CLUSTAL format seed alignment for MF_01487

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RECD_BUCAP        ---------------------------------MNMSHLLQNFANKKIITLVDFY--FSQ
RECD_BUCBP        ---------------------------------MTITSILQKMVKLKIITSSNFY--LST
Q057F4_BUCCC      ---------------------------MLSKNIKKFFKIIKIAKKKKEINCIDYYTCINK
Q72NZ2_LEPIC      ----------------------------MGEIELIFIEKLRTDILELIQSSEFEKKKLIK
B0SUE9_LEPBP      ------------------------------------MKVIDEKIQSFLNS-------LYK
I6XV14_PSEPQ      ------------------------------MAATGLLRAFAEAGMIHVADFHLARRMAAY
K7S5A9_ACIA4      -------------------------MPDLIPVAAGHLAPFCRTGVLEAADVHLARLICRA
D6Z1G4_DESAT      ----------------------------MGPEMAQLMERLVKEEVLAEFDRHWLELLARL
E6WXK6_PSEUU      ---------------------------------MSLLEDLRREGALRTLDHALALSLRRL
F9ZQ69_ACICS      ----------------------MPHAPRDRSRILELLDDWHRAGWLGPLEPVLARWLAER
A8ZX10_DESOH      --------------------------------MDGYRDIQAAMPMLGELDRRFGELLTAL
B8FB95_DESAL      ------------------------------------------MIEFEAIDGQFAAFLQKL
E8RCC9_DESPD      ------------------------------MNPAHLLDFLLAGHWLRPIDVQAAQLLERI
Q2SQD7_HAHCH      ------------------------------MSIAHLIDAARQSNLLRPLDYYLGQQFAEL
B2JKV2_PARP8      ----------------------MSTFDQPLPDVKVNVPAPADFSTALAEGFARRVSALAL
C7LVF6_DESBD      --------------------------------MFASPAILPRLAASTLFSEADLYQARFA
RECD_ECOLI        ------------------------------MKLQKQLLEAVEHKQLRPLDVQFALTVAGD
Q1LST7_BAUCH      --------------------------------MENIILQAQKLGLWRPLDIHFAHLMVAL
Q15V09_PSEA6      ---MVSKLMIKNDVSTPQSQQTQVQASPEPPTTASILQSLLSVGRIRPLDVAFAEFIMLH
F6DBR2_THICA      ------------------------------------------------------------
Q6ANK0_DESPS      ------------------------------------------------------------
Q2LTC7_SYNAS      --------------------MTDLLKRILRKGEMPMLPDEALLFYFSDLDRHFGRLMEKI
F4HA57_GALAU      --------------------------------MLALLQQLRDQKLIENIDYYFADYIARQ
I1YH94_METFJ      ---------------------------------MFRALSLLRQCGFSEIACQFADFIERK
D5VBZ2_MORCB      ----------------------------------MAGDIISRYVTDRIQDNHQWYAKKQV
A5WER9_PSYWF      --------------------MKSNNNTATMRVEESWADTISDYILQRRAQTYAAYVQPSD
Q6FF15_ACIAD      -------------------------------------------------------MDKQN
A5EVY1_DICNV      ------------------------------------------------------------
D6YTF0_WADCW      ---------------------------MASNSFPHRFSTLESAVKLKALSVVDLEFAKML
C7PDT2_CHIPD      ---------------------------------------------MHTINDVHQQFAEYF
D4H409_DENA2      -----------------------MPTGRAGEKMINLLLQLQEQKLLRDIDIYFARNLADT
Q5QUQ9_IDILO      ------------------------MTEVTSNTLFDALREWRDAGWIRSIDLAFVEFLQQA
F8E604_FLESM      ---------------------------------MGTLDELLEKNLINEADYYFARHLFTD
D0KVH2_HALNC      MNRPYAKQMAFDLDQPSDSAPINLTSRRPSAELLDILDEWVAAGWMRSIDRAVAGLVLNH
I0ICH2_PHYMF      ------------------------MSPFSAPSPTPQGAWHPDAGEASPRERAVAASVERA
B4RLU6_NEIG2      ---------------------------MPSDGISTRNTMELQTDEFAQAAARAAIRFLER
Q480P0_COLP3      ----------------------MVDNSMNKPVYSRFSQVKDTIQGVEAIDYFFAKEMLSP
D5ELP9_CORAD      ------------------------------MKELSRAFAAALLKHLRPIDISLGIKVLSG
F5ZCK1_ALTNA      --------------------------MINSHEYLEQLFGIEAIDRFVALEFAHCESLTDA
L0DJ49_SINAD      -----MRPLTELSPSGTARAVVATGLPPSEDDEAALLAWLRPVRERIAASFNLEEEVAFL
A0Q7L6_FRATN      ----------------------MLVYLMEMIMYKTFHKACEQLADIRAIDFFFAKEVFDL
G4QGN2_GLANF      ------------------MLFSLPPAISKKIGYATCTDCLLVLADIQSIDYYFANNAIMQ
J9ZC99_LEPFM      -------------------------MKDLPEDFSAWCDREQEAGRMADIDRGLLILTRRG
I0IR81_LEPFC      -----------------------------MPSDSGILSAERNSPGFGILENSFADLLVRL
D3PC94_DEFDS      ---------------------------------MMVLDILLKNKIIGYFEYEVAKWVYEN
G0AM73_BORBD      -----------------MRDFLVLREFLKDKSKKFLTPELKLYEIIELLNINKKNCYKAQ
A9BB03_PROM4      ------------------------------------MNKENTHQIKPELKNALAKVLLER
Q9JRZ2_CHLPN      ----------------------------MHTEFAPFLEDLVHQQVISPLDIAFASKHISS
                                                                              

RECD_BUCAP        FISKKNS--------------------------IIMLISACVSFESKNGHIFLPIEYFEK
RECD_BUCBP        MLFNKNT--------------------------LATFLSICVNHFTNHGHVCLPHVLIQH
Q057F4_BUCCC      KISNYSP--------------------------EVILVILYLIYSARHGHSCIPKKHFVK
Q72NZ2_LEPIC      VSEEDSN--------------------------YILEILNSIWEATQEGSLCVPVKQEWK
B0SUE9_LEPBP      LFPDWDT--------------------------SLKDTIASLLVQSQSGDLYLPITDDTT
I6XV14_PSEPQ      CGESDDQ---------------------------VLLALALTVRELRLGSVCLDLACAPE
K7S5A9_ACIA4      GGEPSPD---------------------------VELAAALTVRELRLGSVQMDPATIRR
D6Z1G4_DESAT      QPQSSPA---------------------------LLLTAALLRRAVDLGHVCLKLPEVAA
E6WXK6_PSEUU      DPSTPDA---------------------------VAVAAALASLAVSAGHAGFRIDQ---
F9ZQ69_ACICS      DPDIAPE---------------------------LLFLAAITVHLEGLGHTGLDVPAFFA
A8ZX10_DESOH      DPGGGKE---------------------------LFLAAALTLWHTRRGHVCFDLNRA--
B8FB95_DESAL      AGGSDPV---------------------------LQSAAALVSLKTREGHTCVELN----
E8RCC9_DESPD      DQGCCPQ---------------------------LLLAAAFASWATGQGHTCLPLSVL--
Q2SQD7_HAHCH      ATAATEEQ-----------------------RELLALTVALTSNALANGHTCLDLSQY--
B2JKV2_PARP8      RGGASEDA-----------------------VRWAARAAFSASRATSEGHVCTSLDEL--
C7LVF6_DESBD      ASLAREGH-----------------------ANLVAGLTALVSLAVREGHVCLHLGDE--
RECD_ECOLI        EHP------------------------------AVTLAAALLSHDAGEGHVCLPLSRLEN
Q1LST7_BAUCH      SHST----------------------------DALFLASACLSADVGMGHVCLPLSLLTP
Q15V09_PSEA6      ERNKLAVNT--------------------AGIHALGLLAAYLSSRLGEQDSCLNLDGFYQ
F6DBR2_THICA      ---------------------------------MTIQTQNATDSATLSAESDVTNSFLDH
