPS-------------GNFLLPGHVASEAWQARLWRELIRDM
F2JZ46_MARM1      --------PDWISAWESNQEDS------------LPLKLREKFEAQPWQAILWRELMADI
A1S6U9_SHEAM      --------PDWIVTWELGEND-------LSPTGSPLTQGAALPDNCLWQPLLWRALVQYN
D6Z1F6_DESAT      --------PEMVLAWEDRQ--------------------AEPEDDDRWQALLWRQLAQRF
E6WXK8_PSEUU      --------RDWLLRWEDGAG------------------------PDDPQAILWRRVARGR
RECC_BUCAI        --------PEWINQWEIEKN------------------ISIFDKNEQWQIKLWMEIIHNT
RECC_BUCBP        --------PDYIKKWEQKSN------------------IPKTRLKQKWQQIIWMRIIKYT
Q8D2T9_WIGBR      --------PDWIDLLNFKKK------------------SKKLEDSQYFQLIIWNLLVKKI
F8E602_FLESM      --------PWMLQSWEKGEYVNQN--------------GEKLPEDYWWQPILWQNLCKRD
Q480N8_COLP3      --------PQWLDNWQQGNFEL-------------DGLEKISASEHKWQGKLWRLLIAQL
G4QGN0_GLANF      --------PEWLLAWEKGESVIAD-----------PEQNHVALKHEVWQRWIWLELAKEE
D7GDA0_PROFC      --------PDLLLDWDEHRDV--------------DALGRPLSDQDRWQANLWRELTHSL
C7PDT3_CHIPD      --------PEMINEWNAPPE--------------------DPFAKIDWQQYLWTEAKKVS
J9ZF24_LEPFM      --------PEWLTSWEDFPE------------------------DLSWPAVLWRNVAGKD
A5GU99_SYNR3      --------PQMVRRWLNGES--------------VDGSHAPLAAHQQWQPALLRELAQRL
F8L520_SIMNZ      --------EGKLIEWAQKEG---------------------------WQQTLWKTVFSQW
A9BB00_PROM4      --------PDVISDWWGTENEINN-------------LKSKLPKYIQWQPILINLLKQRI
Q6MFB7_PARUW      --------YSLVSKWEKSE-------------------------HRGWQSRLWKSLFGGN
                                                                     .        

RECC_ECOLI        HQLGQPRW---------------HRANLYQRFIETLE-------SATTCPPGLPSRVFIC
F7XY37_MOREP      AQAGKPLW---------------HYANLYKRFIHTLV-------HSTMRPPGLPDRVFIC
Q1LST9_BAUCH      MLS----------------------TNLYQLFIQAMK-------HMTVRPSGLPDRIFIY
Q5E7C0_ALIF1      LALGHSPY---------------HRANMFEHFIETLDNYL----QTGTLSKGMPKRLFVV
C4L7B2_TOLAT      -EQQASHL---------------HRVNLFSSFINTL--------KAGKPKAVLPQRLFVF
A8ZX08_DESOH      -WAE-------------------QRAERWKQFLSLAQSG-------ALAGSTLPSRVSVF
Q2LTC9_SYNAS      KIVH-------------------PAVLRLSLQDVMIRRG-------NQLSACLPERISIF
Q3B473_PELLD      GGRH-------------------RGILKEAFCRNGTL-----------PDAVFPRRIALF
B5EAR7_GEOBB      GQKH-------------------RARLLHDFLASRK------------NDRSWRRRISVI
B8FB93_DESAL      NDRH-------------------RPGLRTDFFKALRSGK-------S-RPGVLPKRISLF
Q7NQR0_CHRVO      PG-R-------------------HRVRMLDQFFADLK------------PEHLPPRVTLF
I1YH96_METFJ      TEPK-------------------HRAYLLEKLHDKLKNS-------NTPPEGLPQRLHLF
E8RCD1_DESPD      VP---------------------HRARLGERFQALLRGG-------AVAEGILPERLHLF
G4SZ17_META2      G-TR-------------------HRGSLWLEVIERFNSAP-----PGQFSAVLPERISIF
M1P5P7_DESSD      GHSR-------------------HRGRFLRDFIDILATD-------ADHGSLLPRRLSVF
B0VLS2_ACIBS      FMQM-------------------QQIDELFWQELEHPER------QKKALSRLPQQIVIF
Q6FF17_ACIAD      FLDI-------------------QNIDDLFWQVLEQPQT------RDIALKRLPKQIVMF
A6W6P1_KINRD      GLPA-------------------PAELLDDACAALRTDP---------ALSDLGPRLAVF
H6N573_GORPV      GAAH-------------------PVERLDALCEAVRADP---------GAVDLPPRVSVF
I0HVQ4_RUBGI      GVSG-------------------RHPIEGFIDTLSGPGG-----AARAREAGLPERVHVV
Q60AZ6_METCA      EVRR-------------------EHPSAAFFRAVEAMG------PEATRRAGLPARAHLF
E1TB32_BURSG      AGDA-------------------RTPAAALPPAYRFLDEIVTLDLDAIANANWPEAVSVF
E1SLX9_FERBD      NDAERD----------------TSRAMLHQQVVDRLR--------QGPPPVGLPRRIVVF
D0KY94_HALNC      RERQDDRDGI---------EFAAGRADLHTAFRKAASE-------QKARPEGLPRRIVVF
C1D6T7_LARHH      ASARHT-----------------HRAAVHQRFVAALRE-------GTPPPGSLPERVVVF
I3YAG8_THIV6      AGEAGAAAGA---------FGHASRAEIHRAFLERATTYPD--ASLDATQDRLPRRVIVF
C0QI08_DESAH      PA-------S---------LRNIGRSDLHQAFLQKAS-------DTRVRPEILPPRVIVF
Q5QUQ7_IDILO      GIDDYW----------------NNRAELHQRFIDTAQA-------LTERPAGLPPRVVVF
Q1QYD4_CHRSD      PAAARE----------------HHRARLHRRFLDAARG-------LRKRPRDVPPRVFVF
B7J9Q5_ACIF2      HSRGLDQAPG--------------RAQVHEQFLAALNAG-------RPPVTPLPRRVVIF
F9ZQ71_ACICS      TEGG-SHFAG--------------RGEIHEAFLQRLREA-------APGSLDLPPRLIFF
B1XZ24_LEPCP      GTTDADQPADAPAESAALAVLAGTRPAVHARFVAALAQD-------EAPQRPLPRRVVLF
F4HF17_GALAU      QQHYPEQ-------------QIWHRANLYQTFLEQLQQGYC------PKN--LPTRIIVF
B8F7F2_HAEPS      KQDSDEAI-----------FNTSHRAYLQQRYFDKLDNLTA------TEKARLPKRIFMF
A6VQ90_ACTSZ      CRHTKDS-------------PARHRVNLHLTYLNTLATGR-------PKN--LPPRIFVF
C7LVF8_DESBD      GGEH--------------------RAALLRRAIASLEKG--------TSLPDLPSRVCVF
F2JZ46_MARM1      SHDGMSLY---------------HRANLLEALADMTKSQ--------PRPSSVPERIFIF
A1S6U9_SHEAM      RDELGQSH--------------WHRANLHQALVAALSNP-------NTDISALPRRLFVF
D6Z1F6_DESAT      GSPA----------------------RLFHQAKGRLQQGD------LAQPELLPARVFLF
E6WXK8_PSEUU      P----------------------HRARRIQQYLERFDRID------GELPRGLPTRLSAF
RECC_BUCAI        KKINQSSD---------------HFANLFYNIQKIIKEK-------KIKKKYLPKRFFII
RECC_BUCBP        KDANKPIL---------------HFSNLLYDSIKKMQRN-------NFINTKLPVRIFIF
Q8D2T9_WIGBR      KKEKD-----------------FCISSIYESCIQKIEKS-------NLIFEDIADRIFIF
F8E602_FLESM      EINR---------------------SDVYLRMLNTTGAA---------GAKDENKHIFVF
Q480N8_COLP3      PYNP---------------------VELMHDAIANIQDK----------KELIPPRISFF
G4QGN0_GLANF      PN---------------------HPVRLQLLALEKLDKK----------SHVLPSEVYFF
D7GDA0_PROFC      RPWI-------------------HPAAREDRLREALDDPD------PSARQHLPSRLGVV
C7PDT3_CHIPD      GHALP------------------DKTIIGQHILDMLKNPD-----HQETLAHRMNTVHLF
J9ZF24_LEPFM      HPAH--------------------FARLLHEFHSLPVLD-------SLWQEALPDRLFLF
A5GU99_SYNR3      EPSG--------------------IPHPAERLLHALEQS--------RQRSDPHEPLHVF
F8L520_SIMNZ      DIPS----------------------KLLDLSLKK---------------PNQPLEIHLY
A9BB00_PROM4      TQEP--------------------FGLQVRNVASKLKKGI-------APKQNLPSDLRIF
Q6MFB7_PARUW      QG----------------------WTYWTKAFQKTLKFF-------------PECEVHFF
                                                                              

RECC_ECOLI        GISALPPVYLQALQALGK--HIEIHLLFTNPCRYYWGDIKDPAYLAKLLTRQRRHSFE-D
F7XY37_MOREP      GISSLPPTYLKVFQALGK--HIDIHLLFTNPCRYYWGDILDHAVLRRLLHRHRWQYPQPK
Q1LST9_BAUCH      AVSSLPPIYLQVLQALSN--HIDIHFMLVNPYRFNRIN----------------------
Q5E7C0_ALIF1      GITSLPPRYLDALAALGQ--HIDVHLMFTNPCRYYWGEIRDRKYLARLEARNRLQVKWLD
C4L7B2_TOLAT      GISSLPPHYLEALMALGE--HCEVHLLLTNPCRYYWGDLQEE-----NQINQRVLNKLLA
A8ZX08_DESOH      GISTLPRFHVQVFAALSA--FLEVRFFVLNPCRHYWGDILSTYE----------------
Q2LTC9_SYNAS      GISYLPPFYLDIFLAVSS--FMEVNFFLLNPSREFWFDIRSSREISR------------E
Q3B473_PELLD      GISYLPQFHLDILSAIAR--HREVNLFVLSPTEEYWGDIVSRRT----------------
B5EAR7_GEOBB      GIPSLPPFHLDVLAKVAE--HAEVNLFLLNPCRQYWGEIVSERE----------------
B8FB93_DESAL      GVWGMPPFHLDVFSGVGR--MLPVYLFHVNPCKEYWAHAFSDKQ----------------
Q7NQR0_CHRVO      GIASLAPMYLALVKRLSQ--LTDVCLFTLNPCEAYWGDIVDARR----------------
I1YH96_METFJ      GLTALPPVYLQTFTLLAR--YIDITIYTLSPSEYYWGELIETKQ----------------
E8RCD1_DESPD      GLNALAPVYLDILAGISN--HSEVHLFHLSPCRHFWGDLVSARQ----------------
G4SZ17_META2      GVNTMPPLFLGFLQGLAN--HAQVHLYLLNPAQAFWADLATKRQ----------------
M1P5P7_DESSD      GLHSLPPVLLNCLQALAA--HCDVHLYLLSPCEIFWGDQLSEQV----------------
B0VLS2_ACIBS      TLLDLPPSQLQFLRRLGQ--YIDVLILHYNPSQEYWADSVDPLWKQRYDLGVKERFIAKN
Q6FF17_ACIAD      TLLDLPPSQLQFLRRLGQ--YLDVLILHYNPSQEYWADSVDPLWKQRYDVRVKQRFIEKN
A6W6P1_KINRD      LVTRLATSRLRVLSALAE--HREVHLLLQHPSPALWDATAAALRTD--------------
H6N573_GORPV      GPTRITETFRQVASALGA--HRDVHLFVPHPGPALWRAVATTAAP---------------
I0HVQ4_RUBGI      ALPTMPPLHARLLAALGR--AIEVEVYLLNPCREYWFELVDPRRL---------------
Q60AZ6_METCA      CLPTIPPLYLDILGKLAR--WTELHLYVLNPCREYWFDIVDPRRL---------------
E1TB32_BURSG      ALPTMPPLHVALLRALSR--WVDVRLYVMNPCREFWFDVVSEGRK---------------
E1SLX9_FERBD      GISTLPSQMIEALAALAQ--HCQILLCVQNPCQHFWGDIIEQKDLLRAQLSRARHQRKPG
D0KY94_HALNC      GLSSIAPQVLDVLAVASR--WSQVIVCFLNPCEYYWGDIIDGHQLFAQRYQGRRPYK---
C1D6T7_LARHH      GLSALPQQTLEALDAISR--HSHVLMAVNNPCRYYWGDIVEGREWLRRQAEQRHRRR-SG
I3YAG8_THIV6      GISSLPRQSLEVLEAIAP--FSQVMLFVHNPSRHHWGDIVEGRELFRREYRRYSARGACP
C0QI08_DESAH      GISSLPKQVLETLYAVSH--LCQVLLFVNNPCRHFWADIIEDRELLRIDHARHSGKATMP
Q5QUQ7_IDILO      GISSLPQQMLQVLDAIKG--YTQILLCVHNPSQYHWADIVDGKEALRQAVKASSRLKHKP
Q1QYD4_CHRSD      GISALPAQTLEALHALSG--VVDVFLMIANPCRHYWGDIVSDRDAIKRAGRLSSQARREQ
B7J9Q5_ACIF2      GAATLPEQSLTALAALGR--QMQVILAVPNPCRYHWADIVSGRELLRRERRRQPPRNGHD
F9ZQ71_ACICS      GAVSLPAQSLEALAALGR--HLQVLMAIPNPSAYHWSDVAGADEDLRRQRRRR-------
B1XZ24_LEPCP      GHSHLPAQTLEALAALAG--HTQVILAVPNPCRFHWADMIDGRELLRSAHRRQPLRNGRD
F4HF17_GALAU      GISAMPPMFLSILSALSQ--YIDIHLFFNSPSRYYWGDLIDHRYLEKLKQKIQTESKE--
B8F7F2_HAEPS      GISSLPHSQLAVLKKLSE--HCNVHLFFTNPSMEYWANDREDKVLEKLALKDNLSEAE--
A6VQ90_ACTSZ      GISALPKAYLETLQAISR--HSQVHLFFNNPSKHYWGDLADPRFIRELSLKTYREHGSDR
C7LVF8_DESBD      GIPTLPPVYLDLLKALSR--HSQVHVFLLSPCQKYWGDLLTHRERRR-------------
F2JZ46_MARM1      GVSSLPPNTLNALQVLANSGWIEMHLFLQNPCRFYWGDVVDKHFVGRAIKRQ--------
A1S6U9_SHEAM      GISSLPPQTLEVLYALGS--RIPVTMLSLSPCRQYWGDIVDSKLRAKLALKYK-------
D6Z1F6_DESAT      GITTLPPVYLDLLNEAAK--LLPCHLLLFAPARDYWGDILSPKAANRLLLRHHPPAANAD
E6WXK8_PSEUU      ATLNVSPDVLRVIATQAR--VGSLHLFVPSPVADYWGDLQRLRR----------------
RECC_BUCAI        SSFSMNPSYIKIFQNISI--YTDIYFLYITPFKKNIFNFIQDNK----------------
RECC_BUCBP        NITPITPQYAIFLKSISK--YCSVHFFYATASYNDKQMFSTSFIKFKQTQEISNNQLLSL
Q8D2T9_WIGBR      GIYYIPEIYLKILKTLSK--KIDIHLFCINPCCLYWFDIDNRFYISNLIENKIK------
F8E602_FLESM      GISVLPPLYVKILENLGY--RFEIEMFLQSPSREYFGTERFYKNAD--------------
Q480N8_COLP3      GLNTMAPMWLNFINALSE--HVEVHFFHLNPCFSYWGDVVTEKYALNKLSQWS-------
G4QGN0_GLANF      AINTMAPQTLAFFNQIAK--YTQIHFFHLNPCIDYWGDAVSDRTLAKQLQ----------
D7GDA0_PROFC      GLDGFVPDERRFLTTMSA--RIPLTIWQLGFGSD--------------------------
C7PDT3_CHIPD      GLSIITAYHVQILHELSSFIDIYFHIINPSPELYWFDDKSEKQQARWRLK----------
J9ZF24_LEPFM      GLSGIAPATLDIFFRIGRETSCQVHFFFLNPTDRYWADMVSLRSWE--------------
A5GU99_SYNR3      GLSSLPPALWKLLAQRASSRDSPVLLYQLSPSLDPWGSLPPSHHEE--------------
F8L520_SIMNZ      KFSFLPELYYRFLEKVAA--HVPVHIYQFSPCATFWTDTFSEKERIFLEKKV--------
A9BB00_PROM4      GINSLAPVQLELIQALSC--IMEVKVFLLTPCKDLWSRCKTKREE---------------
Q6MFB7_PARUW      SISFISKAEFQFLSKLAN--VAPIYYYLLSPCAVFWSDIRSDNETRYLQTYWQQKLGS--
                      .                                                       

RECC_ECOLI        RELPLFRDSENAGQLFNSDGEQ--------DVGNPLLASWGKLGRDYIYLLSDLESS---
F7XY37_MOREP      KEQALFRRPAQAESLFNTIGEQQ-------HIGNPLLAAWGKQGRDHIYLLAQMEGI---
Q1LST9_BAUCH      ------KQSYTQQPIYSTNTNQ--------KSINPLLEYWGKQGKDTISLLSELKNI---
Q5E7C0_ALIF1      DHSEHIGDTEQLKGSIEANFEDELHTSE---VGNSLLASWGKLGRDNLCLLSEMEA----
C4L7B2_TOLAT      QRREQWQQAEQHKPLLPETDWQQLFSDEGEQQGNPLLVSLGKQGRDYLSLLAEISA----
A8ZX08_DESOH      ----------KKQVETGADARDIPEAARHLETGNSLLASMGMVARDFFAMV-EDHPHQ--
Q2LTC9_SYNAS      VK------LVKGSVEKGMENEELSRSELYLEEGNSLLASLGTLGREFWSFL-GECSGR--
Q3B473_PELLD      ------------LSGMTHA------ERELHAEGNPLLASLGRIGRDFSDMV-LEIPDE--
B5EAR7_GEOBB      ------------LARLEKHG---QGEEQWYETGNPLLASWGKLGRDFFKAI-IDDCGD--
B8FB93_DESAL      ------------ITRITTRSPFTRPEELYLEKGNALLASLGGVGRDFLGLV-AGLDCH--
Q7NQR0_CHRVO      ------------LLKLRQ------AGDLFATQGHPLLSSLGKQGRDFFELIAEDAELD--
I1YH96_METFJ      ------------HHRVALQ---QSPDAVPYEPDHPLLASLGKQGMTFFRQL-QEIEHQ--
E8RCD1_DESPD      ------------LAGMRASGREEVGSATYHEQGHPLLVSLGGTGQDFFCQL-LDRETQ--
G4SZ17_META2      -----------RIDR-------------EDPGGHPLLAALGQQGREFQEMLLEQVQFEL-
M1P5P7_DESSD      -----------QLKKNISALRDGKQVLEQGLTSHPLLTSLSQQGREFQNMLLEDILFAG-
B0VLS2_ACIBS      PQ------ATDAEIADFFNKFTLNFNAEARESRHPLLTRLGKQARDHFSLL-SNLSTGE-
Q6FF17_ACIAD      PA------ATDVDIAQFFEQFTLHFNAEARESRHPLLTRLGKQARDHFSLL-ANLSTGE-
A6W6P1_KINRD      ------------------PGPRRAAWAAHAPGRHPLLRSMARDVRELQVRL-AHAAPGH-
H6N573_GORPV      ------------------ADARRASWRP-PSLRNPLLAGLSHDVQELQLSI-AGHLDTE-
I0HVQ4_RUBGI      ------------------AWLQAAGRDAGHEVGNRLLAGWGKQTQAQIDGL-LDAAGDA-
Q60AZ6_METCA      ------------------NYLEVRGDALYRETGNRLLANWGQQTQAHIDLL-FDKAEGA-
E1TB32_BURSG      ------------------EALDAAGQLDYQEVGHPLLAEWGRQTQAQLHML-HELTESA-
E1SLX9_FERBD      -------------------LAAELDPAAQHAEVNPLLAAWGKQGRDYIGMLYGYDQ----
D0KY94_HALNC      ------------------------SAPNETAHAHPLLAAWGRQGRDLMRLLDQFEE----
C1D6T7_LARHH      -------------------MPAALDDSTLHLHAHPLLASWGRQGRDFIALLADYDRW---
I3YAG8_THIV6      E-----------RSRR---VPMDVDETQLHLHGHPLLAAWGKQGRDYIRLLDEHDRREDY
C0QI08_DESAH      ---------------------TPLDPVDVYRHANPLLAAWGKQGRDYIGLVYGYDTPETY
Q5QUQ7_IDILO      E-----------LP-------DDPNDDELHQLAHPLLASWGKQGRDYIRLLDLYDE----
Q1QYD4_CHRSD      E-----------ARHPEAPWLAELDEEALHLHANPLLAGWGTQGRDFIVGLYEFESD---
B7J9Q5_ACIF2      --------------------LSATATEDLHQFGNPLLAAWGRQGRDFLDLLDQFDE----
F9ZQ71_ACICS      -----------------------VLGTSEAGFGPRLLAAWGRQGRDFMRLLDRFDE----
B1XZ24_LEPCP      --------------------LGALDIADAHAEAHPLLAAWGRQGRDFLRLLDAFEEQ--L
F4HF17_GALAU      ---------------------MQTPYDETLAVGNPLLASWGKLGRDFLYQLTQLEPND--
B8F7F2_HAEPS      ---------------------LAELFEKQ---GNPLLTVWGKQGKEFLNLLTETGIQD--
A6VQ90_ACTSZ      EAN---WLSETEKVRLKNGEFERSADDELLQIGHPLLATWGKLGRDFFYLLSDLNARE--
C7LVF8_DESBD      ------------------AYRAGEHASPERPEDAMPLAGLGAVGKEFLELLMERDALE--
F2JZ46_MARM1      ------------------TLKPGMHTNMLHLDANPLLASWGRLGRDYIAQLQDVADAEL-
A1S6U9_SHEAM      -----------------AHKMLPEHWEETLEVGNPLLAANGKMGRELLDLVLSLPPEHF-
D6Z1F6_DESAT      ------------------EQHGRDFEHLHLDTGHPLLASWGEVGREFQHIMEERAEYLQ-
E6WXK8_PSEUU      ------------------------GETAQEAGENLLLQRWGAAGADFMHLVGSYELVHA-
RECC_BUCAI        -------------------IFTDIKIEKKNILNDSLITLWGQYEEIYYFYILKSKKNK--
RECC_BUCBP        LHS--------------KNKNIIYHEIENFQKNTKFQSYWITYEYEQMLFLSLIKDKT--
Q8D2T9_WIGBR      ----------------------NKKNFFRKKIKISLLSFWGCLGAKYLKLLNNLNENIE-
F8E602_FLESM      -------------------------REELKEGVNSLVANLARTGSEFFDFLAEYIDYFS-
Q480N8_COLP3      ------------------DGVLPEELDVHSYVGNPLLANLGQQGREFISMLQDYSTIDV-
G4QGN0_GLANF      --------------------QGKIDAWVEQQAINPLLRNLGQQGKDLFNLLSQSSHYEI-
D7GDA0_PROFC      -----------------------------GPGESALRARYGSVRDELWHRAQALPDVRID
C7PDT3_CHIPD      ----------------------GRPIHESDTAGNPLLMGWGRVVQDTFGLFFKYDAFIN-
J9ZF24_LEPFM      --------------------HMEEELKPYFDPGHPLLAFLGRTARDLHKKLEEGIRPED-
A5GU99_SYNR3      ------------------GDALDRLERRLLHQGHPLLASLGRTQRDFHWQLELIAADLQE
F8L520_SIMNZ      ------------------DANVRAEWNAYLQDRPLLLAHLGKLARQTFRFFEEEDFPIE-
A9BB00_PROM4      ----------------YGEGWKVANDKLWLLNKQRLEATLGRMGSEFEQLLEGSGEYQLG
Q6MFB7_PARUW      ------------------KASQVLQLEELLRDRNPLLANFGKLGREMAYQIEESQATTHA
                                                                              