Q6ANK0_DESPS      MADNL---------------------------LEKHFTEFLTGISGLAGEEALRFSGIIS
Q2LTC7_SYNAS      SGGDN---------------------------QDVFLAAALTSRSNRGGHVCLDLAEYAG
F4HA57_GALAU      GQSQTE-----------------------AINDLAALFAALLSFANQQGHSCLFLTKNVL
I1YH94_METFJ      TQ---------------------------GEPLTTSLTAGLLTEAVSQGHVCLNLHQVPA
D5VBZ2_MORCB      LAAECTLRL--------------------LDFELYHIVQDALLFQLNQGHTILHINDH--
A5WER9_PSYWF      TNTSTNFVE--------------------TDSYLFKSLFMVLAKQLEEGHTVLTLRQNST
Q6FF15_ACIAD      ISKDTDLAW--------------------LETWSKYLVQTPFNLG---------------
A5EVY1_DICNV      ------MPI--------------------NDTDKNHFIGAFLAQR---------------
D6YTF0_WADCW      LEST------------------------SEADELLAALICHLTKSAREGHLCIKKTSLGL
C7PDT2_CHIPD      QIPA------------------------------LKPYAYLLSRKLSEGHICLHLNKP--
D4H409_DENA2      FGAPEGA-----------------------------LLFALVFNVTEGGNTCLNMAEP--
Q5QUQ9_IDILO      GETRSEV----------------------------LLAALCASHEAGRGHTCIDIKALQN
F8E604_FLESM      KIKNSKS--------------------------ELPLLAALISSLNREGHICVDFESL--
D0KVH2_HALNC      AADISAP---------------------------ALLALVLASHQAGQGHVCLDMNACLI
I0ICH2_PHYMF      AVDAGDAPE---------------------IAAAAGRLAAAVVAAEARGSTCVSLADL--
B4RLU6_NEIG2      YAGSGNE--------------------------VLANCTERLFQALQNGHSFIRLSGD--
Q480P0_COLP3      LTALTNNQSLTEDT----AGSGSDTTANISCQHNLYHLFLALSASLRAGHSCLPLSEVAD
D5ELP9_CORAD      SPLKPRPS----------------LHELIEPKARLFWLAALTSYAQGQSHSGLYLDASSS
F5ZCK1_ALTNA      EQVIWLHLLVTLSF----MQRSGHSCLLLTEVAGARLFVEPLLESEAESEAELEAKLETD
L0DJ49_SINAD      AWELGRLPPGLN----------------REERAALILLALTALIALRQGSTRLPFRDRAI
A0Q7L6_FRATN      VKKTTPSMTTLSSESYPPLHGAKGNDLEQKSNEILFHILMKLMHVYSHGHSCLKIADISN
G4QGN2_GLANF      RYEYEAEHVFFSDQ---------------QSLAQLFHMLLALSYFQRQGHSCLTISAIAD
J9ZC99_LEPFM      QPQTGSEEE----------------------TLLVLLMVAILSRARRDGHVLIDLDEV--
I0IR81_LEPFC      YGNGHREDE-----------------------NLFGLLAATLLLESRQGNVVCHLEKLAG
D3PC94_DEFDS      TKNP-----------------------------LIKNIFLLLAYSYENGDSCLDLKCIE-
G0AM73_BORBD      TLAKFTNNE------------------------NIAIFLIFLFNYFDKGHLRADINLLAK
A9BB03_PROM4      IPTSASQPH-------------------------LQDLINILLESLSRGEIYISLDES--
Q9JRZ2_CHLPN      DFEES------------------------------FVFLAVSSALWRYGHPFLSLEEN--
                                                                              

RECD_BUCAP        NCFF------------------------------------------------SISNKQFI
RECD_BUCBP        QKIF------------------------------------------------FTNHIALI
Q057F4_BUCCC      KKIK------------------------------------------------RKN---VF
Q72NZ2_LEPIC      KILK------------------------------------------------IKLPGLVV
B0SUE9_LEPBP      IDKM------------------------------------------------KDYFPFVI
I6XV14_PSEPQ      LI-----VPGEAD-----------------------------DGSVVEP-----------
K7S5A9_ACIA4      DV-----ARQILD-----------------------------PAVVAAAGPGELAALEEF
D6Z1G4_DESAT      W------WPAEAA-----------------------------AMGYAAPSPSTLLAELRH
E6WXK6_PSEUU      --------PRALV-----------------------------DLALEWPAPAQWQAGLEA
F9ZQ69_ACICS      QPLYYLDWPEQAG-----------------------------EALEEFLAQTGSGPETWQ
A8ZX10_DESOH      ------------------------------------------DAFLTDGLDGVSLPDG-R
B8FB95_DESAL      ------------------------------------------SGLDQDCLLSPDCPENPA
E8RCC9_DESPD      ------------------------------------------PELLAAAGVDNAAYRDSG
Q2SQD7_HAHCH      ------------------------------------------AGRSLWPDSAEEDMRAFI
B2JKV2_PARP8      ------------------------------------------AQRYEAEVAHVRCALLAS
C7LVF6_DESBD      ------------------------------------------GVRERLAALGLDGTHACQ
RECD_ECOLI        N----------------------------------------------EASHPLLATCVSE
Q1LST7_BAUCH      DTLF-------------------------------------------EGLHPKLAQQAWQ
Q15V09_PSEA6      PFLPFYRFDSAPVLMSILEASSCVSVVEEPRFNQASDAVAGSDTRSDTGNNTSSHDRYSS
F6DBR2_THICA      RLAAFFAPDNP----------------------------------------ALAKIIKTL
Q6ANK0_DESPS      GLMQHLAGGSS----------------------------------------CVELAKGEL
Q2LTC7_SYNAS      RPLMADIREEPE------------------------------------DEILEEMPESIL
F4HA57_GALAU      ENPFELKYQPEQ--------------------------------------QALLQQIEDL
I1YH94_METFJ      VTKGVSDYLPEQ--------------------------------------VATWTEILKT
D5VBZ2_MORCB      --DDLNNRHGLNGMIPIWQQKIMDSCLTVIT-----------HALANEGMDWAAF-----
A5WER9_PSYWF      ELALQGRVAGKAAKLYAWQRDILQSLAGPLF-----------DLIDSDAALAAIAQSQED
Q6FF15_ACIAD      ------------------------------------------------------------
A5EVY1_DICNV      ------------------------------------------------------------
D6YTF0_WADCW      SPSPE-------------------------------------EIWLRDCEEDIPSE-LMQ
C7PDT2_CHIPD      --------------------------------------------------------VEAA
D4H409_DENA2      ----------------------------------------------------EKISFYKS
Q5QUQ9_IDILO      EPES-----------------------------------------VLNLPPENRYSPNCV
F8E604_FLESM      ----------------------------------------------------------HL
D0KVH2_HALNC      DAKSLLRIPSGDGRGND------------------IQAVPRFTPADLLQGVTLTGWQAAL
I0ICH2_PHYMF      ------------------------------------------------------------
B4RLU6_NEIG2      ------------------------------------------------------------
Q480P0_COLP3      QHWGKGFTSTKKKN----------------------------NVNKDNQQDSEGLTEEHT
D5ELP9_CORAD      LADVLD----------------------------------------SSDQDLTDADISLL
F5ZCK1_ALTNA      SEQEQERELEIDPDSRPWIESEPQS-------------AQVLYVQPEPTTSDSVTSSRKL
L0DJ49_SINAD      RLEI--------------------------------------------ARQLLQEEGSIP
A0Q7L6_FRATN      K---------------------------------------------------TIFASEQS