RECC_ECOLI        -----------------QELDAFVDVTPD-NLLHNIQSDILELENRAVAGVNI-------
F7XY37_MOREP      -----------------AEVDAFVEPAGN-TLLSLLQRDILELENHTVISSSLVG-----
Q1LST9_BAUCH      -----------------QKIDAFVELSQEKSLLSLLQLDILEDNIVC-------------
Q5E7C0_ALIF1      -----------------QEIDAFVDVGND-NLLHSIQSDILNLEERSRD-----------
C4L7B2_TOLAT      -----------------AEIDAFAEINGD-SLLHLLQQDLLELQDGTR------------
A8ZX08_DESOH      ----------------ETSLFAPAGETTMLACLQNDILDLKDAAD---------------
Q2LTC9_SYNAS      ----------------EEEYYVEPGETSLLHAIQSDILNLREGGGE--------------
Q3B473_PELLD      ----------------QNRTVERYIDPRRDTLLHAIQSDILTLSG---------------
B5EAR7_GEOBB      ----------------HERE-DSFYELPQGVLLHEVQADIVELRG---------------
B8FB93_DESAL      ----------------PQELYESPDRTALLGMIQGEILEFKEEDG---------------
Q7NQR0_CHRVO      ----------------AKPLFAAPKGDGLLARLQRDILQLNDPSQ---------------
I1YH96_METFJ      ----------------SISYFEPPESGQMLAELQADMYWLTVAE----------------
E8RCD1_DESPD      ----------------ENDLYQENGARHLLAALQDDLLDLHDRSA---------------
G4SZ17_META2      ----------------ELDSFEQ---DEPSTVLRQLQNDILNND----------------
M1P5P7_DESSD      ----------------EFKSFADPLDHSKPCLLHRVQSDLLKGEL---------------
B0VLS2_ACIBS      ----------------EGKWVDAFVDDFPESLLGKVQSDILHLVE---------------
Q6FF17_ACIAD      ----------------EGRWVDAFVDDFPDTLLGQVQSDILNLAE---------------
A6W6P1_KINRD      ----------------TDVHHPAPEP--APTLLGTLQAALARDAE---------------
H6N573_GORPV      ----------------VH-HRAGDHP--PATVLQTVQAGIRDDSD---------------
I0HVQ4_RUBGI      ----------------VVDEHLFVRP-PEHTLLGRLQGAILDSVE---------------
Q60AZ6_METCA      ----------------VIDDAQFEPP-ARISLLAAVQEAILDLRD---------------
E1TB32_BURSG      ----------------ASSETGDFTENPEPSWLAAVQNGILDLRS---------------
E1SLX9_FERBD      ------PEAYQGQFNSIDLFEDPLSDS-DGRLLHRIQAGIFEL-----------------
D0KY94_HALNC      ------NAQLAANPLTLTPFESTVVDSAKSSLLTLIQDDILKLRTP--------------
C1D6T7_LARHH      ------QSAAATHAQDIDLFDEAVPAG-TLPLLQQVQQAVLEL-----------------
I3YAG8_THIV6      ------EGHFQAASMDIDLFESPSEFPGEATLLQQLQDDILELRPL--------------
C0QI08_DESAH      ------RKNFA----EIDLFRDVIAQDTRGTLLHEIQQAILDLEPS--------------
Q5QUQ7_IDILO      --------TLAKQEAFNTIKLELFEPHNTDHLLAQLQDDILNLRPV--------------
Q1QYD4_CHRSD      ----------RGFDLETDVFRDMAPEQ-SPTLLQQLQQDVLELVHPGE------------
B7J9Q5_ACIF2      --------TAALQRQMDIPRIDLFSEDQGDTLLRQLQVQIRDLEGIRP------------
F9ZQ71_ACICS      --------SVEMGPLWGLQRVDFFTEDTGTTLLRQLQTRIRDLVDSR-------------
B1XZ24_LEPCP      ------GGAEAGALRGELPRVDLFDDEPGDTLLAQVQARIRDAVPLAEHAALNG------
F4HF17_GALAU      ------------------IEVYNAPEGGQ--LLQQLQRQILELTPT--------------
B8F7F2_HAEPS      ------------------ISLYNHFEDKNPTLLTQVKKAILYSEHQ--------------
A6VQ90_ACTSZ      ------------------FTAYTPLEGAD--LLTQVKNRILNLVPD--------------
C7LVF8_DESBD      --------------------TGLYEEPVGDTMLGQLQADLLDLDVR--------------
F2JZ46_MARM1      --------------EIFDDYLLDGLDENQVSLLHRVQQDVFTMENHGAKEERE-------
A1S6U9_SHEAM      -----------------TLDDSGYETNDDSHLLGRLQNDILDMEVAGAPLCADL------
D6Z1F6_DESAT      ------------PAHGDCFVNPATVEVAGASILARLQRDILELQEPAPAAADQRNSAGDS
E6WXK8_PSEUU      -----------SAEFNVHADPAEGGGALQGSLLRRLQADVYHRRASP-------------
RECC_BUCAI        -------------------VINCFKKNKNKSLLSQIKNNFFNDSE---------------
RECC_BUCBP        --------------------INLNFKIKQNSLLQYLQNKILNLHSIQKK-----------
Q8D2T9_WIGBR      --------------------NKIFYKPKKDNLLHTIQNDILYNKYYNIIISKKFNKFE--
F8E602_FLESM      ---------------------SDMKPKKEESLLQCVQNDIISLKPP--------------
Q480N8_COLP3      -----------ELFEQAKSAQAISNNNDVTSVLHQLQNDILELSDARSP-----------
G4QGN0_GLANF      ----------------SAFDTDYQQESAAPKLLQRIQQEILQGEAGQSE-----ARQVES
D7GDA0_PROFC      -------------------RPGTGPSGRPATVLAALQDDIRSGHGP--------------
C7PDT3_CHIPD      -----------------AYESEGLVEPQPDTLLNKVQHDIFLNANE--------------
J9ZF24_LEPFM      ---------------PVADIRECFEEPEGTTTLSRLQRSLFRMDAA--------------
A5GU99_SYNR3      ------QFE--------RQQRPAPLCPEEAGLLQQLKADLLVGRPRGEG-----------
F8L520_SIMNZ      ---------------------EHYVSPKTDTLLHQLQHQILHYEAK--------------
A9BB00_PROM4      ------EWD--EKDLFAMPATIALNKQRKPTLLEQIQQRLVTNECI--------------
Q6MFB7_PARUW      GYILPSHVSELNDEIFFQEDLFLKESLQPLTLLHAIQADILMMRNP--------------
                                                  :      .                    

RECC_ECOLI        --EEFSRSDNKRPLDPLDSSITFHVCHSPQREVEVLHDRLLAMLEEDPTLT----PRDII
F7XY37_MOREP      --QPLTQGNDQRPLRLDDRSLSLHVCHSTQREVEVLHDSLLAMMVEDQTLR----PREII
Q1LST9_BAUCH      ---HLHNAKVKRLLQHNDHSLSINVCHSPQREIEVLHDAILAMIAQEQSLL----PCEII
Q5E7C0_ALIF1      --DVLDNSQHKQPISSDDRSILLHSCHSPMREVEVLHDQLLDMFASDPDLK----PRDII
C4L7B2_TOLAT      -------LRPKRPISASDRSLVLHGCHSPLREVEVLHDQLLQRFAADPTLT----PKEVV
A8ZX08_DESOH      --------QERVRVDGNDASMQISVCHSPMREVEALHDNLLAMFEADAGLS----PEDVL
Q2LTC9_SYNAS      -----ADADGREVMFSEERSLQIHACHSPMREVEVLHDSLLDLLEADPSLQ----PHDIV
Q3B473_PELLD      -----TGEGERPVCSATDRSVQVHACHSPQREVEVLHDRMLDMLESIPGLA----PRDIV
B5EAR7_GEOBB      -----AEAGPR-QVQAGDLSLKIHSCHSPMREVEVLYDTLLSLFDADPLLS----PRDVL
B8FB93_DESAL      -----RKTQEKARPLPGDRSLAIHNCHSPMREMEVLYDHILKFLDEDPDLD----PQDIM
Q7NQR0_CHRVO      ------L---PRPFDPADASIEVHACHGPMRELEALKDRLLAMFAADPKLS----PADVA
I1YH96_METFJ      ----------KSPVIETDDSIMVHSCHSPMREMEVLYDQLLAMFERDPDLS----PADIV
E8RCD1_DESPD      ------VGAERYVLGLEDRSLQFHRCFSPLREIQVLHDRLLDLFQTIPDLA----PDDIL
G4SZ17_META2      ---------SESTPLTRDGSIAIHACHSRMREVEVLKNQLLAALENDSELD----LRDIV
M1P5P7_DESSD      --------TPLSVPLAKDDSVVVVSAHSPHRELMILKDRILHWLDEDPDLA----LKDIV
B0VLS2_ACIBS      ------PQAKQYELAPNDDSIQIHVCHSTLRQLEVLKEQLIGWLAKPHEQP--RRPNDIL
Q6FF17_ACIAD      ------PQAGRYTLEPSDESIRFHVCHSSLRQLEVLRDQLIHWLSQNDDASV-RRPNDIL
A6W6P1_KINRD      ------PAP---GPDPGDRSVQVHACHGRARQVEVLREVVLGLLDADPTLQ----PRDVL
H6N573_GORPV      ------PRAD-RGTCAADDSIEIHACHGPERQVEALRDRLLHLFDADPTLQ----PRDVI
I0HVQ4_RUBGI      ------LEPGSAADLAGERSVEFHVAHSRTRELEALHDRLLALFAADPTLT----PGDVL
Q60AZ6_METCA      ------PEPGCCASVAGDRSIEVHVCHSLVRELEVLHDQLLALLARPDAPK----VSDIL
E1TB32_BURSG      ------ETQ--ADELPYEHGIEVHVCHSLSRQLEVLHDRLLGWFDEFDDLQ----PSDVL
E1SLX9_FERBD      ---EPTPAPPMRVDPD-DDSVRFTLAHSRQREVEILQDHLLKRFAE-DPSLT---PTDVI
D0KY94_HALNC      ---DELRALNRRLEPDQDHSLHFHIAHSPLREVEILHDQLLAAFEA-DTSLK---PTDII
C1D6T7_LARHH      ---EPLPAEPHRLPLP-DHSIAFHVAHSPLREVEILHDQLLAMFDDPELALK---PRDVM
I3YAG8_THIV6      ---HERQALAVAIDPRTDRSLEFLIAHGPQREVEILHDQLLDAFERAAKSGAPLHPRDVL
C0QI08_DESAH      ---APDNESRRPI-ARGDRTITFQVAHSRQREVEILQDQLLHSFETLDN----LLPRDVV
Q5QUQ7_IDILO      ---QETREL-WPTPNTADKSLQFHVCHSPQRELEVLHDQLLDAFAK-DPELK---PRDVM
Q1QYD4_CHRSD      ---RARREGGPRRIAEDDESLSLVSAHSPLREVEILHDRLLAAFERAEAAGQPLRPRDII
B7J9Q5_ACIF2      --------ETCTALDDNDHSVVFHIAHSALREVQILHDQLLDRFATGK-----LQPRDVI
F9ZQ71_ACICS      --------EPGRTLAENDDSLVLHSSYGPLRELQVLQDELLLRLGRGRG----LRPRDIV
B1XZ24_LEPCP      ---PPLDAAAARQRAATDRSIEFHLCHSAMREVEVLHDQLLARLAAAKGS---LAPRDIV
F4HF17_GALAU      -------ASAILQYQEGDNSITLHVCHSPMREVEVLRDNLLAMFEQDPTLT----PKDIV
B8F7F2_HAEPS      -------TTFSLANE--DRSIQLHTCHSKMREVEVLYNQLLYLFETYPDLS----PKDII
A6VQ90_ACTSZ      -------KQQPLQPPKADRSVVLHACHSPMREVEVLHDYLLRQFQADETLT----PKDIV
C7LVF8_DESBD      ----------EEKTDFSDTSIQVHCCHSPLREMEILKDLILDLLAKDTSLS----PQDIL
F2JZ46_MARM1      ---LVATAEYRHTVAASDRSVQVHVCHSPLREVEVLHDQLLALFETNPDLT----PKDVI
A1S6U9_SHEAM      --ARYQSNEGKFLLDEQDNSLVLRSCHSPLREVETLHDHLLGLLSDRQGRLS---AKNIV
D6Z1F6_DESAT      PNPNNRLPEQAAGAVDHDHSIVIHACHSPLREVEVLQDQLLAMLDVEGYRP-----RDIV
E6WXK8_PSEUU      ------GAPLRATVALDDPSLQLHACHTRLRELQVLADQLRALFDDPRFDPPLQ-PREVA
RECC_BUCAI        ------FTRKKRFLEISDHSISINICFNKKNEIEVLYEKLLIFLNENSSIK----PGDIV
RECC_BUCBP        ---NNEQENNKILILKTDKSLSIHSCHTLIREIEVLHNNLLNILNDNNDILF----QDVL
Q8D2T9_WIGBR      -------KKNLRVLNSKDNSITIHTCKNKYEEINSLYNFIVKITKDNKKICF----KDIL
F8E602_FLESM      -------GKIIDTHKTEDESIIVNSCHSPMREVQVLYDYLLRFFDEDSNLT----PSDIV
Q480N8_COLP3      -----DDEAITPKAVQHDDSIVITSCHSALREVQALHDYLLHQFNQDKSLT----PKDIL
G4QGN0_GLANF      NADAEVIDEVTLCRPELDDSIIVRSCHSALREVQVLHDYLLQQFSADETLS----PRDVL
D7GDA0_PROFC      -----------GDPRAADESLQIHLSHGVDRQVEVLRELLCDLFDTHRDLQ----PRDVA
C7PDT3_CHIPD      ------QRHPIFPEDVEDGSITINNCYTVAREVEVLYNYLVHLVDKKRETLS---PRDIV
J9ZF24_LEPFM      --------AEFLERLPDDGSLRIVSSPSVVREVETLRDFLLDRFLAQPDLR----LEDVV
A5GU99_SYNR3      ----LPGIEPPLKLQRNQLNLEVLACHGDRRQVEAAHEALLRLMAGDPSIE----PRHIL
F8L520_SIMNZ      ------------QTLNQDRSILLHPAASKRREVEILFTTLLSLDFN---------PSDIR
A9BB00_PROM4      ---------EPLQRSLDDSSISFTECPGPKRQIQIVRDQILQQLALNKNLE----PKDIL
Q6MFB7_PARUW      ------EGKPPFNFERKDDSIQLHIAPSIRREIQILYHNLLKLFEKDSTLQ----PNDII
                                   :  : .  .    .::      :                 .: 

RECC_ECOLI        VMVADIDSYSPFIQAVFGS-APADR-------------------YLPYAISDRRARQSHP
F7XY37_MOREP      VMVADIERYTPAIQAVFGNDGNKQR-------------------YLPFAISDRRVRHIHP
Q1LST9_BAUCH      VMVTDINLYIPAIKAVFGN-ATTDR-------------------YLPFTIYDRTVKHTNP
Q5E7C0_ALIF1      VMVADINVYSAAIQAVFGN-AAFDR-------------------YIPFAISDQSAEQENP
C4L7B2_TOLAT      VMVADINRYGPYVQAVFGN-ATGER-------------------YIPFSISDRSATQENP
A8ZX08_DESOH      VMAPNMEVYAPYVEAVFDAGADDG------------------GQRVPYTVTDRRSKSGSP
Q2LTC9_SYNAS      VMTPEIETYAPFITAVFETVDEDAPG-------------LVDQPKIPYHIVDRATISGRP
Q3B473_PELLD      VMAPDIETYSPFITAVFGSAAEGR---------------------IPFSVADRRLMNEGE
B5EAR7_GEOBB      VMTPDIEAYAPYISAVFDNPEEDRK-------------------RIPYSIADRSLKNEGE
B8FB93_DESAL      VMAPDMDKFAPYVEAVFASPGPGGI-------------------RLPYCIAHKEVRTVSP
Q7NQR0_CHRVO      VLTPDINAYAPYIDAVFGRRDDAP--------------------NIPYSIADRRVEREQP
I1YH96_METFJ      VMTPDIGVYAPWIEAVFGSAKGDQ--------------------FIPFSITDYQSQSESQ
E8RCD1_DESPD      VSAPDIQRYADAVAGVFGAAGQER--------------------HIPWSIADRSLAEEQP
G4SZ17_META2      VMAPDIELYEPFISAVFDD--------------------------IQHAVADRSLRLSNH
M1P5P7_DESSD      VMAPDIQEYSGMIPAVFHD--------------------------IPHSIADRNPAQSNP
B0VLS2_ACIBS      VLVPNLAEVEPLIRSVFPATATEQ------------------GVHLPVKIAGIASLDALN
Q6FF17_ACIAD      VVVPNIKEIEPLIRSVFPATPSDD------------------GVFLPIKISGVVQLDVMN
A6W6P1_KINRD      VACPDVETFAPLVSAAFATD--SHP-----------------GGGLRVQVADRSALRTNP
H6N573_GORPV      VMCPDVETFAPLVRGAFGQSGLDHP-----------------AAALRVRLADRGLRHLNP
I0HVQ4_RUBGI      VVTPDLEATAPLVDAVFGTVPA--------------------ERRIPYAVTGRARSGQDP
Q60AZ6_METCA      VVMPRLEEAAPLIDAVFGTAPA--------------------ARRIPYAITGLRRTVANP
E1TB32_BURSG      VAVSDLAAAGPLIDAVFGTTPAGD------------------TRRIPYRITGLPPSQANP
E1SLX9_FERBD      VMMPDVSQYAPHIEAVFGQVE------------------RDDPRHLPFTIADRPQRGQQV
D0KY94_HALNC      VMVPDMSLYAPAISAIFGRFG------------------RDDPQHIPFSISDQAASGQVA
C1D6T7_LARHH      VMVPDISSYAPFIRAVFGKLP------------------PDHPRFIPFALSDQSAVSTEP
I3YAG8_THIV6      IMVPDIDPYAPHIEAVFGRLA------------------PDDPRHIPFHLSDQGQRHRNP
C0QI08_DESAH      VMTPDIEGYAPHIEAVFGNLS------------------LDDPRFIPFTIADHPGKKSVP
Q5QUQ7_IDILO      VMLPDVNTYAPYIDAVFGRYHNRFG--------------ERDPRAIPYTIADQGERHQRP
Q1QYD4_CHRSD      VMVPDIDRYAPCIEAVFGQLP------------------PSHPRHIPFTIADQVASEAHP
B7J9Q5_ACIF2      VMVPEIGGFAPLIRATFDQYD------------------REDRRYIPYHIVDLQARDEQP
F9ZQ71_ACICS      VMVPDIASYAPLVQAVFGVYG------------------KNDPRYIPFHIVDLTPQERSN
B1XZ24_LEPCP      VMVPDVEVYAPLVRAVFGQYP------------------ASDARHIPYDIADLRPRGHHP
F4HF17_GALAU      VMVADIDRYTPYIQAVFSQYQEED------------------KRYIPFSISDRKVTESDV
B8F7F2_HAEPS      VMSADIDSYAPYINAVFSRYEKE-------------------RRYIPFTLSDQKISYINP
A6VQ90_ACTSZ      VMVADIDRYTPYIQAVFGQYQRYTEDRIGKK--------RPDERYIPFSISDGKLSENDV
C7LVF8_DESBD      VMNPDIERYAPVIQAVFGTAGEDG---------------------IPFSISDRKPTKAAE
F2JZ46_MARM1      VMLPDVNRYSPYVKAVFSQKVFQNAGGHRASGSSIAQPQNRIGQSIPFVLIDQSGGLENP
A1S6U9_SHEAM      VMLPDVAAYAPFIDAVFASRRGE--------------------HYIPYAIADRGAVEESP
D6Z1F6_DESAT      VMVPDIETYAPLIEAVFRRPTGDRR-------------------YIPFRLADRRVSREAP
E6WXK8_PSEUU      VLAPDIDPYLPYLEPVFGRRGDPD--------------------AIPYALADTSPLANEP
RECC_BUCAI        VTSFSLDTYISSINLIFQSIDNKK--------------------TIPFFIAKKSSKTTEI
RECC_BUCBP        VISKNLDTYIPYINQIFNSASSKN--------------------FIPFSINYKNIKNIE-
Q8D2T9_WIGBR      VMASNIEDYSSYINSIFNNINY----------------------KINYFISDIKIYERFN
F8E602_FLESM      VMTPDIEEYAPYINAVFGSAAFDDV-------------------SIPYSISDKTLSGIYS
Q480N8_COLP3      VMCPQIEQYAPYVNAVFTRGWQDIA---------------GEVPPLPCSIADRSAKDSDP
G4QGN0_GLANF      VMCPAIENYSPYIEAVFGKSIAELNNTE--------------KQRIPCTIADRNPLDADP
D7GDA0_PROFC      VVCTDIRRYAPLLEADFQPADTPDA---------------HPGHALRARVAGPAAEQPNQ
C7PDT3_CHIPD      VMVRDIDVYAPYIKAIFNNAPY----------------------KFRYTIADESYADSDN
J9ZF24_LEPFM      ILAPETELYAGTIRAVFEATGEGGR---------------AGEPVLSVTVSDRPP-FEAA
A5GU99_SYNR3      VMTPDVARFTPLVLAVFERPGRSSD-----------------PRHLPVRVTDRTLRQRNP
F8L520_SIMNZ      IYAPDISSYAPYISLIFGAKES----------------------PFPFSIADLPREQESP
A9BB00_PROM4      IMTPQVEKFAHLIPSIFNDVSATGV-------------------TLPWKITDRSQYDQPG
Q6MFB7_PARUW      VMAPQISDYVPYIQSVFGLEES----------------------QLDFQILDLGMQAQSE
                  :           :   *                            .   :          

RECC_ECOLI        VLEAFISLLSLPDSRFVSEDVLALLDVPVLAARFDITEEGLRYLRQWVNESGIRWGIDDD
F7XY37_MOREP      VLSAFFSILELPCKHVDANQVLALLEVPALAARFAINEPGLRLLRQYMEESGICWGLDET
Q1LST9_BAUCH      VLSVFLRLLKLPFSRLTIEEVLSLLDTSVLAKHFSISQIDLTILRKWIVESGIRWGLDDD
Q5E7C0_ALIF1      VLLAFMTLMALPENRCGLSELLTLLEVPAVMSRFKFNAEQFEIVKRWAEETGIRWGLDNS
C4L7B2_TOLAT      LLQSFLTLLSLPDQRCTATELLELLAVPALLKRFGLAEADLTTLRRWAMESGVRWGLESG
A8ZX08_DESOH      VVRTFLGLMDLWESRFGISAVLEILESAFVRERFDIGEAEFFRISQWLVDAGVRWGLDGA
Q2LTC9_SYNAS      VLGGLLKILDLPLGRFAAGEVLSLLEVAAIRNRFGLTEADIDQVSRWVADSGIRWGIDER
Q3B473_PELLD      VSSAVLRLLELHRSRASAPELFDLLSSPPVARRFGLDVSALQSIRGWIVDTRIRWGIDEE
B5EAR7_GEOBB      AARALVAILGLCGGRYGVATVLDILESPPVARRFGLSGDDLENVRDWLRGANIRWGIDAS
B8FB93_DESAL      SVNAFLEIFDLCQSRFEAAAVLDLAGLPAVAEKFGFSEQDLETLARWIAQTRVRWGANAD
Q7NQR0_CHRVO      LLSTFAAVLKLADSRFAADEVLALFDCPALLARFDLADADLAFIQDWVRDAGIRWGRDAA
I1YH96_METFJ      LIQTFLSLLQLPSSRLDVEMVLSALACPAVQKQFLLDETAIEWVRTWCRHTHIRWGFDQQ
E8RCD1_DESPD      LIRCWLDLLELLGGRFTAPEVLALCESPAVLRRFGLDPALLPRLHVWVGEAGIRWGLDAD
G4SZ17_META2      ALDAFIVFLKLSQSRFGWRSVLDLLEKPSVYPGFGLSETDLELIKHWVRDTQVRWGKSAE
M1P5P7_DESSD      FLAVYLQFLSLCSSRFGWSEVLDLLGRKEVYPRFDIHEDELELIRHWVVSSGIRWGLSGR
B0VLS2_ACIBS      AWRAVIGRIHLMQGRFSFDEFADWLGLHATQQRYALEYAQVERILTLLADAGFKRGLDAE
Q6FF17_ACIAD      AWRAVLGRMTLLQGRLSYDDFADWLSLPATQVCYDLEDSQIKRMLALLAGAGFKRGFDIH
A6W6P1_KINRD      LLGLAVRLLGLAQSRAGATEVLDLAAAAPVRRRFDLDDEDLEQLREWTVAAGVHWGLSAR
H6N573_GORPV      VLDVVATVVELAVGRITAGQVTDLLTREPVSRRFAMSDDDLDWVREWLSRSGIRWGIDET
I0HVQ4_RUBGI      AARALLALLSLAASRVAASELFALLQQPAVARRFGLDEAALERLHGWLLASGLHWGLDAT
Q60AZ6_METCA      AAAALLTLLGLFASRCKASAVYEFLQRPLVHARFGLGLDDLECIHDWFQAAGIRWGLNGA
E1TB32_BURSG      VARLLLDWLALPERSVGAPDLIEWLRVDAVAVRYGIDAGSLEAAQEWLAAAGARRGLAPQ
E1SLX9_FERBD      LVLALERLLSLSQARFTVSELLDLLAVPALRARFGIDESQLPLLQRWVEDAGVRWGLDAA
D0KY94_HALNC      LINALEQILNLPTSRLLRSELLDLLGSPLLLARFGISETDLTTLHDWIDSAGIRWGLNAQ
C1D6T7_LARHH      LLRALQQLLDLPALRLTVSEVLELLDVAAMRRRFRLRETDLPLLTRWIEGSGIRWGLSAA
I3YAG8_THIV6      LLIGLETLLNLPRSRFAVSELLDLLDLPALRERFGIDEADLPRLRQWIGGANIRWGLDAP
C0QI08_DESAH      LVKALERLLHLPDLRMAARDLMDLLEVPAFQRRFGFKETDLPRLFQWIKGAGISWGLNKS
Q5QUQ7_IDILO      LMIALELLLQVDQLRFTQTDLFNLLSVPAVQQRFDMSDDDLPQLKRWVKEAGARWGLNAE
Q1QYD4_CHRSD      LMALALLLLELPERRLTVSEVLDALEVPAFRTAFAIDEAELERLRQWLAGSGVRWGLSAE
B7J9Q5_ACIF2      LLLALDWLLRLPEQRCRQSEIRDLLNCPALRRRFGLELEDLPIVQHWLAGAGWRWGLSAE
F9ZQ71_ACICS      LIRVLVWLLGLPQSRVTQSEIRDLLDCSALQRRFGLAAEDLPQIHTWLEQGGWRWGLSAA
B1XZ24_LEPCP      LLLALEWLLRITEQRCTASELRELIDVAALANRFGLEGDDLPTLGRWLDGAGVRWGLDAE
F4HF17_GALAU      LIATFLQLFTLKESRFSSDIVLSILDVPAIRQCFEIDLGELQTIRDWVTQSGIRFGLDKY
B8F7F2_HAEPS      IIASFLQLLSIKENKFSAEEILDLFDISAIREKYQFNEQKINTLREWIKSVGIRSGLKIE
A6VQ90_ACTSZ      LLATYLSLLDLKNSQFSAEEVLAFLDVPAIREKFEIALSDLPQIRHWVARVEIRFGLDKN
C7LVF8_DESBD      TIRLFLELLEFGQHRFEASRVCALLEAPPVRQRLGLDASDTQRVLEWVRASGVRWGLDLD
F2JZ46_MARM1      VVDAFLYLLGLGDSRFTLSELISILEVPAVMAKFDLTVEELERVRQWATEVGVRWGLTEE
A1S6U9_SHEAM      LIHGFLTLLDINHSRFGLSEILGLLEIPAVMAKFKLDEEELSRLGNWLSEAGVRWGRDAQ
D6Z1F6_DESAT      LLDALLNLLDLARGRLPLSQVLDFLAREPVRQGFGLDGRQLQRLEQWLEQLRVRWGIDEE
E6WXK8_PSEUU      LAGVFLRLLALPVSRFGLHEVLDLLASPAVAEANELDAPALERLRSWLSAAGARWGIDAA
RECC_BUCAI        MLWSFKKILNLSNSRFENEEILELLDVPEIAEKFNFSEEEIKILYHWIEETNIRWGINEK
RECC_BUCBP        FYKTILELIDLPNIELNINKITNLLNIPTLLKKVQINEQEIPILLQIINQTEIQWENDNI
Q8D2T9_WIGBR      IISAIFNILKLPKFKFSIEQIFYLLEFSSISNKFKMKEDEIKMLKYLVINLGVQWGISNK
F8E602_FLESM      SVQLFTSFLQISSGRLKFSDIFQFLEKEIVYTKFGLTPPDVEMLKSLCKSSVMKWGWDSD
Q480N8_COLP3      LVAAFTELLTLPDSRFGVSQLLSFLRLPAMANNFSINGEDLAKISAWLEQATVHWGLDLT
G4QGN0_GLANF      LVAAFMQLMSLPDSRFSVTEFLSFVHLPAVMQKYSIKTSELDLFAYWVKQSNIHWGLDAE
D7GDA0_PROFC      VLELLVGLFGLPVSRATGQDLVDLCSLPPVAARFGFDEDGLAGLPELLARAEVRWGVDGS
C7PDT3_CHIPD      LFNALHAILRLNEDNFKAEEVLQLLDSSYVRKRFGIN--NVPLIRHVVDEANIRFGIHGA
J9ZF24_LEPFM      LADALVGLLRLPVFPLTLSFVQRLLSFQTVLDRFSLDRKMASELLEALARAGFRWGVDKQ
A5GU99_SYNR3      RVDLVFRLLALASSRLSRDDVLDVLLLPELAEHLELGGLTQPQWRELLDQAGICWGRDGD
F8L520_SIMNZ      LLQAFLNLLMLKQNRFNKTAVLKLLSSPPVRQKFRLKEKDVEAFGDWMEKGGVKWGMDRQ
A9BB00_PROM4      LTQCIILLMEIACTRLTASNLDQLLTNPVIKDLYKLDDSEIDKITNCLQETGFRWGINSL
Q6MFB7_PARUW      IVQGFFQLIRLSESRWEVSELLQLFGHRLFQRCHQLTQSDYYLIQEWIQQAGIRWGEDWL
                          . .         .              :                        

RECC_ECOLI        N---------VRELELPATGQHTWRFGLTRMLLGYAMESA-----------------QGE
F7XY37_MOREP      L---------LSEL-MYATGQH--------------------------------------
Q1LST9_BAUCH      T---------QRDLMLPTTSQHTWEFGLNRMLLGYAIDSS-----------------NGI
Q5E7C0_ALIF1      T---------SAQFDLPEHNQNSWLFGIQRMLLGYAMEQG-----------------AGL
C4L7B2_TOLAT      D---------GERFELPPRERHTWSFGLERMLLGFASGN------------------ETL
A8ZX08_DESOH      F---------KTDRDLPEFSENTWKQGIDSLVLGCAMAGKGEI----------------L
Q2LTC9_SYNAS      S---------RLREGLPEIATNSWQWGLKRMLLGYALPARNNE----------------L
Q3B473_PELLD      E---------RSMNQLPAFRQNTWRAGIDRLLLGYAMD-SRES----------------C
B5EAR7_GEOBB      Q---------RAEHGVPPFSENSWAAGLDRLLLGYAMNGDGRS----------------F
B8FB93_DESAL      S---------RKALGLPATGDNTWESGLDRLMLGYAMAGLDEE----------------F
Q7NQR0_CHRVO      H---------KASLGLPAEAAYTWRWGLDRLLLGTVLPPALAGD------------DAGL
I1YH96_METFJ      D---------KQRLNLPATDANTWRAGLNRLMLGFAMPLTVPNQ------------PVRL
E8RCD1_DESPD      H---------RRELGVPTGEPHSWRFGLDRLLLGYLMGESP-----------------VP
G4SZ17_META2      H---------KRELGLPELDENTWQAALGRLLMGYAVGTDDDF-----------------
M1P5P7_DESSD      Q---------KRDMGLPGKNECTWESGLDRLLMGYATAESGD------------------
B0VLS2_ACIBS      HL-------KRSLCDGDDDYRYSFKFALERLALGIAIP------------------EHAT
Q6FF17_ACIAD      HL-------QQSLSAEDHDDRYSFKFALDRLALGIAIP------------------EHTL
A6W6P1_KINRD      H---------RGAWQLGSLDQGTWRAGLDRLLVGVAVGGAVEDDLVGR------TGEDGL
H6N573_GORPV      Q---------RKRFGLSGFGQGTFSAGLDRVALGVVAE----------------EDDGEW
I0HVQ4_RUBGI      H---------RAGFDLPAEARHTLADALDRLFLGHALP----------------AGAESP
Q60AZ6_METCA      H---------RKAVGLPEVERHSFCDGLDRLFLGYAL-----------------GDVPVQ
E1TB32_BURSG      E---------PSGEHVP-VPRHTLADALTRLYLGYAMP----------------DGGE-P
E1SLX9_FERBD      Q--------RATLDLPDNLDQNTWAFGLKRMLLGYAVG------------------QGDA
D0KY94_HALNC      H--------REAFGVPPGMEQNTWAFGLNRLLLGYLSGD-----------------ENAI
C1D6T7_LARHH      Q--------RAELGMPDDFDQNSWHFGLDRMLLGYACG------------------AGAS
I3YAG8_THIV6      Q--------RASLGLPAGLTQNTWGFGLQRMLLGFATG------------------QSGP
C0QI08_DESAH      Q--------RASFGLPPDLDQTTWAFGLNRMLLGYAVG------------------NNKA
Q5QUQ7_IDILO      Q--------RAQFYMPAAEETNSWWFGLKRMIAGYAMGDL----------ADVNLENDSP
Q1QYD4_CHRSD      H--------RDSLGFPALGE-NSWRFGLSRMLLGYAVGEPSAGGARDDSEDSLGHAPSGD
B7J9Q5_ACIF2      H--------RAALGMPHCGSQNSGDFALQRLCLGYASGDD------------------SH
F9ZQ71_ACICS      H--------RADLGFAACGAPTSGAFALQSLLLGYTNGSD------------------SH
B1XZ24_LEPCP      H--------RASLDLAACGEANTWAFGLRRMLLGYAVGDDP------------AATPGEP
F4HF17_GALAU      D-------------QEPVPNYNAWQNGVERMLLGYALKSES-----------------GI
B8F7F2_HAEPS      N-------------PE-WQNYNSWENGLNRLLLGTSLKAEN-----------------NG
A6VQ90_ACTSZ      C-------------DSAVKNYNAWQAGLERLLLGYAMRESQ-----------------GI
C7LVF8_DESBD      F---------RRKAGLGDFGQNTWESGLSRLYLGYMTGAAD------------------P
F2JZ46_MARM1      T---------ATQHDLPKQTIHTWHHGLKRMLLGYSVGHDH------------------I
A1S6U9_SHEAM      S---------REKLGLPAFDKHSWAFGIRRLLLGFSLGDEG-----------------DF
D6Z1F6_DESAT      H---------RRRHDQPPDRQNTWRFGLDRLILGYALPGED----------------RYL
E6WXK8_PSEUU      H---------RARLDAPEDDAYTWSFALDRLLLGHASGSDEP-------------VLLDD
RECC_BUCAI        H---------KNYLLFPKNKQNTWFYGIEKLLLSYAMNDTE-----------------KI
RECC_BUCBP        L----------SNDWLSNDITKCWEHGLQRIFLGQIINNID----------------YKF
Q8D2T9_WIGBR      R---------FKKCNANFEEKYSWNNIIKKTVSEYYTRINN-----------------KV
F8E602_FLESM      I---------AESFNLPYYEYFTVSKGIDRLLLGSAVLAYEW----------------SS
Q480N8_COLP3      H--------KQSLLGQQANASFTWQQGLSRLLRGFAYADSE-----------------QI
G4QGN0_GLANF      HK-------SVILGVDKANDVFTWHWGMSRLLEGFSHADNDLL----------------I
D7GDA0_PROFC      Q---------RARRGLSGVRQSTWVAGVDRLLAGLVMADEPP----------------AR
C7PDT3_CHIPD      K--------------EDETYLVSWKYGIKRIMYGICMSGDQEYG--------------KG
J9ZF24_LEPFM      D------------RTRDEPEDHTLDWAVSRILEGYCTGIEEQ----------------GL
A5GU99_SYNR3      H---------RQSWGYPAGDAFSWRWGLDRLLLGLELSDGFPEQ----------EAASGE
F8L520_SIMNZ      HRKFL----LQGREMHEQGEVGTWEDTFKSLLHGFTTLPKD-------------------
A9BB00_PROM4      E--------------RDGEETHTLNWCLERWLVGMVIP---------------------T
Q6MFB7_PARUW      HRNELLQRHHCEKEMVDSSSVGTWNFGLTRLLLGLTTVVKSAD---------------SH
                                                                              