G4QGN2_GLANF      QIYWS-----------------------------------------EADVIQNEQALSQK
J9ZC99_LEPFM      ------------------------------------------------------QHHPWV
I0IR81_LEPFC      KPVP-------------------------------------------------------P
D3PC94_DEFDS      ------------------------------------------------------NRDLLE
G0AM73_BORBD      DIQNTIIFTKDNLEK---------------------------TNKSYNKLIKMLKELETF
A9BB03_PROM4      ------------------------------------------------------------
Q9JRZ2_CHLPN      ------------------------------------------------------------
                                                                              

RECD_BUCAP        NKILKCLNKKKINWSLELSEHISCGDGSIITPLVFYKDKIYLYKIWKAEKKILERLYEKN
RECD_BUCBP        TKLWEIAKINTCGWIEQLLNSNTISNGSKNTPFIFYKNNFYINKFWLAEQKILKFISQKQ
Q057F4_BUCCC      IKLLNIVSKNNINWFNTVISSMLCSNGTQKTPLVIDKKYIYLYKYWYSENKIIELLYQKK
Q72NZ2_LEPIC      DRFENTEW------------------------VYFEKTYRSKIELERLL----KERIEND
B0SUE9_LEPBP      ERTGKENR------------------------LYLQKSHSEKRNFESLLFTFLNHKTNQT
I6XV14_PSEPQ      VELPWPEPQAWAAAVAASSAVAGPGTGP--RPFRLADGLLYLDRFFTEEQ----------
K7S5A9_ACIA4      KALSWPDPSAWLEELGVSPAVAGPMAPANRRALRLDEGILHLERYWQDEQQVAQLMAGLA
D6Z1G4_DESAT      SALVDSLEPGACSHLQGATEHGPPQVAV--APLVLSDNRLYLRRYWQYEMALADEIRARA
E6WXK6_PSEUU      SRWVAR-----------PADPADEAQGS--APLVLEDGLLYLRRYREYERRLAAGLRRLG
F9ZQ69_ACICS      AALIRG-GRMLAQHHDCSPPISSQRGPE--TPLVWDGRRLYLRRHFRDEWEIARQLQSRA
A8ZX10_DESOH      QWADILSRSAVVA----------RPGGDPAPLVLDGEGRLYLHRYWAYQEQLADFIRSRA
B8FB95_DESAL      QWIDALANSPVVG----------APG-EYRPLILDQAGRLYLHRYYEDQALTAKKILEWS
E8RCC9_DESPD      QLRVQLLRSTV-----------VGAPGDLRPLILDADNHLFLHRLYRDETVIARALSRRA
Q2SQD7_HAHCH      APSLKLWREALLASGLTQADSDIGDAGPVSPCVLDDRNCFYLARYFEYERQLAGLLQQRI
B2JKV2_PARP8      GVASDGMQPAYAL----------------RPLVVDGQGRLYLARYYDYERRLAQSLVDHA
C7LVF6_DESBD      LTGVVGAPGSG------------------LPLILDGE-RLYFSRFFRDEEALARAFMRLA
RECD_ECOLI        IG---ELQNWEECLLASQAVSRGDEPTPMILCG----DRLYLNRMWCNERTVARFFNEVN
Q1LST7_BAUCH      QAGSLQLNDWQNLLLTSPSVSDGSRSTPLVLDK----QQLYLHRLWQDECTVAHFFQRSM
Q15V09_PSEA6      AQHLPAQQLSAKQLHTHQAQEHQSQSKPLILQG----HELYMQRYWQYEVQLAEKINSMT
F6DBR2_THICA      SRAQSEGHSCIQLNSEQQAIIKNNPNDAWVLDG----DLLYFARYHQYETELAQALKQRA
Q6ANK0_DESPS      ALLGK------STLSTQVAGIDETPLTPLVLYG----RRLYLQRYFVYEARLARQLLDYA
Q2LTC7_SYNAS      LSCPPLSIWRETLLACSVVGTPGEYKPLILDDK----SRLYLYRYWSYEDTLVRFIKSCG
F4HA57_GALAU      LAPYDVKALLANLVQHPAFSMNDQQNTPIVCKKIGEIDALYFHRIWQDEHYIAARLSESR
I1YH94_METFJ      SRVVGEPGEYRPLILTDAGQV-------------------YLYRFWLDERDVASLIR---
D5VBZ2_MORCB      FDAYHRCADDTIKIKQFVNHALNHFRQQVSLLDHTVMEIEQLSALFLSMLRIYYVLYKNA
A5WER9_PSYWF      TQGELAHSEDSDPIFNLLNILMTRGNELWLQLSLPNSSKAQLVERFKLVQQLYELMQNDN
Q6FF15_ACIAD      ---ERNSAQITAMLQALIEASVQGDSGLVVSSSIVAELGNYVLDEAQAQTQVAPMIYDGE
A5EVY1_DICNV      ---AGGCSENFVPHFERVMTAIAAGNTVVAAENAIADGALIVTADAAKKGAVAPLVSDGT
D6YTF0_WADCW      LLKQIPGAFDRIPNTICTSVDSFSKT-YPEQPICKHGRSLYLQKYWVFESHFLTHLLPLV
C7PDT2_CHIPD      ADLPAFCENMPTGSRTLQQIPLVAKGGNDSQPFVLYQERLYLQRYFRYETIFLQRIHQFL
D4H409_DENA2      FNKEINNAFSENVIAGLITKGALCEAPAISAPFIKAGSSIYMKSFYSDENSVGIYIKNRV
Q5QUQ9_IDILO      NPSELFRQFGTDVEAALIQSHCVDVDGKGNQPLVLSDGKLYLRRYWQYEAFIENDLQARM
F8E604_FLESM      LEKAPDIFRTKDIKNIVEKNSEYIGAPGEFKPFIFDGKRIYLHKYFEYENFIISNLSERS
D0KVH2_HALNC      DSCPGVVLQRPESSIHGSSILGAPTSEQSNPPFVREGGLLYLRRYWQQEQGIVAALRSRL
I0ICH2_PHYMF      PPGAVSTAPDASRMIAHRNDQDRSPVRDRPLVLDADAGLLFTARSWFFQERLAANLAARL
B4RLU6_NEIG2      --------------EADALSALAPVVGTSAAPLILEGRRLFLGRMWQLEYDLAAEIKRLA
Q480P0_COLP3      QELSHAGFVFAPLTQLQVMLSELNILASDQQLLVLQHDKLYLRRYFQFESDLGEAIHARL
D5ELP9_CORAD      DLLGSGDALCQEFPTVVVTAENLESKPEASFVYRSDSQLIYLQRWYRMEAMLGAFVRDRL
F5ZCK1_ALTNA      GYKFPGLTEMISVIKKALGSEKDDKNNKISPLFVYQSGKLYSRRYYNFEQEIAASIANRT
L0DJ49_SINAD      GLDAARAVKLAESLIEEGRVAAIVGGPEDFKPLIVDGPYLYLQKMRALEERFADALRRRI
A0Q7L6_FRATN      NQSDAKVGFKMPSSDKIANILDSLNYDNLPIYFAKQYDSLYIKRLWNYENEIANFIKLKT
G4QGN2_GLANF      ETRIKTGFSFASSQQLSDVIQQFTEIVPSRKDINWDAPNLYTARYANYENEVARFFRDQQ
J9ZC99_LEPFM      LSWKNRLPDPSRWEAILDAHPLVTGPGEGPSPFLYANRCLYFSALYRQESFLARSIRERL
I0IR81_LEPFC      GRSGSPGIYPDSSVFLLSCSRLSSRKAPFPIVFDREGKRVWLLRYRELEERIARNLTTRS
D3PC94_DEFDS      FFELDDKGLSFIFPDSEKIKSEIVKYNFLKNLVVVFDDKLFFKRIFNYEKYIADKIRELS
G0AM73_BORBD      GNPETIKNMVLLLKKNNILMEFNNKLKITTPLILENNIYIYTQKNYREEEELIKQIIKRL
A9BB03_PROM4      -KPPTEVKAPGWPTEHLRAIKQSGWLEQSTSPIILENNRLGWYRWDYEMKGIIKDLIKKS
Q9JRZ2_CHLPN      ---RIRPSLGGISETDLYRGFHNLPKEVRDKLFVVVSGRLYLRSLYTIRSKLLDKLSLLC
                                                                              

RECD_BUCAP        QFD---------------------------------------------------------
RECD_BUCBP        NFK---------------------------------------------------------
Q057F4_BUCCC      SKK---------------------------------------------------------
Q72NZ2_LEPIC      VSV---------------------------------------------------------
B0SUE9_LEPBP      KNT---------------------------------------------------------
I6XV14_PSEPQ      -ELAARLR----------------------------------------------------
K7S5A9_ACIA4      DDPPDELS----------------------------------------------------
D6Z1G4_DESAT      VRVPAPPA----------------------------------------------------
E6WXK6_PSEUU      RGAVEPDG----------------------------------------------------
F9ZQ69_ACICS      STTVAYFS----------------------------------------------------
A8ZX10_DESOH      GI-IRKVD----------------------------------------------------
B8FB95_DESAL      VPDPAYTD----------------------------------------------------
E8RCC9_DESPD      AGIEAVD-----------------------------------------------------
Q2SQD7_HAHCH      AHHAAFP-----------------------------------------------------
B2JKV2_PARP8      RVEHEDGVS---------------------------------------------------
C7LVF6_DESBD      GAP---------------------------------------------------------
RECD_ECOLI        ------------------------------------------------------------
Q1LST7_BAUCH      ------------------------------------------------------------
Q15V09_PSEA6      G-----------------------------------------------------------
F6DBR2_THICA      ------------------------------------------------------------
Q6ANK0_DESPS      SGQ---------------------------------------------------------
Q2LTC7_SYNAS      NPAESEDFRK--------------------------------------------------
F4HA57_GALAU      P-----------------------------------------------------------
I1YH94_METFJ      ------------------------------------------------------------
D5VBZ2_MORCB      -----------NTLNQFVSLLHNNTFFGDILASNIQ---------SIPTNTPPIYFSDQA
A5WER9_PSYWF      KADVLSEKGLINSLSKFMQHVDQHPLFTQMSSALLAKENSLSKNIPISKQTPIIYQSNHP
Q6FF15_ACIAD      ------------------------------------------------------------
A5EVY1_DICNV      ------------------------------------------------------------
D6YTF0_WADCW      IES---------------------------------------------------------
C7PDT2_CHIPD      ATEKEVLA----------------------------------------------------
D4H409_DENA2      SAP---------------------------------------------------------
Q5QUQ9_IDILO      SDRP--------------------------------------------------------
F8E604_FLESM      R-----------------------------------------------------------
D0KVH2_HALNC      TPD---------------------------------------------------------
I0ICH2_PHYMF      GEA---------------------------------------------------------
B4RLU6_NEIG2      AAGTS-------------------------------------------------------
Q480P0_COLP3      LQQCQYD-----------------------------------------------------
D5ELP9_CORAD      RRPP--------------------------------------------------------
F5ZCK1_ALTNA      HITALSED----------------------------------------------------
L0DJ49_SINAD      AGDGDDSG----------------------------------------------------
A0Q7L6_FRATN      IQNTQ-------------------------------------------------------
G4QGN2_GLANF      SKYLASSGD---------------------------------------------------
J9ZC99_LEPFM      SLGAR-------------------------------------------------------
I0IR81_LEPFC      NLRDSLEG----------------------------------------------------
D3PC94_DEFDS      AK----------------------------------------------------------
G0AM73_BORBD      ENHKNELN----------------------------------------------------
A9BB03_PROM4      NQR---------------------------------------------------------
Q9JRZ2_CHLPN      SAT---------------------------------------------------------
                                                                              

RECD_BUCAP        ----------------------TIDTQQCLNILNNLFSKK--------------------
RECD_BUCBP        ----------------------LINKNKIQKILKNIFNTN--------------------
Q057F4_BUCCC      ----------------------KKNKIEYKKLIKKYCSNY--------------------
Q72NZ2_LEPIC      ----------------------NVDTDRVEKILKDLESKS-FS-----------------
B0SUE9_LEPBP      ----------------------TITADQIKTIISGLETESKIK-----------------
I6XV14_PSEPQ      -------------------------HRSALPDLPSPEPPAPGP-----------------
K7S5A9_ACIA4      -------------------------DHLVEAAVKSVGGALRQA-----------------
D6Z1G4_DESAT      -------------------------PEVAAARLAELATAA--------------------
E6WXK6_PSEUU      -------------------------IDALAPLFARLFPQA--------------------
F9ZQ69_ACICS      -------------------------EGSATLLTRLFGPAS--------------------
A8ZX10_DESOH      -------------------------AHRLKEGLTRWFPGQG-------------------
B8FB95_DESAL      -------------------------QDRLAQELDRLFTPL--------------------
E8RCC9_DESPD      -------------------------QRAALPLVEALFPESK-------------------
Q2SQD7_HAHCH      -------------------------PEQVRQALLRFFP----------------------
B2JKV2_PARP8      ---------------------GEMSPHALRERLLRYFGPP--------------------
C7LVF6_DESBD      -------------------------PRDIPADLLPDIFKT--------------------
RECD_ECOLI        --------------------HAIEVDEALLAQTLDKLFPVSD------------------
Q1LST7_BAUCH      --------------------LVPYDENIVRNILNALFPTTNN------------------
Q15V09_PSEA6      -------------------RTSTLDIEQGRALLGQLFVSAPDDVGDERDLNDVNRQSGHG
F6DBR2_THICA      ------------------------NIDVPLANAPELSRYFDD------------------
Q6ANK0_DESPS      -------------------SVLRIDPDLLAATFPEELDEGEE------------------
Q2LTC7_SYNAS      -----------ISNVSLDLSGLGHNLQTFFPEDAGQFRFEDDK-----------------
F4HA57_GALAU      ------------------IHYQQNELTDLKQILQALFPHSQHL-----------------
I1YH94_METFJ      ------------------LRLKPVENVDFTQLNQDLINWKSHTV----------------
D5VBZ2_MORCB      GGLYL------------WTSRAYLAESQLMTHILRISQADVPIFALD-------------
A5WER9_PSYWF      HNNHLNKHLETDKKITFWLHRTWQAEFNLAKTIQNILNQPIKPLDI--------------
Q6FF15_ACIAD      ---------------LLALYRYWMLEQRLAIQVVRLSQQVIPPVEVMP------------
A5EVY1_DICNV      ---------------FLWLYRLWFQEWRLASCIQKKLNAADDSILEHN------------
D6YTF0_WADCW      ------------------------PEFLAENCLLEDFLK---------------------
C7PDT2_CHIPD      --------------------DRLKMLETHRTFISNLFAAGPAFVAD--------------
D4H409_DENA2      ----------------------YIMTPETEKLIDKYFPEN--------------------
Q5QUQ9_IDILO      ----------------------VTNDDLLKSTLAKLFDKPDGD-----------------
F8E604_FLESM      ------------------------IHYGIGERCAEAFAKDKND-----------------
D0KVH2_HALNC      ----------------------ALPAEPIRHILDALFPSTIAQ-----------------