RECC_ECOLI        WQSVLPYDESSGLIAELVGHLASLLMQLNI-----WRRGLAQERPLEEWLPVCRDMLNAF
F7XY37_MOREP      -----------------IRQLAELLMQLRK-----WRDLLAQPRSIAAWINYICEIINDF
Q1LST9_BAUCH      WQGILPYDESSGKRAELIGNLAELIMRLRR-----WRKNLKKPRKLTEWLHCASDMIKDF
Q5E7C0_ALIF1      FEGMASYEQVQGMNAEIAGNLAQFIDQLLT-----YQIILGQPHAITKWRTTINQLMDDF
C4L7B2_TOLAT      FADVAPYTAIEGQNAVKLGQLARFIAQVMA-----LRDELETARPITEWQNLVDRLLLDF
A8ZX08_DESOH      FDGLLPYDHMEGSDVDSLEKFLAFWHVLLR-----FYRQCGGAHAPGRWRQILTALVESM
Q2LTC9_SYNAS      FSGIMPCETAEGSEARLLGILAEFTERLFL-----TAESLSQDRTLSDWGSLLDDISDRF
Q3B473_PELLD      CEGILPFEGVDGGAAETIGLFADFIDAVDR-----FRHGLSKTRTLEEWRVFFISMLEHF
B5EAR7_GEOBB      YNGILPYDDMEGGVALSFGRFLTFCEKLFA-----QTGALSRPRVPSEWVPALRQILDDF
B8FB93_DESAL      FQNISPFGDLAMEDAPLLGRFAEFTEALFQ-----LSRKLEKSHEIQEWVKILEGVVQEF
Q7NQR0_CHRVO      FAGLLPYTAAQGQLGETLARFAGFYDALDA-----LADAWSQPAAPQQWAQRFHQACDRL
I1YH96_METFJ      FDGELGLDGIQGEKATVAAALCAFIEKLNL-----WREVLDKPQTILDWHSHLNHCLDTF
E8RCD1_DESPD      FAGRQPYGPLAGGEVNELGGFASLIDTLDH-----WRRTLRAERPVAAWCDELLALLADV
G4SZ17_META2      VDGVLPYIDIEGSSALALGGLNDFMQLLFR-----AGNDLSMAKSLKAWGEKLYYYADQL
M1P5P7_DESSD      VDGILPYPDIEGGMAAALGGLSFFCDLLEQ-----AAQQFAGLHSLGEWAVLLSGFADRL
B0VLS2_ACIBS      FNQVLSYAKVQPGDFELIGTLIQIYQDLNERRDWLIMHEQKKSHTVEYWLQILSQDIIEY
Q6FF17_ACIAD      FQGVLSYSGVTPDDFELIGKLIQIYQDIDARRNWVLAHEQGTQHSVEDWLKILMQDVIEF
A6W6P1_KINRD      LGAVVPLADVESSRIDLAGRFAELLDRLDA-----AVTRLQGRHGVAAWCDTLLDAVLDL
H6N573_GORPV      LGAALPLEGVESTQIDLAGRLMEFVDRLGA-----LVVRLSGSASAADWAESLIAIVDEL
I0HVQ4_RUBGI      LPGLLPAGDAEGSAAATLGAFWRYAEALRW-----LQAESARPRPAAAWARLLHAALDRF
Q60AZ6_METCA      FDGRLPAGSPEGSEALALGGFAHFVDLLTH-----WHRVWSTPATAQTWGERLNAVVGAF
E1TB32_BURSG      VDAWLPVAGADGSDAELLGRLSRFVDDIDA-----FATRCASEQTPAQWTQLLLDTLAQC
E1SLX9_FERBD      WAGIEPFEEIGGLDAALVGGLARLLDKLEG-----FWTQLGQSHTPAAWAQHLRRLCAEL
D0KY94_HALNC      WDEIEPHPVMDGISAELVGKLAQLVQQLDK-----YTQRLSEKCTPTEWVARLRRLMTDF
C1D6T7_LARHH      WQGMAPYDEVGGMDAALAGQLADLLSTLAH-----WRQCLQEPATPAGWQARIAALAEAC
I3YAG8_THIV6      WQAIEPYDEIGGLEAALVGPLVQLLETLER-----YWRQLQIPRAPDAWTALIGELLDDA
C0QI08_DESAH      WHNIEPYDEIGGLEAHLVGLVAGVVERLEA-----LWTTLQSSACPERWCLILRTLARDF
Q5QUQ7_IDILO      WANVEPYTEVAGLSAALVGCLADVVRTLEQ-----WWQRAQGEHSLPEWVTQGEWLLEQF
Q1QYD4_CHRSD      FQGIVPYAEVGGLEADLAGRVATLLSTLEQ-----QCAALGERLTPMAWLGRLQALFAAC
B7J9Q5_ACIF2      FSGIEAYGEVGGLDAALLGPLGQLLEKLAH-----WQHVLGESLVPEHWGEAARNLLTDF
F9ZQ71_ACICS      FDGIEACAEVGSLDAALLGKLWVLWERLES-----WRERLKEATTPEHWVERARQLLADF
B1XZ24_LEPCP      WHGIAPYAEVGGLEASIAGALAELVEALQR-----WWREARTAATPADWDARARALLAAF
F4HF17_GALAU      WQDAIGFDYSEGLQGKLAGKLAHFFHALQQ-----WQQKASQNLMAEEWRIAILQLIDTL
B8F7F2_HAEPS      WQNILAFDESYGLISELTGNLAKFIDNLTA-----WHAFICQPQSLSAWQEQLFTLVAQT
A6VQ90_ACTSZ      WQDSLGFDDSDGLKGQVVGNLAAFLDRLAQ-----WHTFLQQSHSIEKWQQNLTALLTDF
C7LVF8_DESBD      LGGIAPLALRGSAEQELLGRVTAWIDELAT-----LWSRLRDTRTPADWQDCLLWILDAF
F2JZ46_MARM1      WQDILSYGDIEGLEASIAGKLADFLDKLQA-----SATHFSQSQSPEGWISTLNALLADY
A1S6U9_SHEAM      YHGTLPFAGVEGQQAQCVGKLLDFIEHLDE-----FAARFAAADSLTLKFAELSRLTDTL
D6Z1F6_DESAT      VAGILPFDDIEGQDAQLAGVLLQFSQALFS-----LVDEVREAKTMARWVELVRRAMAAF
E6WXK8_PSEUU      GQVVAPMPELEGSAIDALDTLVRLLRVLAL-----HERVLGGALAPAQWRERLLQLLVSL
RECC_BUCAI        WNGVLSCSFINGSRSELIGKLISFIKILEK-----WQKKLSKLQYLTYWRSLYSDLVSDF
RECC_BUCBP        WENIVPYNEFSTLYYNIFNKLISLISLLNK-----WKKILSKPKFLSHWDITFKKLLNDF
Q8D2T9_WIGBR      YFKYIYSNDLDEKKINSLIKLENFISKLNY-----WYDYLSQPHLLYEWNDVIKKIIKNF
F8E602_FLESM      FDDIVPSVSVEGENFEILGRFVKYVYTVKR-----YRDILGKNYSAEEWLDILNNLQQDL
Q480N8_COLP3      YQQQLLLSNVEGSDSILLGQLMLFIEQLHY-----FSENLQRSRTAIQWQTFLLEQLSHL
G4QGN0_GLANF      DDRLLALNEIEGQLAVTFGKLLHLLEKLAS-----YGDSLKRLRTMEEWKAFLFDMKDSL
D7GDA0_PROFC      LDTVVPVEHLDAGDADLIGGLAEFVSRMRM-----HLLEFAQPCGMAQWRTRILDAIADL
C7PDT3_CHIPD      EEGFFPLDILEGSDSLEVIRFCHFAEVLIS-----AIEDRKKERSISGWVEYIEGILHNM
J9ZF24_LEPFM      VFPVSPFVLPDDPQGEKAGILFRLLDLFRS-----WRDRLSGRHALSAWAESVSALLSDF
A5GU99_SYNR3      WGGLAACNQSLATANDVLALHDACSRLFEQ------LQALSGPLPAERWNEQIGSAIQQL
F8L520_SIMNZ      -RPAWEKPILDFSDAATLGTCVSIVRSLEKE----LSFLETASLSLAEWSEKLRFLLNRY
A9BB00_PROM4      IPGLVLGGIAPFSKGISISELSKWWEILSKICN--MLQGLRQSHSCMKWGLVLKGLCDDL
Q6MFB7_PARUW      SFDSIPCEGIDFSQAELMERWIRLLHSLRDD---LSPLHDRSQMCMEEWSCYLSCLLDTY
                                             .                                

RECC_ECOLI        FL--PDA---------------ETEAAMTLIEQQWQAIIAEGLGAQYGDAVPLSLLRDEL
F7XY37_MOREP      FM--PDA---------------DAEAALALLANQCQQVLKCCLQVGYNQPVPVTILQYEL
Q1LST9_BAUCH      FV--TNVN-------------KEVETALVIILDQWQQILQCGIKANYDQPVSIARLYDEL
Q5E7C0_ALIF1      L----DVE-------------LEGELVVKSIRDQLQKLEENLEDAGFDAPISAPIINNYL
C4L7B2_TOLAT      YLPQEQLE-------------EDDAAALNLIRSTLQSWQQRLSQMQYQEPLPLTVFHDHL
A8ZX08_DESOH      FAADPAVE-----------ADLQVITDA------LNALGESAAHAGFDGPVDLPVIREFL
Q2LTC9_SYNAS      FLGDEDSE-----------PDIRNLRQL------ASDLKNLQEKTGFPEKISLAIVRSFL
Q3B473_PELLD      MLTEEDST-----------REFLAVQDL------MERMGEISRLSAYHDEVPPEVVIAWL
B5EAR7_GEOBB      ILPDQEGE-----------REFLLLIEM------AKKLGEFPAAAGFEEEIGIEVVRYWV
B8FB93_DESAL      LSPDAE--------------DLHLLQIA------LSKTAKAQSEQGYGREVAAAVVKAAV
Q7NQR0_CHRVO      FLAEGDDE-----------AALELLREA------LAELAENADLAGFGQPVGLAVARDWL
I1YH96_METFJ      FDTSGRDEQQLD-------AELMAVRKQ------LDKLLESADQASFADEVGIELMHSWL
E8RCD1_DESPD      FAAEEDDP------------GLLHLSQA------INDCRTDCRLARHDAPIPLAVIKAYL
G4SZ17_META2      LPEADAVE-------------RQQLNEL------LAELTERLPEI-HNAPIEWQVVCAWL
M1P5P7_DESSD      FVTENNDG-------------LVELYGV------LTDLGQEYGNV-HQKGVSFEVIRSWL
B0VLS2_ACIBS      EQAGVAAL-----------KTAREIVKKQERMLTLASYYAETETGTLRKITLPLPYILDE
Q6FF17_ACIAD      EQAGVVAL-----------KTAREIIKKQERMVTLASFYADKDAHTLRQIALPLPYILDE
A6W6P1_KINRD      ADTAPEDA-----------WQVAQLRRE----LGVVAHDAARA---GTARVGLTDVAATI
H6N573_GORPV      TETAPGDE-----------WQTAQAHRS----ITEALACDTEDPPKGERLLRLSDVRDLV
I0HVQ4_RUBGI      VAPAGDEL-----------PALRELRGT----IARLADDVASGAG--ATTALPLAVLRRA
Q60AZ6_METCA      LMETPETV-----------PDLQEVREA----IAALSRHWGEAA---VTGTIEPEVVRVA
E1TB32_BURSG      FDGGVEFA-----------ESLAALRDA----IDKMSDAMQAGA---REVTMPAAVVRGA
E1SLX9_FERBD      FRPQDEE---------------ETVILARLDEALAQWLEACEQGG-STDPLPITVVREVC
D0KY94_HALNC      FSLSDTQNHLDSPE-----IQIEMDTLARLHNELERWLADCSVAG-FENEIDIETVRHAW
C1D6T7_LARHH      LDIKDEH---------------DLLLYAGIADTLDNWVATLDGNGLADTRLPLEVVRDVL
I3YAG8_THIV6      FAADGET---------------DLLAIAQVQQALERWALDCRRGGARAETLPLEVVRDAL
C0QI08_DESAH      FEPVDAS---------------ERLVLNRMDQVLDDWLNACTQA-DLDQELTLCVVRDYF
Q5QUQ7_IDILO      FEAEEDS---------------DRLLLAKLSDELYQLRDICVEAD-NESQLRLPIFKDAW
Q1QYD4_CHRSD      LQPGTAD---------------EHDVMARLDAALARWAQQCRHAD-FEEPVGLGVVRDAL
B7J9Q5_ACIF2      FSASDDD---------------DEALLQNLEEALRQWQTDCAAAD-FNEALPLAVFRGAW
F9ZQ71_ACICS      FVASDTA---------------DREALEQLESALEDWLLQTEKAA-WDGPLPLEIFREAW
B1XZ24_LEPCP      FRPATED---------------ERLLLAALHDALAQWREACDEAG-YAEAVPLAVLREAW
F4HF17_GALAU      FNVGEQPI------------VIALLKQT------VHQVIDIINEADYPQTIDTEIIGELL
B8F7F2_HAEPS      YQENDQSID-----------AILTLQQA------IRDVIEQIQQSHFEEAIGIDVMLELF
A6VQ90_ACTSZ      FVADEQTVD-----------IQQYIRDA------VRSVTELLRSMDFQEDISAEVMAEVM
C7LVF8_DESBD      FPQDPAQA--------------EHLLAI-------RKAVTDLTRDMGDFEADARTMLYLI
F2JZ46_MARM1      FELTDEDP------------------FRSLFTRHLNTLQEEWQGANFHDDIEFPVIREVL
A1S6U9_SHEAM      FAPLPEYQ-------------EELNLIRETLCDTQKALQSSASSESSLSDISLEVICQTL
D6Z1F6_DESAT      FAPEERAA-------------AGEQWQRQSLRDALVALLQESERAGLERPLELAAFLRLL
E6WXK8_PSEUU      LPKPPSDP--------------KTQRALDRLRSLVDAFAQTAKDAGYEAPVPSEAVRAHF
RECC_BUCAI        FQNNTKIE-----------------KSIQIIQKKWIEIIDDSLSSNYLKKISINILKKIF
RECC_BUCBP        FTDHEQKQ-----------------PEAKLIIKKWTEIIHSGMQEKYTKKISITLLKNEL
Q8D2T9_WIGBR      FDPDKKEN-----------------YVLDLLKKNWNDIIFQGINTKYKKTIYIETLENIL
F8E602_FLESM      FSGTADND-------------------GLQEINNGIRAFGTYTAGIISEELPAYVVAEFF
Q480N8_COLP3      FSRVDADNVS-------------NENSLMVIEQAIAGLVEHCHHAHFEDDISLLIVVDYL
G4QGN0_GLANF      FDASTVEQYASQTITKTLGQFFEHYQMSLFDKLAPNVAADASNDAEVQRQWSYQTLRQAL
D7GDA0_PROFC      TDPDVAEQ-------------------WQVNHIAQELDRLSAGAGTGSTALSAADISAML
C7PDT3_CHIPD      VYEPEEE------------------IDEDYNTLMQQLSDYNLLNEYMSDTVAFDVFSHSF
J9ZF24_LEPFM      FVLDPDRD--------------------RDLFALGQSLRELCRDIHDVEDMDCMMVTEML
A5GU99_SYNR3      SGGDDEGW---------------------QAPEVYELLTPLRDPEASGLALDRAAVVRLL
F8L520_SIMNZ      FEVDEKE-------------------LSTFKWVEEKFALLESKALPKDSYPFLPLFEFIK
A9BB00_PROM4      CNNDRKWSWE-------------------RQRFLRAIDDWIRAADCFKKEIKIEVVAEIV
Q6MFB7_PARUW      FKCEFEDS--------------QSIADYEELKSQFKLLGDSAKTFKETKFSFQTIKFHLN
                                                                              

RECC_ECOLI        AQRLDQERISQRFLAGPVNICTLMPMRSIPFKVVCLLGMNDGVYPRQLAPLG-FDLMSQK
F7XY37_MOREP      AARLDQEQLSQQFLTGTINFCTMMPMRSLAFRVICILGMNDSVYPRSIQPAW-FNLMAQQ
Q1LST9_BAUCH      NMRLQQKHLNQSFISSNIIFCTIMPTSSIPFKVICLLGMNDGIYPHSILPLN-FDLMKQQ
Q5E7C0_ALIF1      KNNLSGGKASQRFLAGQVNFCTLMPMRSIPFDVVCLLGMTDGSYPRTMPVEG-FDLMQKR
C4L7B2_TOLAT      QSELNAVRGGQQFLAGRVNFCTLMPMRAIPFRLVCLLGMNDGLYPRSMPPLG-FDLMADQ
A8ZX08_DESOH      NRRFEGQAYGAPFISGGVTFCSMLPMRSIPFAVICLLGMNVDDYPRQTFSPG-FDMIRKH
Q2LTC9_SYNAS      QDRFQATGADGGFLSRGVTFCSLLPMRSIPFRVICLMGMNNGDYPRRPQTPS-FDLMARH
Q3B473_PELLD      QGRLQQKEQGLGFMTGGVTFCSMLPMRSVPFRVVVMLGMDDGAFPRQQHPPG-FDLISRH
B5EAR7_GEOBB      EQQLGASKRDLGFLTGNVTFCAMLPMRSIPFPVVALLGMNEGEFPRRNPPQG-FDLMTRE
B8FB93_DESAL      AGLLEQSSPSGSILRRGVNFCSIAQGAGIPAKVICLVGMDDGAFPRQDGGMG-FDYMARS
Q7NQR0_CHRVO      LRKLSS-SSAQGFLSGGVTFCAMVPMRSIPFQALCLIGMNDGAYPRDERPVS-FDLVARN
I1YH96_METFJ      SSHLEELNGAERFMGYGVTFCGMVPVRSIPFDVVCLVGMNDADFPRRQPGLS-FDLLTQD
E8RCD1_DESPD      QETLSRSDGGQAFLSGRVTFCNMVPMRSVPFRVICLLGMNDQDFPRGQHPVS-FDLMAAE
G4SZ17_META2      EGRLEEHKSSNGFLRGQLTFCSMLPMRSIPFKVIALLGMNDGEFPKVDRNPT-FDLLAAN
M1P5P7_DESSD      QGAVEEKRSSAGFLRGQLTFCSMLPMRSIPFQKVCLLGLNDTVFPKNDFHPP-FDLLGEK
B0VLS2_ACIBS      IQRTLENQTAQAEPTGQITFAQIGQIRPLPYRLIVMLNLDAGQFPNRDTHVP-FDLMDAL
Q6FF17_ACIAD      IQRTLEHQSAQAEPTGQITFSQIGQIRPLPYRLVVMLNLDTGRFPNRDSHIP-FDLMDAL
A6W6P1_KINRD      SERFAAHPQRANFRTGALTVCTPAPVRAVPHRVVCLLGMDDGAFPRAGGPDA-DDVLARD
H6N573_GORPV      AMMIAGRPTRANFRTGELTVCTLVPMRSVPHRVIVLLGVDAEAFPRALRVDG-DDILGRV
I0HVQ4_RUBGI      LEARLDDPARGGVPSGTVSFSAMSSLRGLPYRVVCAVGLDDGAFPTTARPPE-FDLIALA
Q60AZ6_METCA      LESLLDDPARGGTPSGRLTFTAMASLRSLPYRVVCVIGLNDGEFPHPDRPAE-FDLIAQA
E1TB32_BURSG      LAEALDDPARGGVPWGSVTFSSLTSLRGLPYRVVCLLGMDDGVLPSLARADE-FDLMAAF
E1SLX9_FERBD      LSPFGEEGVSQRFLAGKINFGTLMPMRAIPFKQVCLLGLNDEDYPRSRPAMD-FDLLAAA
D0KY94_HALNC      LNRLEPHRLHQRFIVGGVNFATLMPMRAIPYRHIYLLGMDDANYPRRQTPND-FDLMNG-
C1D6T7_LARHH      LGQLADTSVSMRFLGGAVNFGTLMPMRAIPFKVICLLGLNDGDYPRSQNRAD-FDLMAQ-
I3YAG8_THIV6      LSALDEPTLTQRFLAGAVNFATLMPMRAIPFRQIWLLGMNDGDYPRNRRPAD-FDLMAND
C0QI08_DESAH      LEKMAVQGVSQKFLAGMVNFGTLMPMRAIPFKVVCLLGMNDGAFPRSHPPLD-FDLMAEP
Q5QUQ7_IDILO      LERVDQQNLNQRFLAGAVNFATLMPMRAIPFKYVCVLGMNESDYPRSTPRVD-FDLMTDR
Q1QYD4_CHRSD      RAELDEGGLAQRFLAGKVNFATLMPMRAIPFREVYLLGMNDGDYPRVRQPQD-FDLMATR
B7J9Q5_ACIF2      LEMLDAPDLGRSFLGGGVTFCTLLPMRAVPYPLVCLLGMNEGDYPRRSPRPD-FDLMALP
F9ZQ71_ACICS      LDGLESAGDG-AFLGGGVTFCTLMPMRSIPFRMVCLLGMNDEDYPRPDPRRD-FDLMTLP
B1XZ24_LEPCP      LGTVDEPGLRSRFLAGGVTFCTLMPMRAIPFQGVCLLGMNEGDYPRRGVRSD-FDLLAAP
F4HF17_GALAU      QQKLNEQDNSLHFLLGKLNFCTLLPMRAIPFKVICLLGMNDVDFPRQLPNNS-FDLMQYQ
B8F7F2_HAEPS      TQQLSEQRSHLNFLVGKVNFCTLLPMRAIPFKVVCLLGMNEGEFPRQQTINS-FDLMQYA
A6VQ90_ACTSZ      TEKLNDNPNSLKFLVGKVSFCTLLPMRSIPFRVVCLLGMNENDYPRRRTPNS-FDLMRYH
C7LVF8_DESBD      RKRLDESGGESGFLASGLTFCGLKPMRSIPFRVICLTGLTSTAFPRQDIPLG-FDLMAAR
F2JZ46_MARM1      APRLQESSGSHRFLAGRVNFCTLMPMRSVPFKVICVLGMNEGDYPRNAVPMG-FDLMVGD
A1S6U9_SHEAM      GSKLTDARVGQRFLAGSVNFCTLMPMRSIPFKVVCLLGMNEGIYPRVQHPVG-FDLMAKT
D6Z1F6_DESAT      RARLDEAGMAAGFLEGGLTFCTMLPMRTIPFPVVCLLGMNDGDFPRQDNPAG-FDLLAAA
E6WXK8_PSEUU      AAMLSEADTRAPLLTGGVSIGRMVPMRLLPFRAICVLGMNDGEFPRRDPAAG-LNRLTAE
RECC_BUCAI        FYKYYD-NNHEIFLPGVVNFCYPDSVCYIPFKVICMIGTDHTSIPKTNYLDN-FNLLKKY
RECC_BUCBP        CNSVSYISQSNYLFSGKITFCNNFTLTNIPFKIIYLIGLNDNISSNTHESFDIYNLLKLH
Q8D2T9_WIGBR      YKRFKKENFFKKNKFNSIHFCNLKLSKIIPSKIICLLGINDGTYPRQDINYN-FDSIYKN
F8E602_FLESM      KSYFKSVEKTGGYMEGGITFCSMIPMRSIPFKIICMIGMNDTSFPRIHKPVE-FDLTAVY
Q480N8_COLP3      SQHFSQGDASKQFMVGQVTFCSMLPMRSIPFKVIAVLGLNDGEFPRQRQALG-FDLMSLS
G4QGN0_GLANF      QNAFTSPDSQNQFMTGQVTFCSMMPMRSIPFKVIAVLGLNDGEFPRQSTFVD-MDLVNHL
D7GDA0_PROFC      RRLLRPSLGRADFGTGSLVMCGLGDIQALGHRVIVLLGIDDEHFPPRVAHDH-DDLLARP
C7PDT3_CHIPD      LQTLTGTTRTGLFVNGGITFCSLIPMRSIPFRVVAMLGLDYDKFPRREQPIG-FNLMEKN
J9ZF24_LEPFM      SRRIFRTTWRDRFFSGGITFGRMVPLRSIPFRIVCLLGMGESAFPRNDVAQS-FDFLRES
A5GU99_SYNR3      EEAEAQQQGRYGHVSGAVSLSALEPMRSIPHRVVVLLGMDEQRLPRRDQRPG-YDLMLQR
F8L520_SIMNZ      KAFQEKTGRKEAVQVEALRFASLKLAALDHAPVICLLGLDETQFPRVSSKSS---LCELS
A9BB00_PROM4      KDLIAKEAGRFGHRTGRITISALEPMRAIPHKMIVLMGLDETIFPRKQQRPG-FSLLDHK
Q6MFB7_PARUW      NLLQQRGITYRESHLQTIRFCSMMPLRSIPAKVIAVLGMQEGAFPRAGYHTSLNLMVGQD
                                   : .             :   .      .               