I0ICH2_PHYMF      -------------------------EAPPGDTLARLFPDAGTP-----------------
B4RLU6_NEIG2      ----------------------APDAAGARQNLAKWFQGAG-------------------
Q480P0_COLP3      -------------------------NDSIGQCIGKLFPNDLAQVEAQD------------
D5ELP9_CORAD      ----------------------RALPESFFEVFQDFIAPEGLA-----------------
F5ZCK1_ALTNA      ------------------------GLSRVKALWPAMFPTNTID-----------------
L0DJ49_SINAD      -----------------------WPEAEVAAAVLDVEGRPAVRNGV--------------
A0Q7L6_FRATN      ------------------------KDNRIEEVVDKLFEPAGEI-----------------
G4QGN2_GLANF      --------------------EFAHLQQCADSLWPTLFPIKPQQ-----------------
J9ZC99_LEPFM      ------------------------EPDARDQEILRLASGGVED-----------------
I0IR81_LEPFC      -------------------------ESPKSILLDRAFGEASPE-----------------
D3PC94_DEFDS      -----------------------------KRGIKKFFYDENLN-----------------
G0AM73_BORBD      -------------------------DNKIQNIISTLNINNLNK-----------------
A9BB03_PROM4      ------------------------PKLAIIEVDKDAIKSTVKLN----------------
Q9JRZ2_CHLPN      -------------------------PNYFPPSIDSSILSE--------------------
                                                                              

RECD_BUCAP        ------KHDLQKIAVILTLINNIIFITGGPGTGKTTIILKIIIALIKNAKKK--------
RECD_BUCBP        ------IDDTQKLAIILSIINNITFIIGGPGTGKTTIILKILLVLIRLHKKK--------
Q057F4_BUCCC      ------IDKNQKNAVKKALIHNLFFLLGGPGTGKTNIIAYLILILIKISKKK--------
Q72NZ2_LEPIC      ------LKKNQKKTIFSCLNSSFQIISGGPGTGKTTIVAFLLQILNELKQLPS-------
B0SUE9_LEPBP      ------LAEEQRETIQDVITSNFRVISGGPGTGKTTVVSFILMAFDRLKLLPS-------
I6XV14_PSEPQ      ---GMVPDPTQDAAVRAATRARTCVITGGPGSGKTTVVSRIIDALAPRG-----------
K7S5A9_ACIA4      ---GTVLDPAQIQAAERACRHRLTVLAGGPGTGKTTTVCTILAVLARAAGD---------
D6Z1G4_DESAT      ---GVELDQDQQAAVLGALNHYLTVISGGPGTGKTTIIFFILTLLTQMAREEGQG-----
E6WXK6_PSEUU      ---AGGGD-HQARAAAVALLHRLLLVTGGPGTGKTTTIARLLVLLGARAAAAGQ------
F9ZQ69_ACICS      ---SSSAGDGQRLACALAAERGFTLITGGPGSGKTYTIARLLVLLMQAA-----------
A8ZX10_DESOH      ---PGNGPDMQRVAAVSALTHDFSVITGGPGTGKTLTAARILALLAEQAEN---------
B8FB95_DESAL      ---PNSETDWQKAAAATAVLRKFSVISGGPGTGKTTIAARIIRLLLSLADG---------
E8RCC9_DESPD      ---GAVEVDWQRAAAVLALHKRLVIISGGPGTGKTYTVARMLALLIALTP----------
Q2SQD7_HAHCH      ---SVAAEDRQAIAAAVACRQGFTAIVGGPGTGKTTTVAKLLGMLGELSE----------
B2JKV2_PARP8      ---QDEQIDWQRVAAVMALSGRLTIVSGGPGTGKTTTVVGVLA--CLLDAR---------
C7LVF6_DESBD      ---KGDETDWQDVACFAALRSRLCVISGGPGTGKTTTVARILALASRMHTG---------
RECD_ECOLI        ------EINWQKVAAAVALTRRISVISGGPGTGKTTTVAKLLAALIQMADGE--------
Q1LST7_BAUCH      ------SINWQKIAIALALTSKVSLISYRTSNDKNTMITKLLAAILQINKSE--------
Q15V09_PSEA6      HAQREPEIDWQKVAVCLAASQSVSVITGGPGTGKTTTVIRLMALLQGLARHKGK------
F6DBR2_THICA      --------PHQQQAAELALTKQLALITGGPGTGKTTTVVKILALLIQQ--NP--------
Q6ANK0_DESPS      --------NHQQKAAEKALQTPFLVVSGGPGTGKTTTVVRILALLHHAI-GH--------
Q2LTC7_SYNAS      ---SKIFPDWQKIAALAVLRNRLVVISGSPGTGKTTTAARALALLQILSRGP--------
F4HA57_GALAU      -------PDWQKIAVATAFSSTISFISGGPGTGKTTTVAKLLLGLQWLQQIRKQ------
I1YH94_METFJ      ------GTDWQKVAVAMAVSRQFGVISGGPGTGKTSIVLKILQCLEQQSNS---------
D5VBZ2_MORCB      -QLPNSLNTEQRDAIKLVSKQAFCLITGGPGTGKTFTVAQIVIALNQ-------------
A5WER9_PSYWF      -HIPDNLNAQQVQAVKVANENAFSIITGGPGTGKTYTVAQLVIALQQAQANSDAQQALGE
Q6FF15_ACIAD      -HLDLLTDPHQQAAMSMVATQAFSLITGGPGTGKTYTLARIIAVLNQA------------
A5EVY1_DICNV      -SFDDGLNAEQKQALKMGLTRQLSIINGGPGTGKTFTVARIVAALLAR------------
D6YTF0_WADCW      ---KSPLNALQKKAVCQVFRQRFCVISGGPGTGKTHTAGAIVSLYSKMFKERLPK-----
C7PDT2_CHIPD      ---GGDPADWQLSAAVTGVLNNFTIITGGPGTGKTTTVAKILAILYYLDPS---------
D4H409_DENA2      --------NMQKAAAINTAMNSFSVISGGPGTGKTSTVFNLLAVLAEMSSEP--------
Q5QUQ9_IDILO      ---KAEEINWQRVACANTVRNRFSVITGGPGTGKTYTVVRLLTALQHQTLFLGL------
F8E604_FLESM      ---SDVQLNLQNLAVFMGLRNNLSFISGGPGTGKTTTVARLLYYHLLQNKN---------
D0KVH2_HALNC      -------PDWQKIACAVAIRRRFSLITGGPGTGKTTTVVKFLLLEQMRALEAGLP-----
I0ICH2_PHYMF      ------EGADAAAAAAGLAASRFGVLTGGPGTGKTTAAARLLAAFLLAEEAAGRDL----
B4RLU6_NEIG2      -------SEGQRDAAALALLQFFMVITGGPGTGKTTTVAKLLALICGENEN---------
Q480P0_COLP3      --VESLEIDWQKVAVANAINKNFSVIAGGPGTGKTYTVTKLLAALVMLEQMGLAKTGKQQ
D5ELP9_CORAD      ------ENPWQAAACFAALRHDFSIITGGPGTGKTTTVTRLIGLLMSLPVGMR-------
F5ZCK1_ALTNA      ------EQDWQQVAVAKSLVQQFSVINGGPGTGKTYTVLRLLLALQACNQNE--------
L0DJ49_SINAD      ---PLPLSDDQLAAVRTAASHRLAVISGGPGTGKTTIVVSILRVLRRLGIPP--------
A0Q7L6_FRATN      --------NWQKQAVIKSLNYNFSIISGGPGTGKTTTVAKLLLAIQMLNQNQ--------
G4QGN2_GLANF      ------GTDWQKVSVANGLISQTSIISGGAGTGKTYTVARLLLSWLFTQKKAGSG-----
J9ZC99_LEPFM      ----------RRRLLEGALFRPFFLLTGGPGTGKTYTSAEILKVWKILRPEA--------
I0IR81_LEPFC      --------NTIRRCANIVFHRKLLILSGGPGTGKTTALSRILSRCPSLLSIP--------
D3PC94_DEFDS      --------NLQNLAVSLSVINNFMVISGGPGTGKTTVIKKIIETILDNNDN---------
G0AM73_BORBD      ---------EQITSVRKALKSNFFLLSGGPGTGKTTTINYILKAINKTLNNKK-------
A9BB03_PROM4      --------SEQLLALESITSHNLVLLSGGPGTGKTSTIVEMLRKSLSIDLE---------
Q9JRZ2_CHLPN      ---------EQNFIFNKITQGCFSIVSGGPGTGKTFLAAQLILSLVKQQPK---------
                                           :   ....*.      :                  

RECD_BUCAP        -------------IKIQLSAPTGKATENLIEILNDKWLNRYLLKEE--------KKQFSF
RECD_BUCBP        -------------INIKLTALTGKAANRLSESIHENIKKLNLTEHE--------KNIFN-
Q057F4_BUCCC      -------------IKIQLTAPTGKAVNKLTQSIYKILKKKNIQKNE--------KKMIP-
Q72NZ2_LEPIC      ------------PEKIALVAPTGRAAQRLTESVQENLKKISTSLE---------NGFLR-
B0SUE9_LEPBP      ------------MERIALVAPTGRASQRLTESIQRNLEKFQADPSL--------TSNFR-
I6XV14_PSEPQ      ------------PVTVALTAPTGKAATRLETAV----RGRLRYPER------------VA
K7S5A9_ACIA4      ------------PGPVRLAAPSGKAAARLRDAVGQVAAGLPEEFRP------------AS
D6Z1G4_DESAT      -----------SDLRVLLLAPTGKATARLAETLRERAAEFSA------------------
E6WXK6_PSEUU      -----------PAPRIALAAPTGRAAERMAESLRRAAQQLSAEGIE-DG-----LLAPLA
F9ZQ69_ACICS      ------------PRRVALAAPTGKAALRMDTALRQSVDDFVRRGDDDLA-----DLLRQV
A8ZX10_DESOH      -----------RPLAAVLTAPTGKAAARLGEAMSTLRGAVPGPAS----------ENRLE
B8FB95_DESAL      -----------RAPSIAITAPTGKAAARLLESLGKELSRLGVPPGM---------EDAIP
E8RCC9_DESPD      -----------TKPRIALAAPTGKAALRLRESIRRAKDALPPLLAT---------P--IP
Q2SQD7_HAHCH      -----------PPLRIALAAPTGKAAARLMESIRNAKLQLGERLSH---------PERIP
B2JKV2_PARP8      -----------PALRVALAAPTGKAAQRMQEALLARA--GSLPPEL---------AARLP
C7LVF6_DESBD      -----------ANFRIRLAAPTGKAASRMTEALAEAFPEGSQLPEL---------NACLA
RECD_ECOLI        ------------RCRIRLAAPTGKAAARLTESLGKALRQLP--LTDEQ-------KKRIP
Q1LST7_BAUCH      ------------YLHIIIAAPTSKVTAQLTDYIARSMMILT--HDY-L-------RYKIT
Q15V09_PSEA6      ------------KLQIKLAAPTGKAAARLSQSISAAMDKL----PDAL-------KPDLP
F6DBR2_THICA      ------------YATFALAAPTGKAAMRLQESITNSKAGLVNLFDADL-------LNHVP
Q6ANK0_DESPS      ------------KLDVALAAPTGKAAQRLYESILGGADRLPEQLRRDV-------GEWLP
Q2LTC7_SYNAS      ------------KLRIALAAPTGKAAVRLDEAMNSAYARVGLNDQQG-------------
F4HA57_GALAU      -----------PWLNIRLAAPTGKAATRLTESLHQAIQNIHL--PLDL-------SSTLP
I1YH94_METFJ      -------------LQIGLAAPTGKAAARLQQAIRQP-----------------------G
D5VBZ2_MORCB      -------RDEHKKMRLGLAAPTGKAAQRMSESLLKSLDKAN---------------DIQL
A5WER9_PSYWF      GSTI---RFSTDSAGLALSAPTGKAAQRMQESLQAALDNAQV--------------EVQL
Q6FF15_ACIAD      ----------IPNIRIAMAAPTGKAAQRMQEALQASFNDEKLTASGLLS------HELKQ
A5EVY1_DICNV      ----------DPDLTIALAAPTGKAAQRLEIALHQAF------ITAQLT------RPTQL
D6YTF0_WADCW      ---------------IALTAPTGKAASKLRSSLGS--------------------SDGFC
C7PDT2_CHIPD      -------------LKVALAAPTGKAAARMAESLRNTQLPVDDAITA----------QFRS
D4H409_DENA2      -------------VKIAVCAPTGKAAARLTESISEKREEYKHEAFI----------DQIP
Q5QUQ9_IDILO      -----------PPLRVSLAAPTGKAAARLTESIESELNRLRGDAKLATLK---DALDAIK
F8E604_FLESM      -------------INIALAAPTGKAAARMGDSLSDSMKRFNLENTT-----------FTD
D0KVH2_HALNC      ------------PRRIRLCAPTGKAAARLLQSILGQMDALLAPFDAAFP----DLRKALP
I0ICH2_PHYMF      -----------AGLRIVLATPTGKAAERLTASIRGSAPKLDAPEAVRG--------RLAS
B4RLU6_NEIG2      ------------LPHIALAAPTGKAAAHMARALHRAINGFDAPEAVRR--------HLLK
Q480P0_COLP3      AEVAQQKQQGTAVLNIALVAPTGKAAQRLSESIVNAISGFKNLIDDKV-------LAEIP
D5ELP9_CORAD      ------------PESIQMVAPTGKAAERMRESFNGNLNAMLAALPEHRRQPIVEQKDRVL
F5ZCK1_ALTNA      --------------RIVLAAPTGKAQQRMTESIVSNLETLRGKVDDKL-------LNSVP
L0DJ49_SINAD      -------------EAMLLAAPTGKAAQRLGQSIQAGLQAVAQPSPEDN-------DLETI
A0Q7L6_FRATN      -------------QRIALLAPTGKAAQRMTESLNSVLSKRVDNDSY---------LGLSN
G4QGN2_GLANF      ------------KAKLMLAAPTGKAAQRLNESILGEFTQLLKVNKINHVSAL-IDDLMPM
J9ZC99_LEPFM      --------------HLVVATPTGKAARRFREALSLP-----------------------E
I0IR81_LEPFC      ------------PERIALVAPTGKAAARLGESIAKLLPDLPDQDDRE--------YLSKI
D3PC94_DEFDS      -------------HKIAITAPTGKAVSRILESLKEFPFLDKI------------------
G0AM73_BORBD      ------------KRLVAIAAPTGKASLRLQTSIDYSFKNLEI------------------
A9BB03_PROM4      -------------LRIGLAAPTGKATRRLQESLQSSIEELNPQVKD----------KFYR
Q9JRZ2_CHLPN      -------------LRIAIVSPTGKATSHIRQILMKYNIFDDM------------------
                                   : : :.:.  .:   .                           

RECD_BUCAP        NPIMTIHQLLGIS-KKSEK------IFFNKNNLLMIDILIIDEASMIDILMMSNILSALS
RECD_BUCBP        QKTTTLHNLLDLKPNKSFN------YSCCKNKLYNLNLLIIDEASMIDITIMDKLISSIP
Q057F4_BUCCC      KEGITLHKLFKIQKETNKN------NAKYIKRKKKIDILIIDESSMISLNIMEIILTCIK
Q72NZ2_LEPIC      --GQTIHGLLNYKQSLGGF------YYN-RERYLPHRLIIVDEVSMVDLDLMLSLWNSIP
B0SUE9_LEPBP      --GQTIHNLLKINPTTNQA------KFG-EKRYLPYDFIIMDETSMVDLKLMNLFFSAI-
I6XV14_PSEPQ      LTAGTLHRIIGVVPGRAE-------HTHGALNPLPFDVVIVDETSMVSITLMSWLLEAVA
K7S5A9_ACIA4      VEATTVHALLGSRGPGRG-------FSHDARNPLAAGVVIVDEASMLSLPMAARLLEAVG
D6Z1G4_DESAT      ---MTIHRALGYQSCSPTI------FRHNRSNPLAADLVVVDEASMVDLALMSKLFAAVS
E6WXK6_PSEUU      TTGRTLHRLLGTIPDSPR-------FRHHAGNPLAVDIVVVDEASMIDLPLMAKLVEAVP
F9ZQ69_ACICS      PPAQTLHRLLGARPGTRR-------LRHDAHRPLNFDLLVVDEASMIQHDLMAALLRATP
A8ZX10_DESOH      VRACTIHRLLGALPGTTV-------FRHHRHNPIAADVVVVDEASMADVALMAKMVDALP
B8FB95_DESAL      KRAKTIHRLMGARFNSSQ-------FIHNADNPINADILIVDEASMVELSLMARLLEALP
E8RCC9_DESPD      EQAQTLHRLLGVHHDRPG-------FRHHGANPLHLDLLILDEASMIDVPLMAALLAALP
Q2SQD7_HAHCH      DTAYTLHRLLKVRGDGKG-------FVHHAGHPLPVDLLLIDEVSMVDLAMMLRIVEALP
B2JKV2_PARP8      HTSFTLHRLLGTGPDGR--------FRHHRENPLPYDVIVIDEASMIDVAMATHLFDALA
C7LVF6_DESBD      QGAQTVHRLLGWSSGG---------FRHCQGNPLPLDMLVVDEASMLDLELAARLMDALP
RECD_ECOLI        EDASTLHRLLGAQPGSQR-------LRHHAGNPLHLDVLVVDEASMIDLPMMSRLIDALP
Q1LST7_BAUCH      YQVINLYKLLGTQPNSRR-------IQYYCDNPLYLDILILDESSIVDLPMMANLINALP
Q15V09_PSEA6      SQCSTIHRLLGSIPNSPY-------FRFNQQHPLHVDVLIVDEASMVDLPLMSKLFAALP
F6DBR2_THICA      QEVTTLHRLLGARPLTPV-------FKHHADNPLSHDVIVVDEASMIDLALMSKLVKALK
Q6ANK0_DESPS      EKAVTLHRLLGTQLNSTR-------FRHNRENPLGWDLVLLDEASMIDLAMMSKLVDALK
Q2LTC7_SYNAS      -KAMTVHRLLGTVAGSPY-------FRHGPGNPLPYDVIVVDEASMVDLPLMAKLVQALS
F4HA57_GALAU      QEAATIHRLLGMR-PNSL-------PRYHQQQPLNIDVLVIDEASMINLALMATLLRGIK
I1YH94_METFJ      YEVKTLHRLLGITEQNHF-------GRYNHKRTLPLDVLIIDEASMIDISLMAKLMRAMS
D5VBZ2_MORCB      PKPKTIHRLLGIGENGSP--------RYDAKNQLPLDMLIIDEASMLGTELASQLFAAIA
A5WER9_PSYWF      QEAKTIHRLLGIGRDGRP--------RYHAGNPLGEDIIIVDEASMLGVELANYLVSAIK
Q6FF15_ACIAD      QTTQTLHRLLGLGHQQLP--------RFHAKQPLPYDVIVVDEASMLDLKLATLLFEAVP
A5EVY1_DICNV      TTAQTVHRLLGVDNTGTA--------RYHEHYFLPYDVVIIDEASMLSLELAAQLFQALA