RECC_ECOLI        PKR-------------GDRSRRDDDRYLFLEALISAQQKLYISYIGRSIQDNSERFPSVL
F7XY37_MOREP      PRS-------------GDRCQRDDDRYMFLEALFSAQQRLYISFIGRDIQDNTPRYPSVL
Q1LST9_BAUCH      PRR-------------GDYNRYDEDRYIFLELLLSAQQKLYISFIGYFIQDNTLRSPSIL
Q5E7C0_ALIF1      MKP-------------GDRSRRDDDRYLFLEALQSANKAFYLSYIGRSIRDNTEKAPSVL
C4L7B2_TOLAT      PRK-------------GDRSRREDDRYLFLEALLAAQQQLYISYVAHSAIDNRDLMPSVL
A8ZX08_DESOH      PRP-------------GDRSKRNDDRYLFLETLLSARRRLYISYVGHDMRDNSDRPPSVL
Q2LTC9_SYNAS      PRR-------------GDRSRRNDDRYLFLEALLSARDTLYISYVGQSMEDNSRIPPSVV
Q3B473_PELLD      PKR-------------ADRSVRAEDRYLFLETILSARDVLYISFVGRSRKDSSPIPPSVL
B5EAR7_GEOBB      PRS-------------GDSSPRDEDRYLFLEALLSARKRLHISYVGQSIKDNAELPPSVL
B8FB93_DESAL      PRR-------------GDRSPRGDDRFSFLQAIINAQSRLHISFTGQGIQDNAALCPSPL
Q7NQR0_CHRVO      PRR-------------GDRSRRFDDRYLFLEAILSARGRLYLSYVGQSARSGEPLPPSPL
I1YH96_METFJ      HRE-------------GDRSRREDDRYLFLEAILSAKKRLYLSYVGASIVDNNDIPPSVL
E8RCD1_DESPD      PRL-------------GDRNRRNDDRYLFLEALLSARDVFFLSWVGRNQRDDSLAPPSVV
G4SZ17_META2      FRK-------------GDRSRRSDDRYQFLEILLSTRQQLIVTYIGRSISHNETIPPSVV
M1P5P7_DESSD      PVP-------------GDRSRRSDDRYQFLEAILSARGSLYISYIGQSIRSNDTLPPSVV
B0VLS2_ACIBS      RQQL------------GDRSRLEDDQGAFLDALLLAQENLWLFYNGFDVNDGEVRDPSSI
Q6FF17_ACIAD      RQQL------------GDRSRLEDDQGAFLDAVLLAQQALWLFYNGFDLNDGEVREPSSI
A6W6P1_KINRD      PHV-------------GDRDPRGEDRQVLLDLVRSARDALVVTYSGRDVRTGAVLPPAVP
H6N573_GORPV      PLV-------------GERNPRAEDRQLFLDALTAAQEHFLVFYTGADPVSGSRVPPAVV
I0HVQ4_RUBGI      PRR-------------GDRQRRHDERNVFLDLLLAAREHLHLSWRGRSVRDNAPLPPSVL
Q60AZ6_METCA      PRR-------------GDRQRRYDERNLFLDLLLAARERLYLSYTGRSVRDNAPLPPSTL
E1TB32_BURSG      GKA-------------GDRQRRDDERNLFLDLLLAARSRLFIAYTGRSIRDNAPLPPAAL
E1SLX9_FERBD      GWPDGRGQPIANQYRPGDRSRREDDRYLFLEALMAARDQIYFSYVGRNARDNAERTPSVL
D0KY94_HALNC      ------------RYRPGDRARREDDRYLFLEALLAARERLSISWVGRNINNNKIRPASVL
C1D6T7_LARHH      ------------DYRPGDRSRRDDDRYLLLEALLSARRRFYLSWVGKSPRDNRPRPPSVL
I3YAG8_THIV6      -------------YRPGDRSRREDDRYLFLEALLSARERLVISWVGRGIRDNSIRPPSVL
C0QI08_DESAH      G-----------MYRPGDRSTREDDRYLFLEALLSARETFYLSHVGRDVRDNGERTPSVL
Q5QUQ7_IDILO      -------------YRPGDRSRRDDDRYLFLEAMLSARDCFYLSWVGYSAKDNSERTPSVL
Q1QYD4_CHRSD      P-------------RPGDRSRRDDDRYLMLEAMLSARAKLTLSWVGHDVRDNTPRPPSVL
B7J9Q5_ACIF2      G-----------MARPGDRSRRDDDRYLMLEALLAARRELYVSWAGRDQRNNHERAPSLL
F9ZQ71_ACICS      D-----------MARPGDRSRREDDRYLMLEALLSARDGLYLSWTGRDPRNQENRAPSAL
B1XZ24_LEPCP      G-----------QRRPGDRARRDDDRMLMLEALLSARAQLHVSWIGRSVRDNTAQPPSVL
F4HF17_GALAU      TQK-------------GDRSRREDDCYLFLEALLSARQKLYISYVGYSIVDNTEYEPSVL
B8F7F2_HAEPS      PQK-------------GDRSRRDDDRYLFLETLLSAQQMLYISYIGQSLTSSQEKLPSVL
A6VQ90_ACTSZ      RRK-------------GDRSRRDDDRYLFLEALLAAQEQLYISYVGRSITDNQPRQPSVV
C7LVF8_DESBD      PRP-------------GDRSHREDDRYLFLESIISARDNLILTYPGLSQSDNLEAPPSVL
F2JZ46_MARM1      YRS-------------GDRSPREDDKYLFLEALMSARDTFYLSYVGRSVQDNSEKNPSII
A1S6U9_SHEAM      PARR------------GDRSRRLDDRYLFLEALLSAREQLYISFIGRSERDDSERLPSML
D6Z1F6_DESAT      PRP-------------GDRSRRRDDRYLFLESLLSARRRLYISYVGRSIKDNTELPPSPL
E6WXK8_PSEUU      LGTP--------DRRHGDRSTREDDRFLFLQLMAAAQDVFYVSWIGRDPRDGSEREPSVL
RECC_BUCAI        PLI-------------GDINLYQKYSYLFVQSLSCAEKYFYISYIGYSVKDESKVHPSIL
RECC_BUCBP        PRA-------------YDPCDEINHKNLLLKTLLSAKKFFYISHQIVSNNYKKLNNIPIA
Q8D2T9_WIGBR      LKN-------------DDKNIRQEDLYSFLIILLSSKEHLYISFIKNYINEERSKYISII
F8E602_FLESM      PAK-------------GDRSTKDNDRYLFLETIMSARKKLYISYTGQSIKDNSDIPPSPV
Q480N8_COLP3      KAKL------------GDRSRRGDDRYLFLEAIISSRNSLYLSYQGRNIKNNNEKQPSLV
G4QGN0_GLANF      GRHI------------GDRSRRGDDRYLFLEALLSARKALYLSYQGRGIRDNKSREASLV
D7GDA0_PROFC      TVSS------------GRVDADARARQQFLDAVLSAGEQLIVIGRGADQLTGERLPLPVV
C7PDT3_CHIPD      KQR-------------GDRNVKDNDKHLFLETVLSARQYLYISYVGQSAKDNSRMPPSAL
J9ZF24_LEPFM      PRP-------------LDRSVREDDLHLFLEILLSARSSLWISYVGGEGEDGTTGLPSPP
A5GU99_SYNR3      PWR-------------GDRDRRQEDRAILLEALQACSDHWIATYNAIDPRSGEERNPAAP
F8L520_SIMNZ      LPK--------------QPLSQYEDRLLFLESLFAASSHLIMSYVSISEEDGKEQAPSPI
A9BB00_PROM4      HFL-------------GDPRINDKDRYVLLEALISTRETLLITWDGRDEKTGDSLEPSSP
Q6MFB7_PARUW      NLDY-------------NPNSTDYDRYLFLEALQSVTDVFIVSYQGYTYQDSKVLQPSLI
                                              ::  :                        .  

RECC_ECOLI        VQELIDYIGQSHYLPGDEALNCD----------------------ESEARVKAHLTCLHT
F7XY37_MOREP      VSELIDYIAHSFYLLGDEYVDAE----------------------NRAKRVRSHLLQWHS
Q1LST9_BAUCH      ISELTNYITQNFYLSGDEQLDEH----------------------TCNLHIRKHLWQWHS
Q5E7C0_ALIF1      VSELLEYCQQGYCLEGDNELNPE----------------------ASAKRLVKQLTIEHP
C4L7B2_TOLAT      VTELVEYCQRAFLLPEDEEKAET----------------------EQETALHQHLLTGHP
A8ZX08_DESOH      VGELCDYLRERFDAGPLT-------------------------------DVVEKITTHHR
Q2LTC9_SYNAS      VSELLDYVRRGFVLKD-C-------------------------------NIDELLITYHP
Q3B473_PELLD      VSELFDAIDRGFLLPEGV-------------------------------RAEEMLLFSHP
B5EAR7_GEOBB      VSELLDYLERAFVTPEGK-------------------------------PAAEVA--RHP
B8FB93_DESAL      VSELIDYVEAGFDLSD-----------------------------------SGPLVVVHK
Q7NQR0_CHRVO      VSELLDTLS----AMCGE-------------------------------DMAARLTLRHP
I1YH96_METFJ      LSDFQDFLSMRFETQSGG-------------------------------DILDQIKTKHP
E8RCD1_DESPD      VSELRDYLEQSCRCAEGATG-----------------------------SVLDQLTTDHP
G4SZ17_META2      ISELLAVLRDHYGLDNGV--------------------------------------TYHP
M1P5P7_DESSD      VSELLDILR-VYGVDSLV--------------------------------------DVHP
B0VLS2_ACIBS      LQEFREHLALIVKPEPNAPDRE-------------------VIEGIEIPSQLKQLYHLHY
Q6FF17_ACIAD      LQEFRDHLALIVAPAEQIAKHEDSNLTIQMQQQ--------QFKLLDIPNQLWPLYCVHP
A6W6P1_KINRD      VGEVLDALEAAHPG------------------------------------VRARIEVHHP
H6N573_GORPV      VSELADTVATLCGI------------------------------------RAAGFIRRHT
I0HVQ4_RUBGI      VAELLELLAAATAEDPEDPGSV--------------------------AAARQRLVVEHP
Q60AZ6_METCA      LSELLDYLLPLVAAAGESP-----------------------------EEARRRLVVEHP
E1TB32_BURSG      VDELLDYLAQVSAGEGASPAQV--------------------------EEARRAFIVDHP
E1SLX9_FERBD      LGQLMDHLRAGYCLE-------------------------------DGEDLVEHLTTVHP
D0KY94_HALNC      VSQLRDYLDQFWAVP-------------------------------EPHSCSEIQTTEHP
C1D6T7_LARHH      VEQLRDYLAAGWQAAPL-------------------------GTEPATTGLLAALTTEHP
I3YAG8_THIV6      VGQLRDHLAAGWRL----ANPE------------------------QGSTLLDALTTEHP
C0QI08_DESAH      VGQLRDYIDAGWTLEPGCAEPERPESECSEPERLGSECPESGQPNYEGSGLLDHLTTIHP
Q5QUQ7_IDILO      VAQLRDHLQQGWEVD------------------------------------INSLTVVHK
Q1QYD4_CHRSD      IGELLDTLEQGWDVPED-------------------------GAGSRDARLARRLIETHP
B7J9Q5_ACIF2      VAQLREAIRDGW-PPALE-----------------------------------KRTFEHP
F9ZQ71_ACICS      ILQLQREIVGIWGEDALR-----------------------------------TRLHLDP
B1XZ24_LEPCP      VAQLRDYLAAGWGRPLVD-----------------------------------ALSVEHP
F4HF17_GALAU      VNQLWDYMADHLSHPDDL----------------------------------KQLRFSYP
B8F7F2_HAEPS      VTQLFDYLKENLPKADYT----------------------------------KLLSV-HP
A6VQ90_ACTSZ      VSQLQDYINDNLADNALR----------------------------------LTEKV-HP
C7LVF8_DESBD      VSELLDFLDRGCTVDGLT--------------------------------PSEAIVFKHK
F2JZ46_MARM1      LSELVEYIGQSCTLERDRLKEPD----------------------VSTQNMMSHVVTEHP
A1S6U9_SHEAM      VSELLDCCELSAYVSQGK--------------------------------LVNRLVKQQP
D6Z1F6_DESAT      VDELLDCLERMPEAVAESTADSEGTGEE-------------ERLADRRRRTRARFVVNHP
E6WXK8_PSEUU      VSELLEAAAAQHEHPPGD-----------------------------TSPVTRALVVEHP
RECC_BUCAI        VDQLLNYITLNFCFIGDQ-----------------------------------NLSYKEN
RECC_BUCBP        IDKIIKYITQYFYIKNKN-----------------------------------KDNFNDN
Q8D2T9_WIGBR      INELIEYISVSFYIKNCK-----------------------------------SYNFLEN
F8E602_FLESM      VAGLLEYVRQISGGG-------------------------------------YSLINKHK
Q480N8_COLP3      VKELMEYLAQGYGWQFSEEQLTSDNNND-----------------DTNAESNQSGIYQLA
G4QGN0_GLANF      LSEFLAYLKKHHQFDNLV---------------------------------------QQP
D7GDA0_PROFC      LADLIGAAPVRDESGDDSGDGAHR-----------------------GSPSDSALIRRHS
C7PDT3_CHIPD      VDELLDYIESGCEDAEGV---------------------------------RNRLVTRQP
J9ZF24_LEPFM      VRQLLETLREPFPPEKKG----------------------------------QGLFREVP
A5GU99_SYNR3      LSDLLRCLERSYRTEAGEP------------------------------ITTWVLQQQPP
F8L520_SIMNZ      VQELLTILDPI------------------------------------------SITEKHP
A9BB00_PROM4      VQQFFEYLQHELGEKSS-----------------------------------MGLLKKPS
Q6MFB7_PARUW      IEEFFTYLDKYYLIQNKK--------------------------------ISEQCVSKHP
                  :  .                                                        

RECC_ECOLI        RMPFDPQNYQPG------------------------------------------------
F7XY37_MOREP      RMPFAPENFLPGS-----------------------------------------------
Q1LST9_BAUCH      RMPFAPENFIPGS-----------------------------------------------
Q5E7C0_ALIF1      LVPYSQQSF-------IG------------------------------------------
C4L7B2_TOLAT      LVPYDRRYFSPTVPPATA------------------------------------------
A8ZX08_DESOH      LQPFHPDYFSSDTQARFS------------------------------------------
Q2LTC9_SYNAS      LQAFSPVCFTEESCRLFS------------------------------------------
Q3B473_PELLD      LQPFSPACFSAG-GPLFS------------------------------------------
B5EAR7_GEOBB      LQPFSLQYFNRD-SALFS------------------------------------------
B8FB93_DESAL      LQPFSPDYFSGQCPGLFS------------------------------------------
Q7NQR0_CHRVO      LQPFSPKAFDGGDARLAS------------------------------------------
I1YH96_METFJ      LQPFSYRYFDGMDDKLFS------------------------------------------
E8RCD1_DESPD      MQPFSRRCYGG-DSAVAS------------------------------------------
G4SZ17_META2      LQAFSPRYFEPE-SALFS------------------------------------------
M1P5P7_DESSD      LHGFSSTYFDGS-GSLFS------------------------------------------
B0VLS2_ACIBS      LQPFDPKGFMAENRYIRY------------------------------------------
Q6FF17_ACIAD      LQPFDPLGFGNLPVAKRY------------------------------------------
A6W6P1_KINRD      LQPTDRRNFTPG-ALGTD------------------------------------------
H6N573_GORPV      LHGFDARNFEPGGVGGVQ------------------------------------------
I0HVQ4_RUBGI      LQSFAPELFDAEADTRRR--SHDAELAAALRAGAT---------------------AAAL
Q60AZ6_METCA      LQAFSPVYFDAAVAKDPRLVSFNSEYCEALRAARSPRPSGEGVRACESHSQEPEECSAIL
E1TB32_BURSG      LQAFAAEYFAAQPELFTY------------------------------------------
E1SLX9_FERBD      LQPFSRAYFSGTEGS---------------------------------------------
D0KY94_HALNC      LHPFSRRYFSADNTD---------------------------------------------
C1D6T7_LARHH      LQPFSPRYFSRAPDARPQPD---------------------------------------Q
I3YAG8_THIV6      LQPFSRRYFQPDRPPR--------------------------------------------
C0QI08_DESAH      LQPFGRAYFSSPEAP---------------------------------------------
Q5QUQ7_IDILO      LQPFNPYYFNQEDSD---------------------------------------------
Q1QYD4_CHRSD      LQPFSRRYFERDDPR---------------------------------------------
B7J9Q5_ACIF2      LQPFSPDYLAG------------------------------------------------K
F9ZQ71_ACICS      LQPFSPRYLE-------------------------------------------------P
B1XZ24_LEPCP      LQPFSRRYFEQTVEQGEPVDGPADETGDETGNDTAAL----------------------R
F4HF17_GALAU      MTVFSEHNFLAPHF----------------------------------------------
B8F7F2_HAEPS      MTVFSPNNFKDGKV----------------------------------------------
A6VQ90_ACTSZ      MTIFSPQNFYGNDR----------------------------------------------
C7LVF8_DESBD      LQAFHPDYFSAGSPIF--------------------------------------------
F2JZ46_MARM1      LQPFNADYYSASPLLTDN------------------------------------------
A1S6U9_SHEAM      LQPFDHRLYLTNQDITAS------------------------------------------
D6Z1F6_DESAT      LQPFSPRYFQPDQPLLFT------------------------------------------
E6WXK8_PSEUU      LQPFSPDAFGSDGEPRR-------------------------------------------
RECC_BUCAI        SKKITKYLCKKHKKQFF-------------------------------------------
RECC_BUCBP        LKDIKSHIYHNYTFYAHE------------------------------------------
Q8D2T9_WIGBR      INNIKKILFKKYNNFYFFR----------------------------------------K
F8E602_FLESM      LHPFSITYFDEKEK----------------------------------------------
Q480N8_COLP3      MQAFSPNNYRGTW-----------------------------------------------
G4QGN0_GLANF      LHPFSIAGFSPEQNNSPD---------------------------------------VPK
D7GDA0_PROFC      LQPHDATNFLGSGRHQPF------------------------------------------
C7PDT3_CHIPD      LQGFSRKYGQGDER----------------------------------------------
J9ZF24_LEPFM      SDPFDPSCFSREAGSWGS------------------------------------------
A5GU99_SYNR3      LPPLTAREVVGAPWPMDQ------------------------------------------
F8L520_SIMNZ      PFLFHADYFDAPKPTSHL------------------------------------------
A9BB00_PROM4      PNPLNKNNFLSCNNQPPI------------------------------------------
Q6MFB7_PARUW      FDAFDVSYFKPNSILNNY------------------------------------------
                                                                              