D6YTF0_WADCW      VESYTLHALLGLSPESPY--------VYPPVKKLPYDLIIVDECSMIDVKLMASLLPSIK
C7PDT2_CHIPD      LAPSTIHRLLRSRKDSPY-------FVYNRENPLNYDVVILDECSMIDVALFAKLLDAVG
D4H409_DENA2      EKALTIHRLLGMAGDSRV-------PRFNKENKLPYDVVVADEASMIDVRNMAKLTEALS
Q5QUQ9_IDILO      PEGKTLHRLLGVKPNSRA-------FKHHADNPLRTDVVIVDEASMIDIEMMTALLKATP
F8E604_FLESM      IQTMTIHRLLGYSPYLGGFRYSKSGRKKHHPALLGYDLIVVDEASMIDLSLMFHLLKALP
D0KVH2_HALNC      DTVETVHRLIGVRPNQIHP-------VYRAENPLPADVVVVDEASMIGVELMAKLLASLD
I0ICH2_PHYMF      LEASTVHRLLGWTPLPPERGGP---FRRTAENPLAADVVLVDEASMIGLELMSRLCDAVR
B4RLU6_NEIG2      LEGQTVHRLLKLSPPKMQA-------AFDHIRPLPFDVLIVDEASMLDTALMLQLLKAVK
Q480P0_COLP3      TQAQTLHRLLGVLPNSPN-------FRHHQDNRLPYDIVLIDEVSMVDLPLMTRVFRALK
D5ELP9_CORAD      HPASTIHSFLGSQGNRG--------FRQHAGNPVSCDVLIVDESSMIDLELFIALLDALP
F5ZCK1_ALTNA      TDAVTLHRLLGLREHTIAT-------RYNQHNPLMLDVLIVDEASMVDLALMARIIRALP
L0DJ49_SINAD      PEPRTLHRLLGYSPSTGR-------FLHHENNRLAGRVVVVDEGSMIDLVLMERLARSLR
A0Q7L6_FRATN      LEAQTIHRFLGLRPNSTH-------VKYSKQSKAPYDVIIVDEASMLDMNIFIKLIRAVA
G4QGN2_GLANF      IKAKTIHRLLGLGMHGIDP-------KYNDKKQLDCDFLVIDEVSMIDLAMMAKLLRALP
J9ZC99_LEPFM      VDVLTLHRLLGISPGGAS---------PGEDRPLVQDLVLVDECSMVDLSLMARLFRALS
I0IR81_LEPFC      PSPMTIHRLIAQAKRDHE----------QNPLPLPVDLLVVDEMSMVDLSLFDKLLLVLP
D3PC94_DEFDS      EPPCTIHRLLGANSREMR-------FYYNKNNRLPFDTLIIDEVSMVDVEIFYHVLQALK
G0AM73_BORBD      -ECNTIQKLLGIKFINKKN-------LYDEENQLNFDVIIIDEASMVDAYTFLKLLKATP
A9BB03_PROM4      IPCLTLHRWLKANERGFS---------KNETNQLDLDLLVIDEMSMVDISLMRGVLNALP
Q9JRZ2_CHLPN      VLMQTVHHFLQEYAYRRYN---------------SIDVLLVDEGSMVTFDLLYSLVQTLQ
                      .:   :                            :: ** *:        .     

RECD_BUCAP        K---------KTKIIFIGDHNQLKPVKSSSILKYICSYAEDG--------YSLKTQSI--
RECD_BUCBP        K---------TTKIIFLGDYNQLPSISGGNILKNICSYYQEG--------FSTTTNKF--
Q057F4_BUCCC      K---------KTKIIFVGDVYQLPSVETGSILKKICNFKKKK--------KEKKK-----
Q72NZ2_LEPIC      KNETIQEGTIPFRFILIGDPHQLPSVEKGAVLSDFLSVLESKRFHFVSKLEESNRQQP--
B0SUE9_LEPBP      --------HFDTHIILLGDPNQLPSVGQGEVLTDLITTLKNK-KEFLSELNSNHRFS---
I6XV14_PSEPQ      D---------STRLVLIGDPNQLASVEAGAVLADISAAPDLITS----------------
K7S5A9_ACIA4      P---------STRLVLVGDPGQLVSVDAGSVLADVVASASGLG-----------------
D6Z1G4_DESAT      P---------RARLVLLGDKDQLASVEAGSILGDICLAAP--------------------
E6WXK6_PSEUU      D---------GARLVLLGDPDQLPSVEAGDVLSGILAAAGDGMHLAASDAR---------
F9ZQ69_ACICS      A---------RSQLILLGDPDQLASVEAGAVLAEICRGRAVYSPATAEDLKRRWGITLAT
A8ZX10_DESOH      D---------HCRLILVGDKDQLASVAAGSVFADICGAAGRNRFSADFLQALEAAGV---
B8FB95_DESAL      D---------HGKLILLGDKDQLASVGPGSVMGDICSGPGSQAFSPEWARVLAKA-----
E8RCC9_DESPD      A---------ACRVILLGDRDQLASVEAGNLFGDLCGEGAAGWSARLIRHMRGLLG----
Q2SQD7_HAHCH      P---------HARLMLLGDSEQLASVEAGSVIGDICSQRATAGVSPDMASYLRKIG----
B2JKV2_PARP8      R---------DTHLVMLGDKDQLAAVEAGAVFGELSAQPAFTAQGVGSIAAALGIGERSL
C7LVF6_DESBD      D---------EASLVLLGDRNQLASVEAGAVLANLCREDIVNAFSPDFTA----------
RECD_ECOLI        D---------HARVIFLGDRDQLASVEAGAVLGDICAYANAGFTAE--------------
Q1LST7_BAUCH      A---------QARVIFLGNDDQFISVDTGTVFSDIFQLIDHGYSIK--------------
Q15V09_PSEA6      R---------HAKIVLLGDKDQLASVEAGSVLSDICSAALNFSPTVFNQSPPY-------
F6DBR2_THICA      P---------DAKLILLGDKDQLASVESGSVLADCY------------------------
Q6ANK0_DESPS      P---------GGRLILLGDKDQLASVESGTVLATVI------------------------
Q2LTC7_SYNAS      P---------ASRLILLGDRDQLASVEAGAVLGDLCGPDDAGNFFSQAFRQEIRR-----
F4HA57_GALAU      P---------STKLIFLGDKDQLASVESGAIMAELGQFLSFDYSRQ--------------
I1YH94_METFJ      E---------QTRLILLGDSQQLASVESGAVLANLSEGQQGVFSDT--------------
D5VBZ2_MORCB      T---------GCRVILLGDTHQLAAVDAGAVLADLCRIERLRHLRVNLT-----------
A5WER9_PSYWF      P---------GARLILLGDANQLAAVDAGAVLADLCRIDVLQPIHAQLT-----------
Q6FF15_ACIAD      A---------GCRLILLGDANQLASVDVGSVLADLQQVEALEQNRVNLV-----------
A5EVY1_DICNV      P---------HTRIILLGDAQQLAAVEAGAVLHDLAQQSALNHHVVTLQ-----------
D6YTF0_WADCW      E---------GARLVFLGDPDQLPSVEAGSLFSDMIRFLDPS------------------
C7PDT2_CHIPD      N---------GTRLILLGDKDQLASVEAGSLFGDLCQAQDALNMFTKERLALINSFIP--
D4H409_DENA2      D---------DCRLILLGDKDQLASVQPGAVMGDICSAAPVDEFSTDRA-----------
Q5QUQ9_IDILO      K---------NARLVLIGDKDQLASVEAGAVLGNLCEGADQGHYHTETAQWLQHV-----
F8E604_FLESM      L---------ETKLVFLGDRRQLASVAPGAVFGDICDIENINAFSEQFAGEYRLFS----
D0KVH2_HALNC      E---------TTQLVLLGDKDQLASVEPGAVLGELSSVIAPDAYTAETRNWLAATTGQTL
I0ICH2_PHYMF      P---------DARLILMGDANQLASVEAGGVLAELVTAGEAA------------------
B4RLU6_NEIG2      T---------GARVILLGDENQLPSVGIGAVLSVLSQKTVLDGETHQRL-----------
Q480P0_COLP3      D---------TAKVILLGDADQLPSVAAGSVLADIAPRPHGGFSLENEQYLAQVCQLL--
D5ELP9_CORAD      Q---------ECHLILLGDKNQLAAVGTGNVFTDLTGTCDAIYGNLNVNSMAFSTAFE--
F5ZCK1_ALTNA      P---------RARLYFIGDADQLPAVELGNVLEQLVHDSDEAEFAEMGISENN-------
L0DJ49_SINAD      D---------DARLVLLGDDHQLPSVEAGAVLRDLLAEDDDGPSPLGPRAVRLTQSHRMR
A0Q7L6_FRATN      D---------NTKLILIGDTNQLPSVEAGSLLANFTHDKYGS------------------
G4QGN2_GLANF      K---------GAKLVLIGDANQLPSVESGGLLKDLVNQETWRSAAASSDYSNVYTQSHLS
J9ZC99_LEPFM      P---------ETSVILVGDPDQLSSVGPGSVFGDLALAMSVE------------------
I0IR81_LEPFC      D---------EAILILSGDPGQLSSVAPGAVFGEILKKPEES------------------
D3PC94_DEFDS      D---------DARLILIGDKNQLSSVEAGAVLGEICSIKEFFGLNTLNFFTKNIAN----
G0AM73_BORBD      I---------TTKLIMVGDKNQLPSVNEGNVYSSLLGIKQIN------------------
A9BB03_PROM4      K---------QSQLVLVGDPNQLPPVGSGAVWNELLKSQNQE------------------
Q9JRZ2_CHLPN      GYEKDKK-LYTSSLIILGDTNQLPPIGIG-------------------------------
                               . : *:  *: .:  .                               