RECC_ECOLI        -ERQSYAREWLPAASQAGKAHSEF----------VQPLPFTLPET------VPLETLQRF
F7XY37_MOREP      -EHQSFAKEWLPAASAKGKPIPDF----------IAPLKAQPYYT------LALDELLRF
Q1LST9_BAUCH      -INQSFAKEWLLAAKASFRSNNTQ----------NRFFMNKSLATKKQENMLLLANLKKF
Q5E7C0_ALIF1      -DNISYASEWLPTAKLEGAAAPEF----------QTAPLVYAPETK----ELELTELQRF
C4L7B2_TOLAT      -DLFSYAAEWLPALTPTGQAGFFD----------ARLSLPEELQGKP---EIELADWLRF
A8ZX08_DESOH      -----YAADYLAAARQLAG-GRPG-------RPAALEPAVPV-PDNADPQTIEVEDLCRF
Q2LTC9_SYNAS      -----YSEENRKAANTLLKRSSLT-------SIPGAEAERLP-EDPAMATQATIRDLIAF
Q3B473_PELLD      -----YSEEN-FLPHAEHS--GAG-------PEPLFMDSPLP-EPGEPLQRVELMDLIGF
B5EAR7_GEOBB      -----YSQQNCEGAKAKLS--SPT-------PREPFLDAPLP-AWEE-EGTVTLKTLIDF
B8FB93_DESAL      -----FSRQYSQAADILQR--GEK-------QSRQFFSQPLE-EPEAQDKSISLEALCAF
Q7NQR0_CHRVO      -----FEPAFAAALAAPPA--------------EPAPFVAPL-PDEGAATVVNLHDFIRF
I1YH96_METFJ      -----FNASQCPPQIVSPK--------------ADWFASPLP-EAEESWRHISVDQLARF
E8RCD1_DESPD      -----YNPCWLPAGHEAEP--------------SPFLAVPLE-PPGEEWRTVDIGQLVRF
G4SZ17_META2      -----YSEADCQAAAALVK---PK-------PEPAPWWQGSL-EDETDQTIIEIGELFAF
M1P5P7_DESSD      -----YNRQLMEVGSALHG---KH-------DTPDPWWQGRI-EGEA-KDVCSVAELKSF
B0VLS2_ACIBS      --------QDHWFNVAMQIQQASG-------VLKPWANISYP-LEIPDMLVLDSHQWIQD
Q6FF17_ACIAD      --------QDQWYQVAQSIQEASA-------ILQPWVNMVYT-QPQQELRVLDSQQWMAD
A6W6P1_KINRD      ---GPFSHDGTAFSGADAGHREPA-------PVPPFLPAAL---PPAPAADLDLDTLVQF
H6N573_GORPV      ---GPFSFDRGLLAGARALRGTKQ-------PVRPIAGAHLGIPAPDADSDVELTSLVSF
I0HVQ4_RUBGI      PPVAEAEVGDDENEEADATPDP----------ALPFFTTPLP-PPGPEWRTPTLAQLVEF
Q60AZ6_METCA      AERERADHGPAGPIAGEEQNDPDF-------EHAPFFPAPMA-APEPEWREPNLDVLKRF
E1TB32_BURSG      ----DADRAELATLLAAPQPKN----------AAPFFEEPLP-PEES--APVAFDDFVRF
E1SLX9_FERBD      --LHTFAREWFDAHQGHVETE--------------SPALPVWQP----QAPITLTDLASL
D0KY94_HALNC      --LFTFANDWRAVHDSTQGTS--------------KTELPIWLP----KEPLTLNTLSDF
C1D6T7_LARHH      PPLFTYDSDWRAIHDATDPPA--------------EPAAALPLPLPDWDGRTDAVTLARF
I3YAG8_THIV6      --LFTYAREWRAVHRDSRSDPDGDPGIEPAAFSDTEPERPPTLDPPDLDAPVRLSALGGF
C0QI08_DESAH      --LFTYAQEWRNCLGRREDQP-----------------REEFLETPPCVDALTLSPLIGF
Q5QUQ7_IDILO      --YFTYASEWAQAHQGAVAST--------------SRTASETAADDELERTLSINDIKRF
Q1QYD4_CHRSD      ---FTYEASWEALYATPEDTA---------AATADGAPSPDASMASLPDEPLSLGDLQRV
B7J9Q5_ACIF2      PGLRTWAREWYP-SPHSAPENAA-------------------LPDPAEITPRSIRELLEF
F9ZQ71_ACICS      DGPESFAREWFPVSAVEDRSVAV-------------------LSPPAARLELALLDLKGA
B1XZ24_LEPCP      RGLLTYAREWRAAHAREDAAAAAS------DPLTAAPTPIDRRPAPADQPPLKLAMLTRF
F4HF17_GALAU      ----SYAQEWLPIAQAQQQQQHPL---------REFDQTLLQPENGSHQLIVELDDLQQF
B8F7F2_HAEPS      ----AYDKEWLEVKNNILPRKDFL---------QKLTKTQEDIMSD-----IPLNQFIHY
A6VQ90_ACTSZ      ----TFAKEWLPSSPAMPSGENKQ---------AVLPLTEKLTRIE-------LDQLVKF
C7LVF8_DESBD      ----SYSAQNRDAAQALFAEHQSR--------QFFPEASTLEGAHAEQEIEIDIEELTRF
F2JZ46_MARM1      ESLFSYNEQWLPLFYLENVYGEKF----------DSFSFEPLTDYDGDLSELDVDELRRF
A1S6U9_SHEAM      -----FAAQWCPQETRPPK---------------PFIDAVLDEVDEDEHKVLELASLIRF
D6Z1F6_DESAT      -----YAAEYAPVPSTRPVGTGQG---------GPDSPRPKAAATAPAPGAPTLAELHRF
E6WXK8_PSEUU      ---FSYRRDWREAAAQPSAQRSPLA---PWFNGQALPAPPPADEPVGAIPVLPLEALRRF
RECC_BUCAI        -----YETKNIESFIQDDIKNDFK--------HTEKNISHKNLLKKNTDNEINLKDLINF
RECC_BUCBP        -KRNFLEKLNYPNFNTTIWKMATL--------INNSHKEFIKKLPSIKNQTINYNTLILF
Q8D2T9_WIGBR      EKIEIFNKKYFLNNININ-------------------------SDKKIFSKISINEFFLF
F8E602_FLESM      --MFSYSKTNFQIAESYLETPVTD----------EDRGEDILTEDAKPPSEIDIEEIAYF
Q480N8_COLP3      ---PSFDANWLALGQSSNSDNDESMG----EGSTLAIESLAVTPEQTVEVSLSCQQLIRF
G4QGN0_GLANF      QVQQNFDKGWYRLMTSLHSSKDDSLFTSQESQNNQEKTVASQSQESRLSEKVALPDLVKF
D7GDA0_PROFC      ----SFDRQALAGAESLAGPHPKAPA-----RWWQVTARVPVSGGPDPDEALDVDQLTAF
C7PDT3_CHIPD      --LYSYLNTAVPERIITRADKAME---------------------QPSIEEIDLDELVRF
J9ZF24_LEPFM      -----FSSSRAGIVRSRSTRTDSSPS--FFVPKKGRLVLPKGPEDRGSGRRISLSRLQSF
A5GU99_SYNR3      ------------------------------------------RWPVDECEPASLEELQQW
F8L520_SIMNZ      ----AFRAAQKFYTPHSKPTPFIP----------EFLTPTPLPPSQTEDLTIDLRALSRF
A9BB00_PROM4      ----SCDKRDLETRQWMNAKQGSR-------GLTLALPLNWNLSKNAVNSSSDNELLKSW
Q6MFB7_PARUW      ---SQFDYRIAEQYYQTHKTPSHRLL------KQFILSNYSLEDILPSHTVIDLKTLNTL
                                                                              

RECC_ECOLI        WAHPVRAFFQMRLQVNFRTEDS-EIPDTEPFILEGLSRYQINQQLLNALVEQDD------
F7XY37_MOREP      YHHPVRAWFVQRLALSVVHYKSLEQKTNEPFNLNGFTRYQLNDQLVNALINGEN------
Q1LST9_BAUCH      YQHPVRTWFQQRLDLWLYNEPQ-DISENEPFIVKGISHYKIKEKILNALIEGKN------
Q5E7C0_ALIF1      WRLPVAYFFNRGLKVFFESVES-RVEDDEPFTIDGRTGYGMKSDLLEDLLAYDDPNHV--
C4L7B2_TOLAT      FRNPVAGFFRRRLRVQFVEREA-ALEETEPFWLDKLQQYQLRERLLRYQRLDVD------
A8ZX08_DESOH      FAHPARYFLTQRLGLRVAETDR-IPEEAEPFEVAGLERYDMARRLVERLLAEDPAAP---
Q2LTC9_SYNAS      FRHPARFFLQRRLAVFLGEADI-VLEENEHFDVEGLDRYGIEQLLMEKEIETGHMEE---
Q3B473_PELLD      YDNPSAFFLRYRLGLQPAGQVL-PLDEREPFGLDGLDAYRIRAELAEAMLLEGDIGR---
B5EAR7_GEOBB      LCNPAKELLRRRLGIRIEQGVE-PLEESEPFALDTLAKYQLEQEMVTALLRGEELDT---
B8FB93_DESAL      FRMPPKSILRDRVGVFLDAYTE-AMDSAEAFSLGGLERHVLAGKMVEKRVQGRSSLD---
Q7NQR0_CHRVO      WQNPARAWLADRLALRVAYSGD-AQPAREPFAMARDASHALRRQLVEAMLHGKPPQP---
I1YH96_METFJ      FAHPAKFLLRERLHIQLQPDEQ-VLETREPFQLDGLSSWQLRQELLEVNLASAPVAA---
E8RCD1_DESPD      WRHPVRFFLERIIGLRLREEIP-VIEESEPFALDPLQQYHLRRQTIGELLAGLSPEQ---
G4SZ17_META2      YRHPQKYFMQRRLDVRFNGIAA-DAEEREPFAIGQLDGYAIYHEWIDGVL--HDKPL---
M1P5P7_DESSD      FRNPQKYFVRDILGIHLGQQNL-SVEEHEPFVLDSLQKYLVEQDMINGFLGSSEQRL---
B0VLS2_ACIBS      VTFPARLYLKT-LGVENLGNVG-VLDQNEPLLLDGLGRYTIRHFLQQN------------
Q6FF17_ACIAD      VTFPARLYLKN-LGVENLAMTT-LLDQNEPLFLDGLGRYAIRNFLQKQ------------
A6W6P1_KINRD      LQHPARGFLRQRLDVASATREE-EPDDALPVQLDALQKWAVGDRALAARLRGVAA-----
H6N573_GORPV      FANPIEGFVRQRLGARMPDEEH-DDSDRLEVRVAGLEEWAIGDRLLARMLAGADL-----
I0HVQ4_RUBGI      FRQPVRHLLRRRLQIALQFDEA-ALEDDEPLVADALARRAFAERLLPPLLAGLDT-----
Q60AZ6_METCA      FRNPCRYLLEQRLGLTLAEGEA-ELADDEPFLPAYFARGEVAERLLPLMLSAATE-----
E1TB32_BURSG      WRHPARALLRDRLGIVLSDAQG-ELLDTEPFELDYAGRDALAERLLPVLLDTDSEDGE--
E1SLX9_FERBD      LRDPVRLLMTRRLGIWFGDDTE-AAEDLEPFALDGLTSFQIRDELMTVLRQHPEQTG---
D0KY94_HALNC      LRTPAHTLLTKRFGVYLRPTAT-ELEDHEPFELDGLQRWQLKKEINDRVRHQLAIQA---
C1D6T7_LARHH      LRQPAATFLHGRLKVRFGELDE-LAED-EPFALDPLATHQLKSRLLEAVRDVPEAET---
I3YAG8_THIV6      LRHPVRTFYTRRLALYLTEDAD-AVEDDEVFDFDGLGSWGMRDAMIQAVQHTLAQQP---
C0QI08_DESAH      MKNPVKFFYNHCLSIRFDDISL-ENLDHEPFALDLLAPFNLGATLLSAGLAAGVSPELYP
Q5QUQ7_IDILO      IEEPARLYFNWRLDTYFSRNSE-DLDDSEAFVMDNLQSWSLTTRLVDAGKKALLNGA---
Q1QYD4_CHRSD      LRRPWTVYL-GRLGVHYVDPHV-PDEDNEPFALDGLEDHGLKRELLDGARGGVALAS---
B7J9Q5_ACIF2      FRLPARAFYRQRLRTDFNEEDP-AEEDDEPFTLDSLETYHLLEDLLRAAEKNGPDRIAER
F9ZQ71_ACICS      LSDALASFYALRLGVESPWRDR-MAADDEAFRLDGLGQWQILQQLWERAA--SPAELREG
B1XZ24_LEPCP      LRNPVADHLNERLGVRLALADE-ALADDEPLGLHALDESILLRRLVEQGDVQTAQLPASA
F4HF17_GALAU      VIAPIKYFFEQRLGVYLNENEQ-ERVESEVFELTALAQYQLKQRLFENEPQNSTLEFE--
B8F7F2_HAEPS      IQEPIKYFFQQQLGVRFEQNED-KIEESEIFQLSGLEKYNLLDDLIQVEEQDIEIFFE--
A6VQ90_ACTSZ      VRHPVKYFFENQLGVYFQNDDD-LIPDTENFTLDGLDLYRIKDDFLTYSDEELCRYFE--
C7LVF8_DESBD      LTHPCRHLLRALRIDPTGGEDD-FLDEEPLATPTGLEAYGPLQDLLRTALDEPAANL---
F2JZ46_MARM1      FRHPARYFTQKRLRAYLSFNEE-DELEDEPFALTGLSGYQIKVELLEAMLKDEEAEL---
A1S6U9_SHEAM      YRDPARFFCQRRLRLDLSHRLD-ALDDSEPFDVDALGRYQLQDKMLNAALEADEIRQQ--
D6Z1F6_DESAT      FRNPSRWYAEHHLGLSLPPGEE-ARPDREPVFLERLDAYRLNRQLLQDPASVLAAVNAG-
E6WXK8_PSEUU      LLNPAREFLNRVRVRLPEVESHGEDLEPLAAPAEPLERTLLQRAVFESLLRGDDAPT---
RECC_BUCAI        WKHPIRYFYNSHLKIKIRQKKQ-KINTTETFLVNPLNSFKIKNKLLDYIIHNKNITK---
RECC_BUCBP        WKNPIQTFFHVRLNIQLNTTKN-KHMHQNKHFINKLDQYKMNKTLLKFFLYKQNTNQ---
Q8D2T9_WIGBR      YSNPIKFWCKKKLKINFSKEHL--YKDNEFILKNKFNSYRINIILFEYLIKNKYLNK---
F8E602_FLESM      FKNPLRYYFKNNLGIYPENLAQ-DNEDVEPLNLNNLQKTILKDRLAKESLFSEEQEIS--
Q480N8_COLP3      YQHPAKMFAQQQLNLYFENHDV-LLEDVEPFSVNHLQSYLLRQDLLSAALTGTIESPSN-
G4QGN0_GLANF      FKKPVEFFANHSQGLWLDDIQT-GLSDTEPFIENGLDVYLMKSDFIDCMLECQKFGFSE-
D7GDA0_PROFC      YRDPVGAWFGATFGFTPRNQDP-VLSPALPLAADGLTDYVVGSRMLEATLSGQPRER---
C7PDT3_CHIPD      FKNPFKAYYNKVLGIYYNDEQV-LLNETEIFHLDSLQKWSLKNELLQMDTNAIANMK---
J9ZF24_LEPFM      YRNPPFYQAKNVLNLAVAGERP-LLLDEEPFLLDPSQEIADPAQNPWPPVGPLQREQ---
A5GU99_SYNR3      LRDPARALLQAHGIHPHRRGDE--SSDPEESAPDGLQRWTLGQRLLNLGSERLEANQWP-
F8L520_SIMNZ      AKHPLRFYLNHALHFYLQYEEK-----DEEFTLSPLNQMKLREEAHHRPFEEVFEQA---
A9BB00_PROM4      LATPQLKWLEQFHLHPREWNKP--IEDLDSLSIPELIKFKILKQEFTELITSSNNQIISP
Q6MFB7_PARUW      VRSPVKFYLNRGLDIYLEGYEDRIIKNQEELGLSALNKYQLKQFALKEPFEKVMQIAD--
                     .                                                        

RECC_ECOLI        -----------------AERLFRRFRAAGDLPYGAFGEIFWETQCQEMQQLADRVIACRQ
F7XY37_MOREP      -----------------IAQLFHQWRAAGLLPDGAFGELYLAKQYQEMMVLSEKVRPWRL
Q1LST9_BAUCH      -----------------LDVIYQQVRAAGLLAYGAFGKLYWTKQCSKMIYLVDQIRTYIL
Q5E7C0_ALIF1      --------------SQISRDFYQQQKAQGKLPIGSFGEITADKEVNTVKDLVAHIQPLTT
C4L7B2_TOLAT      -----------------QAVWQARLLAEGMLPDGEFGRLALQADAKNLAPLAAALQTWPL
A8ZX08_DESOH      --------------------LENALRASGILPHGEPGKRLFERLKTGAAGFVAGVRAVTA
Q2LTC9_SYNAS      --------------------VYPVLAAQGLLPHGAVGQSRFDALKRDICHFVRSYKHILH
Q3B473_PELLD      --------------------VQDRFRAEGVLPPALSGDRLYQSLLEDAARFVRSVQRLAP
B5EAR7_GEOBB      --------------------PYAVACARGDLPPGVCGSALFRKLGEPAQEFAAKVVEASD
B8FB93_DESAL      --------------------LYALAKAQGELPHGNVGAFAFNQLENQISPFARKAEAMLS
Q7NQR0_CHRVO      --------------------VRQRVAAAGLLPCGELGQAWLQEEGRASVRLAGRLPGALR
I1YH96_METFJ      --------------------YRDIVRAKGVLPHGYIGDAWFDQEVDKVMDFSERLEQLRS
E8RCD1_DESPD      --------------------VRSSLEGSGRLPQGGFGSCAFKAVAAESEPFAAQLRPLLA
G4SZ17_META2      --------------------TAQKLKAQGRWLSGVAGDLEFARQQQSIDAFAEAIKAKAL
M1P5P7_DESSD      --------------------LQQQVQAAGQWPLGTPGNISFSEKREELQTFVDRVATRKA
B0VLS2_ACIBS      ------------------EQQAQPEVLLDQLPVGKVQYSAWQQGIFEQECLLERLHHYAP
Q6FF17_ACIAD      ------------------EQTTTPDTLLDQLPVGKIKHSAWQQSLAEQERLLERLHHYTT
A6W6P1_KINRD      ------------------PEVVRLEGARGGLPPGPLGVAVLREVGPVVDAIAGVAAEFDT
H6N573_GORPV      ------------------RDCQMAEVRRGTLPPAEFGRRELVRISRQVGAVYDAAVGLRH
I0HVQ4_RUBGI      ------------------EAALRRAEAGIELPSGTLGRCQRDAEFARVAGFAERVRAALA
Q60AZ6_METCA      ------------------EAVEVVARAGIEFPQGQLGELLLKGELTRIREYAERIAGQTQ
E1TB32_BURSG      ---------------LVFERVRRVAEASPELPGGATGAVWRARELGALRQLADSVRREVA
E1SLX9_FERBD      -----------PQRAQLLAQRIGRLGGRGQLPFGAFAELATDHLAEPTLAAFERAQQLAG
D0KY94_HALNC      -----------HATSQMTTPTIEHISALISTQYGQ-ARLGGRLPIVSPAFEYSELLPLID
C1D6T7_LARHH      -----------GRHWQAAATRLTEEGGLPFGAAGAQLLQACHAPVMALRQNWHRLDDLTD
I3YAG8_THIV6      ----------DADPQACLRATIRQLARAGRLPLPPFDGVWTDSLVKDLEAPVETYRSLLQ
C0QI08_DESAH      GRGG------PCVVEAAVVEAADRLTRTGELPMAGFGTLAAKNLTAPVIAMLTRYGSLAE
Q5QUQ7_IDILO      ------------GIEASLLKELNRIKREGALGIGAIAEQNGLQLLEQSQEILETYQQSIA
Q1QYD4_CHRSD      --------------------VAERLRLAGRLPTAGFGEALIEPRLARLSRQVESWRRDVA
B7J9Q5_ACIF2      VRAQ---------------------RRSGRYPLAGMASRTATALLDDVTPVLTVWREIGT
F9ZQ71_ACICS      LAAE---------------------ARRGHLPLAAAGILQQQRLLTLMESLLGSWQAVAE
B1XZ24_LEPCP      PAADPESDADAARLQRALQDGSLSLQRQGILPLAGLGERWQQAFVRQSLPMLAQWRIWQE
F4HF17_GALAU      -----------------------KAQREGMLPRAEFAFLQQEELEQSCDLLRQATAQYQQ
B8F7F2_HAEPS      -----------------------NEKLKGNLPARYFAEINKTKLTEDIQLLRNTLSSYLS
A6VQ90_ACTSZ      -----------------------RLSVKGILPRGNFGKVYEAKVRSEMETFREKVRDYLL
C7LVF8_DESBD      ---------------------EGLLLAWQLLPPGQAGTDASRKLCSQIRALADQARAVIG
F2JZ46_MARM1      ---------------------IARLPFTGNLPSGSMGKVAFDEVVQQCRGLSEAVKSHGV
A1S6U9_SHEAM      ---------------LAVDTLCDRLAGAGVLPMAPFDKLLFASYQRDLAPILDRCRFIMG
D6Z1F6_DESAT      ------------EDDEAGRRLRHLLAARGELPLAGAAAPALAEAMAAVEPVAAFLATNPA
E6WXK8_PSEUU      --------------------THALLRARGLLPSGASGRSVLERQARSLLPWREAFASWRG
RECC_BUCAI        --------------------LYQHYLLSGKLPYHFFGEIFWIKNIKEMKLIANKVMQYRI
RECC_BUCBP        --------------------LFQYYKNIGIIPNNNIGNIIWEYTKKLITPLYDQIMKIKK
Q8D2T9_WIGBR      --------------------KDLLKNTIKYFFDGVFEEIIIEKKYYQIIKLINNINKHLL
F8E602_FLESM      -----------------LDEMLNYYRKSGLFPPGKFGEYMKEVNKYNVSFFTNNIKKTLK
Q480N8_COLP3      --------------KDGSEQVITRAHLSGKFPDLPTTTNLFKDYQLDVQQFSEEISKVNC
G4QGN0_GLANF      -----------EQKQEAMNSMKTRLMLSGKFPDYPNSEELIDENALQSQKLTDELSQFIS
D7GDA0_PROFC      --------------------IDSAVLLSGAVPPGTLGATQLMNLWPTVQAMAARIGDFRA
C7PDT3_CHIPD      ----------------------IRLVKTGRLPLKNMAYVALQQIEAEVQPVREKFRACIN
J9ZF24_LEPFM      ----------------------QTRKRRERRERLLGGFEGLQEDHTETRRFSLGIGGSLL
A5GU99_SYNR3      -------------------QQRDALARRGHLPPGPAAIVSSDQPWQRCHALLAKQAELQD
F8L520_SIMNZ      -------------------------DLQGKLPLGRFKEVARLHASEEIALLKEALKQFEF
A9BB00_PROM4      EINE-----------RESPNWQDKYLGQGVFPPKSAATLESEILGRRWTSLIKSLSKLGE
Q6MFB7_PARUW      --------------------------KEGKLPLGMFKTVATKRFKDEIDEVHQRLYKHGI
                                                                              

RECC_ECOLI        PGQS------------------------MEIDLACN--------------GVQITGWLPQ
F7XY37_MOREP      PETPR-----------------------FQVSLTVN--------------DIKLSGWLQR
Q1LST9_BAUCH      PEQHT-----------------------EKIQLNID--------------NTVLIGWLSK
Q5E7C0_ALIF1      LPLDD-----------------------QEVRLRFAFPH----------GEMELQGWLKQ
C4L7B2_TOLAT      ATAQR-----------------------ETFHLDFA--------------GWQLLGSVGE
A8ZX08_DESOH      -NG-----------------------GLDRREIRLDING------------TTLCGTLDG
Q2LTC9_SYNAS      -SE-----------------------NIPPRDIDLEVAG------------FRLSGRLEG
Q3B473_PELLD      ISL-----------------------PLPALDFELPLGP------------MILSGRLEG
B5EAR7_GEOBB      -GE-----------------------PLPPLDIDLVLPG------------GRIIGRIEN
B8FB93_DESAL      --E-----------------------ANQRLDADVMAGE------------WKIHGRLSP
Q7NQR0_CHRVO      -GE-----------------------ALPPQPVHLEIAG------------FTLVGELYG
I1YH96_METFJ      -ES-----------------------VAFTLPFEFCVER------------FQLEGQLEA
E8RCD1_DESPD      -EA-----------------------VA-PMELDHAIGS------------FRLTGWLGQ
G4SZ17_META2      -GK-----------------------PLEDLSVDLAVGS------------YRLVGKLGN
M1P5P7_DESSD      -FG-----------------------SEEDRFLDGEFCG------------FHISGRMSS
B0VLS2_ACIBS      AVT-------------------------QTTQRVWRIAK-----------QLHMNITVPK
Q6FF17_ACIAD      QPT-------------------------ATTHHVWRVSK-----------TLHLNIIMPE
A6W6P1_KINRD      APP-----------------------RSVDVELDLDVPGVGQLRLTGNVRGVRPVRGGGR
H6N573_GORPV      GDA-----------------------ATRDFVLDLP-------------DGTRVHGSVGD
I0HVQ4_RUBGI      EPV----------------------LDAQGAELDFDLDG----------ERWTVAAGFAD
Q60AZ6_METCA      EEP----------------------LQPLPGRLAFQIEG----------ETWTLSGALGQ
E1TB32_BURSG      SGVERLPFVLDVAPRWPDRAELAGELFGRHDEALREAAE----------APLQLHGTLNL
E1SLX9_FERBD      QWQLADDLECYHKHGA--------------LVLEDWLSDLYQTGGS----HFRLRVLPQS
D0KY94_HALNC      QWQRWLELNLRFHQTAAKSPVLSI-RSDRGIMLEASVPDVYSTESSIPNDTLARLIFIEG
C1D6T7_LARHH      LPPLTLPPLLLPLAGDQTATL---------LAHCDGLQAVAADSPPLRRRVMRTGRLADS
I3YAG8_THIV6      QYPLVCPARTIRLAGIG-------------IDLDDSLNDLRQDDAGNRVRLHLQASRLHE
C0QI08_DESAH      RWPRACDPMEIALVIEQDGWP--------EIRLDDWLDNMITTDFDDPGAILPQFARQQF
Q5QUQ7_IDILO      GYSGVNEFPETVFFEHSG------------LTIDDTVTGLHSNENGERLWVVTSASNIAA
Q1QYD4_CHRSD      ACTAASPFLARFQGGASALTL--------EARLDDVFAAPEDGAAPWCLMTLEPGHYGHL
B7J9Q5_ACIF2      EWTAAPQRRVVHRA-------------RGRILLEDWLPALY-QNNAGDLAFVQLRASRLL
F9ZQ71_ACICS      ALGPEHEVLEDEFL-------------GDGFRLQAKLPKDR-SWNANPLGIHLRRHTSKL
B1XZ24_LEPCP      AAPERAAPQPLNLALPLAD--------GGALQIDDWLDGLQIEATTGALLWLDLQASRLC
F4HF17_GALAU      QAA-----------------------DSVMVDVTFELDG----------QEVRLQGQIDH
B8F7F2_HAEPS      QEK-----------------------NIIEIEHSVIFAE----------RKYQLVGNVPN
A6VQ90_ACTSZ      QTP-----------------------QTQAIELDIDGVK----------ITGNLTALYGD
C7LVF8_DESBD      DEK--------------------------PLRLDLKLPL-----------GRITLTGRID
F2JZ46_MARM1      EALPD-----------------------QEVDLTLTTEA----------GTSRITGWLPM
A1S6U9_SHEAM      ETE------------------------GQSLRISLVLNQ-----------GHKLVGTIDK
D6Z1F6_DESAT      GRP------------------------LPNLPLDLELGQ-----------HLYLRGELRD
E6WXK8_PSEUU      TDE------------------------PQSRVFEATIDG------------TGLRGQVDN
RECC_BUCAI        EKE--------------------------EKKINLNIEK------------YQIYGVLSE
RECC_BUCBP        ILN--------------------------NSKFCINVKN----------KCMLHGQLKNI
Q8D2T9_WIGBR      MKK-------------------------ETKKVFFKLDR------------TIIFGWLPN
F8E602_FLESM      PPE------------------------IKAMDFYLDVKN-----------RNINIRGEYM
Q480N8_COLP3      ENPE-----------------------LIDCNLVLDIDGTEVDGPS-AQKIRVSLNTKLA
G4QGN0_GLANF      DDQ--------------LSGQLAISSSLIDFHFDLSITGGAVDYSLTGNATRHLIATWIK
D7GDA0_PROFC      SSEG----------------------AARHAEIEVALPH-------------SLVSGQFQ
C7PDT3_CHIPD      GAEE------------------------QSVQVNLDIEG------------TLLKGTING
J9ZF24_LEPFM      FGT---------------------------LSLYRETGL------------IVQDPFPWA
A5GU99_SYNR3      ADG---------------------------------------------------------
F8L520_SIMNZ      VEQPK----------------------TIDLALTVPLDRG---------RIAHLEGTLGG
A9BB00_PROM4      VKR------------------------------DSLMED--------------NETGEIL
Q6MFB7_PARUW      NPSE-------------LFQIEFCTSCSEPCQIQKDQWLLPALQLNYSDQYQISIIGKLP
                                                                              

RECC_ECOLI        VQPDGLLRWRPSLLSVAQGMQLWLEHLVYCASGGNG---------ESRLFLRKDGE----
F7XY37_MOREP      VQVNGLLRWRPGTLSTRDGLLLWLEHLAYCAMGGEG---------ESRMFG-VHGE----
Q1LST9_BAUCH      IQCNGLVRWYPHNLSMKHGLQLWIEHLAYCAIGGNG---------QSRMFG-TNSQ----
Q5E7C0_ALIF1      RYQAGMLRYRGGKIRSHEILATWIDHLCLCAMGQ-Q---------QLTHLFGTD----A-
C4L7B2_TOLAT      VYAGQLVRHRVSKLKASWLVAIWLEHLALSAAGKLT---------QPTRLLALDNGKLG-
A8ZX08_DESOH      IGEQEWFRFRYATARPGDFITNWIAHLAWSVDQGRA---------GSGR---FAARDG--
Q2LTC9_SYNAS      LGSRGLLHYRYATLKGKDHLKLWIMHLLLHATDGPD---------GGDRESLLLGKNG--
Q3B473_PELLD      LRSSGQLFARPASMKARERMRSWIFHLVLCSLRPE----------GVDPETLLIMNNG--
B5EAR7_GEOBB      LRTDRMVRYRYTKLKAKDQLRLWVEHLALNCAKAE----------GYPLESSFVASDS--
B8FB93_DESAL      LGPWGLILYRTASAKAYDRLNAWIRHLFLCAVRP-----------GFENKSLFAGTDA--
Q7NQR0_CHRVO      LRPEGRLDFIVGKMNAAQRVALWLSHLILCASRPAG---------IAPHSACYDDAG---
I1YH96_METFJ      VTEQGLLRYRLAKLKGKDVMAAWLDHLVLNHLHPEG---------IALETRLITEDN---
E8RCD1_DESPD      VHRGGRINWRTGALRGADLVELWVHHLCLNLLAPAG---------VTLCSLHLARDSQAD
G4SZ17_META2      RYERGSLFYRYADLKGKDFMLAWLHHLM--INQIEP---------QQTCLIALDQ-----
M1P5P7_DESSD      FYSNGSFLFRYTLLKGQDVFAAWLHHCLSAICLDDA---------RETRLLAKDV-----
B0VLS2_ACIBS      SETQDWVSMEASSARAKRRAKVWLEYLLWLTYLNEG---------SAGTERRRIVVFSDQ
Q6FF17_ACIAD      HDVQDWVSLEASSARAKRIAKVWLEYLLWLSYLNEG---------DAGQRRRRIVVFSDQ
A6W6P1_KINRD      ATGEVAVTTVYSRIKGKQTLRAWVELLALSAAHPGT---------EF------RTVLVGR
H6N573_GORPV      VFGTGIVAATYSKVRAKHRLSAWIRLVALAAAQRCG---------AVGGPVIDSTTMIGR
I0HVQ4_RUBGI      LRASGLVRWRWGVLRGADLLEAWLHHLVLAAATPPG---------VAPRTRWLLTNGE--
Q60AZ6_METCA      VWRRGLVRWRYDDTRPVDYLSGWLDHLFLNALAVRG---------VEPTTTWISRDGE--
E1TB32_BURSG      LTGSGQVIFRYAKPTARDYLSAWLAHLAYCAALPDG----------PRRTVWHGSGES--
E1SLX9_FERBD      IGQRGQL----------KNPMHGLDLYLGHLVGCAA---------GLSLTSYLVGADTA-
D0KY94_HALNC      KLHRGQD----------IEWHKCVAQWPAHLLAQLT---------HGSVETYLIGETGT-
C1D6T7_LARHH      AGRGADTR-------WIPRLHTLVGFWPAHLALQAA---------GLAIPTLIVGETVT-
I3YAG8_THIV6      --------------GKDLKWYHLARQWPFHLAAQLE---------G-PVTTHLLGPDTD-
C0QI08_DESAH      YPRNILDKG-----GKLLLLYPLVPLWISHVAGCAM---------GIDLTSHLIAPDAV-
Q5QUQ7_IDILO      KNGKGINS---------GGWKHASAYYLGLLLLNLQ---------KPTRLLIVSKGGCQ-
Q1QYD4_CHRSD      KVEGTGPHR-----HVGKVHRLYGGYLRWLLANATL---------EAPCSWTAVFEDRC-
B7J9Q5_ACIF2      NKDSKK---------PEGDKLAALWLQQLLANAVGL---------R--CGGIVVGRDVL-
F9ZQ71_ACICS      WHGGK----------ARADRLLLWWLELTVLQTKRR---------EGAVLGLFLGQDG--
B1XZ24_LEPCP      AKPGKKDQGKGKAGPVRPDKLYRAWLVMLAAGAAGI---------A--LTGRIVGRDVT-
F4HF17_GALAU      NYQQQYVDWRIGKIRDQDVLKLWLNHLILSAMGQVT---------DSRFIGINKGN----
B8F7F2_HAEPS      CFNNEVVLWRVGGLRDKDIIQAWIYYLLLKANNHPI---------LSLRFYYRQGKK---
A6VQ90_ACTSZ      SPDKRRIAWRVGNLSDGFGLENWVYHLAKCATGEVT---------SSLMITR--------
C7LVF8_DESBD      LHGDRFVTCRPAKTKSSDMLRLWVRHLAASATGHAV---------QSMHIGTDDC-----
F2JZ46_MARM1      TNATMRVSYRLGDLTANQKIVYWLEHLLLSAQGTPK---------RHVFVNDVKGKVKT-
A1S6U9_SHEAM      VFAKGLLVARPGTAKAKDVLALYLRHLCLCASGYRQ---------SSFLLDVGNFH----
D6Z1F6_DESAT      RAELGLLRWRPGRSKPVFLLLAWLDHLALCARAPAD---------QDHQCLLVARGKGQD
E6WXK8_PSEUU      IYPQGIARVRFGQPNGPAWIRQGLDWLLAAAAGEPL---------PLVLFHEGEPGTGHG
RECC_BUCAI        IQSTGLLRWKTSSIRYSDRIALWLEHLIYSILGGCG---------KSKIIGYKSQI----
RECC_BUCBP        NSSGGLLRWKATKLSFQDIISCWLEHLLYCSLYKKH---------NSILIGTNHQI----
Q8D2T9_WIGBR      LQNSGLLRWNPKNLSLQDGFLFWIEHLIYCIIGGKG---------DSIFLGIESY-----
F8E602_FLESM      LSGSVNILARMAKIKDSDRIKAWLYHIFALYDLLQSNRY------SGEFSTLFYSEDKIL
Q480N8_COLP3      VKNNLLVHYRSSSAKAKDKFVMYFQQLVVQVWQDQAIANETNITDDNQRLQQVTETIGLY
G4QGN0_GLANF      HLIVCAHGNSATSEKTQPEQVESEQVESEQVESEQEENELVPATESAVSSVAVCIVKNTQ
D7GDA0_PROFC      LFDDRLLDHHFATVKAKYLVPAWIRLVAATAGGLPV------------REFVLVTRDKE-
C7PDT3_CHIPD      VFDGKLVQVSWSKREDKYLMEAYIRYLAGRAAGVLD---------GMCFISGASKRE---
J9ZF24_LEPFM      LRPPDLLRVFLAHLAGSLAFSFYRGTVLLNLAKDFP------------RTDSTDRP----
A5GU99_SYNR3      ---EAVVLMSNSRFKPKRLLDGWLEHLWANAERPQQ----------TLLLGPMEQKGEER
F8L520_SIMNZ      VTSEGLLFHG--EKKLHDLLKIWPLYLAFASSDQME---------KKKLLLTKTGER---
A9BB00_PROM4      IANNCTVLVEIGRLKAKTILNTWLTHLKLSAYHKST-----------KKTVVIARSDSNT
Q6MFB7_PARUW      FVSKKGLVVLSQGSGFSDAWKAWPQFLLFNYATTFN--------IEAIERNLILSKSS--
                                                                              

RECC_ECOLI        --------WRFPPLAAEQALHYLSQLIEGYREGMSAPLLVLPESGGAWLKTCYDAQNDAM
F7XY37_MOREP      --------WRFAPMNICQAKTFLLVMVTGYCQGMSSPLLLLPRSGGAWLSNSYDAMTKSI
Q1LST9_BAUCH      --------WCFPVLSSDEAKKYLLTLIKGYWQGMSEPLLLLNRSGGAWLTHCFNKKTRMI
Q5E7C0_ALIF1      -------IYHFGTIEKEKAYQELETILSLYISGNCAPLAYLPKAALAGLEAHVDKKGVWN
C4L7B2_TOLAT      -------EWLLAVLSADAAREQLLLWWQAFTEGMQRPLCLPVNTAWQWLEKATTESGCLG
A8ZX08_DESOH      -------WWAFDPVD--NGLSILAALIEIYRQGRLRPLHFFPRSAFVYAETLQKKG----
Q2LTC9_SYNAS      -------LWRYSAID--EARCHLEKLISLYREGLCRPLHFFPETSWAYAVKILRNGELSE
Q3B473_PELLD      -------AYRLRQPE--APGLLLQELLERYRSGQRMPLAYFPETSFSWEGKLE--KGEGD
B5EAR7_GEOBB      -------TIHLPPVE--ACTEHLDRLLELYRMGMTCPLKFFPESSLEYAKKSRDPKKAAK
B8FB93_DESAL      -------VYYYDNVKQNAAVTRLAALAEVYDKGMEFPAPFFPETSFAYAQSMFKTDDVGQ
Q7NQR0_CHRVO      ---------STLLHDEIDAAGLLVPWLARWKQGQAQPLPFFGRTSWAYAEALAKNPDKPD
I1YH96_METFJ      ---------MLHFLPVNNVTPVLNKLLDYYWQGCHQPLKFFDKASLAYFRGVIAG--KGD
E8RCD1_DESPD      VP-----LRSISLGPVAEAEKHLHQLLAFYWQGLTRPLPFFPETSWAWARA------EAD
G4SZ17_META2      ---------DITFEPDYCALGELEAWIEIYRQGLHRPDAFFVEPAFAYVKQAHKLSQSSR
M1P5P7_DESSD      ---------ELVFPAASATAEDLQELLSLFQRGQQTPSILMVEAVFAYAVQSAKNENGGR
B0VLS2_ACIBS      T-------VICKGISSEQARQYLQPWFKIWRYAQQQPLVLPAALLLKPLEKAKAYQWETT
Q6FF17_ACIAD      T-------VICEGVSSIQARDYLTQWLKMWQVASTQPVVLPAALILQPLEKAKQYHWVQQ
A6W6P1_KINRD      GDRGSTGLLTLGPVRSDAARDLLVDLLELRAVGLRFPLPLPVDTAAAWAQEAWRGRAPDA
H6N573_GORPV      ADRKAPGISVVRLAGPDDPLALLAELVAIRRLGLQTVLPLPLDPCAAYGIKRASGSSEMI
I0HVQ4_RUBGI      ----------LLLRAPEAPREQLATLLRLYRRGLAEPLRLYPKTSLALVRDGAAA-ALKC
Q60AZ6_METCA      ----------YRLRPVAAAQERLRELVALYREGLRLPLHFFPRSAWACALGLKQG-GSQA
E1TB32_BURSG      ----------FELAPVAAPLDELAPLAALFIAGRRLPLRFFPKSAWAKVSESDSA-AQGV
E1SLX9_FERBD      --------FCLPPLPRNAAQQQLSALMDHYLNAMTAPQPVAPRAALAYLAELEKSGDEDD
D0KY94_HALNC      --------LCFTPIEKEMAKQHLLTLLDAWFDAVQAPYPLACKTAFCLLAQEMTPENTD-
C1D6T7_LARHH      --------LQLAPLPADEARHCLQVLAGYWRQAHGEPLPLPCKTAGVWLQQQD-------
I3YAG8_THIV6      --------FRLAPLDAESAHDRLIQLLESFLEGLTTLPPLACKTGFAVLRAREDD-----
C0QI08_DESAH      --------AAFHPLDKAAAFSVLMDILTVFRQGLARPLPVTAKTGVAYVAALMAKDEQR-
Q5QUQ7_IDILO      --------LQVAPVPAELAVQQLEQILELVALSAQQPQPMHLDVGMTWLSAMDKNSQDEA
Q1QYD4_CHRSD      --------LSLPGMAAATARQQLATWLDAWARAYRMPWPAIGEVAQEIWKRVPRETCEAL
B7J9Q5_ACIF2      --------VRAAPPPPG-AIAALDDLLDLWQEGLCEPLPVTLKTALVSLQGK--------
F9ZQ71_ACICS      --------WLCAPAPVA-ADESLTELLAWLGEALREPHPLSLDWALALLADAERGDGAG-
B1XZ24_LEPCP      --------LELSPPPAEVARAALADLTGAWWASWRAPLAIAPRSALAALAEAPVLADADP
F4HF17_GALAU      -----IETTTFSAIDQNKAMAQVAIYLQDFLQAQGQICILPTTDFQQYQKLFAEEN----
B8F7F2_HAEPS      -----ANYLTFNDISQTEATEILNLYLQDYLASQTELKWALSDSITEYFNNKNKE-----
A6VQ90_ACTSZ      -----DKSVTLAAIAAERATAQLGVYVRAYLCAMNRIQCIPTMKITALLKCRSAD-----
C7LVF8_DESBD      ----------FPAPEAPNARNLLEGLLRLYTRGMRAPIHLFPRTSLAFAEARFTGRKPKE
F2JZ46_MARM1      --------LEFSAVTPDDAQLQLQIMLTLLNNGLRMPQLLPAKSSDTWCASYLNKKALEC
A1S6U9_SHEAM      ---------AFLPLTPDNALTSLEDFISHYFESVRTPSPLIPALAMTYIEALAEGASEEE
D6Z1F6_DESAT      EG--QADIRIFRAVAQEQAQSLLAQLLDLWRRGQEAPLPFFPACSHAWSDKIYQAKESDP
E6WXK8_PSEUU      P-------FVVAPPTQDQAKAALAALLQLREQGLAAPLPFMPYSGWEIHQGMDDYERSVP
RECC_BUCAI        --------WSFSSLNSHRAHSYLLEYIKGYIKGMKEPL-FLTKSGASWLDQVYDERNNCI
RECC_BUCBP        --------ITFYKLENKTAKYYLKKYISGYFDGMEQPILLTKSGINWINAIYDKKNNKFY
Q8D2T9_WIGBR      --------WHFKNINYKKAKHFFKKLLVGYELGIENPIFLLNKSGGAWINHSFNKEKNKL
F8E602_FLESM      KFEDYTDLYKNDEKMYENLHSYVRFIVETYIYGSVNPLPLFPVFGCSYAKKIIKG-----
Q480N8_COLP3      FNTKAQKVEQFNVANIADAKSKLINLVKMFFKGQQQVLLLNGELADQVFTKKRGQ-----
G4QGN0_GLANF      SKTVSIKIEQFSVIEQQQALAYLSTLLDIFTRGLERPLLIAPDLADKLMSGIQADPDFEP
D7GDA0_PROFC      --------VHLAPPPQQVATRILRQLVEMRRRGLREFLPLPLATAWTYARAQHAHTSGSD
C7PDT3_CHIPD      -------AFEAIPLAQQEALRRLTALVKIFREGFEKITPFYPDFDIKPADVAGLD-----
J9ZF24_LEPFM      ---------VLWSSEPEEATRLLRPYLVLYRRFRTRTFPFVPAVSLAYALEQRNQRGRGP
A5GU99_SYNR3      -----AAVWTLPAVEAQQAKAWIDDWQQWREEALQRPIAWIPELNWQLLSQQQDGSLPGL
F8L520_SIMNZ      -----------LSFPKLDPQHALASYLLYYEKALTHPSPFLPAWGQTFLEKGPQE-----
A9BB00_PROM4      KIDSYEVMLSWHPMSSIKAESILDELKQQAHNGLKQCWPVPPESGWKLAKARYKKS----
Q6MFB7_PARUW      ---------EVKKAFFKDSIPYLKHLINYYALSMRNFSPLFPDWIPSLIEGDEQAIQNYM
                                        .                                     

RECC_ECOLI        LDD------DSTLQKARTKFLQAYEGNMMVRGEGDD------------------IWYQRL
F7XY37_MOREP      DRN------ERRQFQARNKLIQAWQGNYHVPGEGTD------------------PYLQLL
Q1LST9_BAUCH      NWE------KDCQRTARNYMIKAWEGNHLFPGESSD------------------LYLQKL
Q5E7C0_ALIF1      DD-------EETHQKALKKMADEYNGTRFA-GENSN------------------DYVIRM
C4L7B2_TOLAT      DDA------QQLQAREAAQKTYTGDGTFVS-GEGQD------------------TYLARC
A8ZX08_DESOH      -NASM------ALDRALQAWRGNE--RVA--GEKED-------------------PFYAL
Q2LTC9_SYNAS      EAEES------AWDAARKAWEGDD--FQR--GEGVD-------------------HYNRL
Q3B473_PELLD      -----------ALKAARGAWRTSG--FGGARGEGDD-------------------PAFRR
B5EAR7_GEOBB      -----------ALADALGKWHGSE--FYE--GEGKD-------------------EHCRR
B8FB93_DESAL      -----------AMKAARNKWGPDF--YGR--GEALD-------------------SYAAL
Q7NQR0_CHRVO      K----------ALAAAWQKWEPNFILGDGVAQKDEP-------------------AIALA
I1YH96_METFJ      A----------AIEQARKVWSS----GNLHVTSEQD-------------------DPYYQ
E8RCD1_DESPD      R----------AEEEARKTWEG----GFLREGEGRD-------------------PAYGY
G4SZ17_META2      AAKP-------AIESAIDQLTRAI---EKAYEPELR-------------------KLFLE
M1P5P7_DESSD      TA---------PISRAIKSVEDSL---NRGFEAEWE-------------------LLYQ-
B0VLS2_ACIBS      N-----------PTEKIKLDEKSYAELLKYWNE-TGTFTSIDMTQNEACKLHQDWRFILQ
Q6FF17_ACIAD      -------------SDQFQLVEKDLLNILKEWQD-PKAYMQIDTSQLESSQYHLDWSFILQ
A6W6P1_KINRD      C-----------LRAARRAWTSDFSFDKEDRQE----ENVTVWGAERPVEHLVRWEPPTT
H6N573_GORPV      A-----------LNAAATSFAGKFGAHTDPYLRLVYGADVTASVDFDTLTSVCAADTAPW
I0HVQ4_RUBGI      W-----------TPGERTPYAEGGE---EAMRL----------------------AWRGR
Q60AZ6_METCA      A-----------ERQARKRWEGSGDRRGESEDL----------------------AYRQA
E1TB32_BURSG      W-----------INDRVRG---------ESDDP----------------------ALRIA
E1SLX9_FERBD      ---------RAALDKAELAYEGGFALTGDRDRSPYL------------RRQYPAFADLRD
D0KY94_HALNC      ----------SALKKARECFEGNMKVPGEVTNSPAL------------ARLWPDFSTLIN
C1D6T7_LARHH      ------------ASAARQAYEGGYHSTGERAESPAL------------ARLFPAFEDLDL
I3YAG8_THIV6      -----------KGCPFSTYEG-GFNRAGEREDHPGY------------TRFWPTYAEL--
C0QI08_DESAH      ----------AKNDAARVYAGDGFNARGELGYDPYL------------QRTFPDFDALWQ
Q5QUQ7_IDILO      ---------LAHEAARQKYEEDGFQDPALVTKSDYC------------GRVAESYEAIQA
Q1QYD4_CHRSD      QAGEPLESGLREALIARYETDAYAGPAALRARDGAL------------GQLWPDFAAFEA
B7J9Q5_ACIF2      --------------NPAPIYDGNDRLPGEARKDLSL------------FRDYPDFATLSS
F9ZQ71_ACICS      --------------SRRHILGDGLGAAGAWRENWLL------------QRHFPNPEAVLE
B1XZ24_LEPCP      -------SGPRPWPLDAWIAAERTYDGGTFTRRVPP------------ESDEPSLARVFA
F4HF17_GALAU      -------------SGEAQLYRQLMEQQSSNEFDKSQ------------------PYWQRL
B8F7F2_HAEPS      -------------LDPSKILKKIFDINKN-------------------------PYLTRI
A6VQ90_ACTSZ      -----------------ELRRLLDNAARPTDYNRGD------------------PYWRRL
C7LVF8_DESBD      R------------PEALMQAMRQWEGGYMVSPERDD-------------------PHLAF
F2JZ46_MARM1      E-----------ETAFSKSLETYQELDDEYHSVEVS------------------DPYWQR
A1S6U9_SHEAM      S-----------LAELSTKWDDGNGMGEIAEPHNERLFEFPASFATPAFTVVAERLWKPL
D6Z1F6_DESAT      ---------AKLCRQARQAALQAYHGGDFHPGDGAD----PYVGLIFQEADPAGEWSEDD
E6WXK8_PSEUU      KAR-------GRWHGNGQFFAEGEDASVRLALRGCD--------------PFAEPAMLRR
RECC_BUCAI        KNDYY------TKIKAYKKLLYTWKGDNYTEGEQED------------------YYLKKT
RECC_BUCBP        TNT-------NKNLNAYKIFLNTWNGNNWITGEKDD------------------PYIQKM
Q8D2T9_WIGBR      ILDEK------TKKNARSKLISAWQGNKFINGDSQD------------------FYISKV
F8E602_FLESM      ---------------ESADFGRSWWAQNVYKNDDKF--------------------YLEK
Q480N8_COLP3      -----------LVEMTQARFEGLWIGDMSTRGLSDD-------------------DYLSY
G4QGN0_GLANF      FSASA--DDYFHHPEIANRWSTFFDATNFPSPFVVD------------------KYFTHY
D7GDA0_PROFC      R-------ITSNAYRREGRYSALWGDYLDLDWRALA-------------------ALPAD
C7PDT3_CHIPD      ------------FSKFSKKVDKALDKGDDITIDPYI------------------SREYEN
J9ZF24_LEPFM      DPR-------KAIAAAQTAWRQLDPWRTDHGQKNSWKSPFR------KDPRRREGFYPHL
A5GU99_SYNR3      S------------AQQLKELNPPGRNDYEWPSAWLQ--------------------LLGG
F8L520_SIMNZ      ---------------LAKKIEDTTDPYALWIFRPHQ------------------------
A9BB00_PROM4      -------------NDCNEIFRRAWIGDFNKEGERNK--------------------PEMQ
Q6MFB7_PARUW      K------------QVFSNSFGAFLNQELRWVFNKDH------------------LPCPKI
                                                                              

RECC_ECOLI        WRQLTPETMEAIVEQSQ--RFLLPLFRFNQS-----------------------------
F7XY37_MOREP      IRQLEAKHIEAMILAAE--RYLLPPVMFNIAHCEPTKRKKK-------------------
Q1LST9_BAUCH      ILQLNENYIIAIIKAVE--CYFLPPLKFNISNKVDLVN----------------------
Q5E7C0_ALIF1      WPEWNDEFGQVIFDNAQ--KVLRNALLHSEKEKL--------------------------
C4L7B2_TOLAT      FPELSSEYWEEIEEWAV--QLLLPLRQHLQEAEA--------------------------
A8ZX08_DESOH      WFAGDDPLDDEFETLST--AVVTPLLACRRPDGPPRTV----------------------
Q2LTC9_SYNAS      CFGDFSPQDVEFQELSL--NVYRPLLETQWKKKSNRKAP---------------------
Q3B473_PELLD      CFGEAGFDSEAAGPLYF--RELAAALVRPVLQHSEAVK----------------------
B5EAR7_GEOBB      CFGDDAPLDEEFATLAL--QVWEPLLELQKAKGKGKDRL---------------------
B8FB93_DESAL      CFEGLDPLSREFRDLAV--EVYAPMLECEQKGGR--------------------------
Q7NQR0_CHRVO      FRHQSPLEDPLFAQLAE--TLLLPLAERLQGGEA--------------------------
I1YH96_METFJ      LLYPDSPLDDLFTEIAE--QIYQDIVSHLQGGKL--------------------------
E8RCD1_DESPD      FFSGSELDLSEDFFRLA--ALYHPILDHVEDSRAAA------------------------
G4SZ17_META2      GYNPVELLNEIFEDHCR--TLLLPVWELIDGKSED-------------------------
M1P5P7_DESSD      GRSADSFLEQEFIDLCD--WFYESIWKRAYVSELI-------------------------
B0VLS2_ACIBS      EQDAQALLQHACDEFAY--DLYHPVFQFQHSE----------------------------
Q6FF17_ACIAD      QQDATALLKDALQRYSY--DLYAPIFQYLRLE----------------------------
A6W6P1_KINRD      LPPGVPT---TFEGLVR--RVWEPLLGVQRMDER--------------------------
H6N573_GORPV      AQIGLVSGEPVFTTLAR--RLWGPVVEHEVIR----------------------------
I0HVQ4_RUBGI      ---EAEALAGDFEQLAH--TVFGPLLAHAEGSALE-------------------------
Q60AZ6_METCA      LRGQADPLDGAFFRTVR--TVFGPLLDHLEDGRIA-------------------------
E1TB32_BURSG      LRGTPLTLDEPFGSLAS--IVFKPLLQHVRSAS---------------------------
E1SLX9_FERBD      ---------TEFPALAQ--ALYQPLREMEEVTHGA-------------------------
D0KY94_HALNC      G---QSFAKKQFTELSQ--IIYAPIKDAIEAR----------------------------
C1D6T7_LARHH      ---------ARLDALAT--DLYAPLLASVTVPESAA------------------------
I3YAG8_THIV6      ------SADAGFEPLID--RLYRPLFRHCLDQEGPSS-----------------------
C0QI08_DESAH      ------ARDNFFKDLAA--TLYLPMVQAVE-REG--------------------------
Q5QUQ7_IDILO      --------SPHFRRFMD--ELYDPMRLTLVPEDKS-------------------------
Q1QYD4_CHRSD      ---------AGGVAASL--TLYAPLLDMLAQVTQRVHGGRA-------------------
B7J9Q5_ACIF2      --ARTGPQRRGFAEYAA--ALYRPFAGWLETLEWQAHP----------------------
F9ZQ71_ACICS      --WRSSA-GLSALDLAR--RIYEPYRRWLAAVQPLADGLELSGPQLLQRAVDSVSSLREA
B1XZ24_LEPCP      DWEALGARADEFQHWAE--RLYRPLRAWALNTERVKAQPLPQAVLLDDDAQDDERDDGED
F4HF17_GALAU      LVQTKNLDYAAIKQRFT--DWFAQMLEQLEDNATS-------------------------
B8F7F2_HAEPS      TEQSEALDLTTISDRME--SWFSLMYMSIKT-----------------------------
A6VQ90_ACTSZ      LLNLDDGELTDVLPTLT--DWFAMLVDAYEKA----------------------------
C7LVF8_DESBD      LFRDTEPDWERFADVAE--EIYGPILGGAE------------------------------
F2JZ46_MARM1      FYPNLSAHRAAFEQNVR--AIWLPLHHHLKPLENKA------------------------
A1S6U9_SHEAM      LCRCHRGKLGELADFVSNPSSIPPILSHEADAYRCEADEKADKVTHQRQGE---------
D6Z1F6_DESAT      SSGPGGSDWEEFTAVAE--TVYLPMLRVLEKAGEK-------------------------
E6WXK8_PSEUU      FVEASHSIYAAVTGAALSSPVDPLMLKGLASRHDAEDAA---------------------
RECC_BUCAI        ITISNKKNIKKICESAE--KWLIPILKNKG------------------------------
RECC_BUCBP        IVYLTKKNIQKIYKTTK--KWLTPILKNISYSKYH-------------------------
Q8D2T9_WIGBR      IPFLTENNINKIINESK--KYFIFPLKFNKLLK---------------------------
F8E602_FLESM      LYGDVIPGTENLKELSR--IIYLPMLQKESFVGT--------------------------
Q480N8_COLP3      FWPECPQYHNHQADIEFIYQDLYQVVAKQAAKKASKTTAKPSKEAK--------------
G4QGN0_GLANF      FPQYIEKDKETISDLLAIYQPLKKHMLTKITVKSGAKSGAKTARKGRV------------
D7GDA0_PROFC      PDDPITASESRFKNLAR--WLMDPLLDAMAADDQAGAWR---------------------
C7PDT3_CHIPD      GFFKDETMLDTYKVICS--HLLVPLAEIIPGYYN--------------------------
J9ZF24_LEPFM      FFDPEGDWIKDPFFGLLAQKLWNPILDRLFPDGQEGER----------------------
A5GU99_SYNR3      EAPSIASWLEHPEAEQLSLRWLLPLSEALAAGGRQL------------------------
F8L520_SIMNZ      --YDADILFETWATLLQ--TTFHPLQEALNDDL---------------------------
A9BB00_PROM4      LCFGYKAAPEIFLENELFDQCLELLYKPLIAQLVK-------------------------
Q6MFB7_PARUW      LIESWQEIGKQLAGDLI--QLWYPPKKKKGEDA---------------------------
                                                                              

RECC_ECOLI        --
F7XY37_MOREP      --
Q1LST9_BAUCH      --
Q5E7C0_ALIF1      --
C4L7B2_TOLAT      --
A8ZX08_DESOH      --
Q2LTC9_SYNAS      --
Q3B473_PELLD      --
B5EAR7_GEOBB      --
B8FB93_DESAL      --
Q7NQR0_CHRVO      --
I1YH96_METFJ      --
E8RCD1_DESPD      --
G4SZ17_META2      --
M1P5P7_DESSD      --
B0VLS2_ACIBS      --
Q6FF17_ACIAD      --
A6W6P1_KINRD      --
H6N573_GORPV      --
I0HVQ4_RUBGI      --
Q60AZ6_METCA      --
E1TB32_BURSG      --
E1SLX9_FERBD      --
D0KY94_HALNC      --
C1D6T7_LARHH      --
I3YAG8_THIV6      --
C0QI08_DESAH      --
Q5QUQ7_IDILO      --
Q1QYD4_CHRSD      --
B7J9Q5_ACIF2      --
F9ZQ71_ACICS      AQ
B1XZ24_LEPCP      A-
F4HF17_GALAU      --
B8F7F2_HAEPS      --
A6VQ90_ACTSZ      --
C7LVF8_DESBD      --
F2JZ46_MARM1      --
A1S6U9_SHEAM      --
D6Z1F6_DESAT      --
E6WXK8_PSEUU      --
RECC_BUCAI        --
RECC_BUCBP        --
Q8D2T9_WIGBR      --
F8E602_FLESM      --
Q480N8_COLP3      --
G4QGN0_GLANF      --
D7GDA0_PROFC      --
C7PDT3_CHIPD      --
J9ZF24_LEPFM      --
A5GU99_SYNR3      --
F8L520_SIMNZ      --
A9BB00_PROM4      --
Q6MFB7_PARUW      --