RECD_BUCAP        ----------------------LQEITQNSIINYKINKKNTSYISDKICVLKKSYRFE--
RECD_BUCBP        ----------------------LKQLFPNRITIKTIKKHQFSNINDKIIMLKKSYRFK--
Q057F4_BUCCC      ----------------------------------------------IFFVLKKNYRFN--
Q72NZ2_LEPIC      ----------------------NTNGEVSKIVTLAEEILKYSPENLNLGTKIDESFPK--
B0SUE9_LEPBP      -----------------------NDSEFSVFAEIVKQSFDTNSNTKPFPLPKMITKSD--
I6XV14_PSEPQ      -----------------------------PGGPAVVRLGGSHRNLDDVARLADSIRD---
K7S5A9_ACIA4      -----------------------------PERLPVTTLTSNHRSGGAIARLAEAVRR---
D6Z1G4_DESAT      -----------------------------QLDSAVIELSREFRFDPRRGIGALVRGI---
E6WXK6_PSEUU      ----------------------TLQPLLGEVEASAIEADTATPFPARHVHLVRGWRQ---
F9ZQ69_ACICS      D---------------------SLRDDASALEEAVVRLGSSYRFDGPIAKLATAIRS---
A8ZX10_DESOH      -----------------------------LTGGMKAFPAGTARLAGNVVHLETVYRF---
B8FB95_DESAL      ------------------------------AGQAIPSENGLAPIADGIVHLVKNYRF---
E8RCC9_DESPD      ------------------------------PRQMPASVPLASSLGDCLVLLHTSRRF---
Q2SQD7_HAHCH      ------------------------------LTPPYPEEEKAAPVADCVIRLEVSHRF---
B2JKV2_PARP8      RDALPATAICHDARSDQAEPLFDDLFAMSSGAPSEAKPARLAPLADCVVWLERNYRF---
C7LVF6_DESBD      -------------------------YAAKAGAQGLTATGIPVPLTDHVVELKKSWRF---
RECD_ECOLI        ------------------RARQLSRLTGTHVPAG--TGTEAASLRDSLCLLQKSYRF---
Q1LST7_BAUCH      ------------------RCQELSRLTGYQLSNNRTNNMFSYQVTDSLCLLQNNNSL---
Q15V09_PSEA6      ------------------SDQALGVVKDLCQIELNINTLNKAPISNSLALLHKSYRF---
F6DBR2_THICA      -----------------------------------------RALQNNRVELQTTYRF---
Q6ANK0_DESPS      -----------------------------------------SGLARCSAQLIKTYRF---
Q2LTC7_SYNAS      ------------------MTGESCLPPVPFRHLPPVPFRHLPPVSDSMVQLQKNYRF---
F4HA57_GALAU      ----------------------QAAFLATVCEQQLAFSNELNFIRDSLCHLQHSYRF---
I1YH94_METFJ      ----------------------FIEQFSCLGLEK-ASSNTPELLIDSFVRLKHSYRF---
D5VBZ2_MORCB      ------------------------------ASKRFTDTSGVGQLAKLINDDRQNIHF---
A5WER9_PSYWF      ------------------------------ESRRFHADSGIGKLATQINTTPTDMQQVWQ
Q6FF15_ACIAD      ------------------------------TSRRFREGAKIGEFAQFIQCLDVTWDPQQI
A5EVY1_DICNV      ------------------------------ESRRFHQTSGIGILARCTQNASQTA-----
D6YTF0_WADCW      ---------------------------------------VIVRLEECLRV----------
C7PDT2_CHIPD      -------------------------DERRKLPDSQIKANDPHPLFQHLVELRRSHRFS--
D4H409_DENA2      --------------------------EILSKYTTGTIKAGKSPYADVTIMLDKSYRY---
Q5QUQ9_IDILO      --------------------------ADTPVLPAELIDNNGEQRLQHVVKFRKSYRFHGP
F8E604_FLESM      -------------------------------GEGIKETTVKSPMGDNIVELRKSYRYK--
D0KVH2_HALNC      P-----------------------------DSETNKSIVTDAALAQAAVQLHHSYRF---
I0ICH2_PHYMF      -----------------------------------------GPLAGRVFHLRHSRRFA--
B4RLU6_NEIG2      --------------------------AGFLPEHGFSVSANPPVLAQNTAHLSFSHRFG--
Q480P0_COLP3      ----------------------PAQVSDYFSAHRLPSQSAEQSSFDYLTFLVKSRRFD--
D5ELP9_CORAD      ---------------------------ALSTCTLPSFEDAEALCGDHVVELTKSYRFTG-
F5ZCK1_ALTNA      --------------------LGAVTSELRQHIATLCPHLPLLPLNENAKTWVHTLQAPQ-
L0DJ49_SINAD      P--------------------DDPDGRNILTVSQAIDRGETPRFAPSRDRDDTIVERPS-
A0Q7L6_FRATN      -------------------------------------------ITPYTTLLIKNYRS---
G4QGN2_GLANF      L---------------------LRKLAPDLVSANLQEVNAGMNGNSETEPVHRAYQYNHV
J9ZC99_LEPFM      -------------------------------------QKTRPEISRAFQVLTRNYRQD--
I0IR81_LEPFC      ------------------------------------LSGSPEGISGSIAILKKSYRFS--
D3PC94_DEFDS      ----------------------------KFDFNGNVVENDSMPIVDCLIEFDESYRFG--
G0AM73_BORBD      -------------------------------NDNVEELKENFRSNKEINLLSKAIYK---
A9BB03_PROM4      -----------------------------ILGSSRINLSKVYRNRGQIALLAKMIREDS-
Q9JRZ2_CHLPN      ---------------------------------------VGNPLQDLIGYFHENTFFL--
                                                                              

RECD_BUCAP        -------------------KKTGIYILSNAVYNKETKIFEKLFKNSIENVFFYEINSEIE
RECD_BUCBP        -------------------KKSDIFKISEMLTKNKINNIKTLYQNINNDVNFKQISSKTN
Q057F4_BUCCC      -------------------KNSGINFLINQLKKKKIKDINKIYKKKYKDIIWKNLNTSND
Q72NZ2_LEPIC      -------------------TNQIKENILYKSEVVWLQNIESSTSDYFSRDELVEKLWKEI
B0SUE9_LEPBP      -------------------LNLKHDFVWIQGDKKTKSTNGNHPEIHDWNIESMVPFLWET
I6XV14_PSEPQ      ------------------GDADGCLALLE--RSATCTLTPYSGTESLTDLPALASDVEAA
K7S5A9_ACIA4      ------------------GDQDAVMAVLDGDDSTVGFIDADAAGVGLQDLPEVAEQIRSV
D6Z1G4_DESAT      ------------------KAGEPATVLAVPVRVDGAQNDDP---KGPPAEVTLSDQPGAP
E6WXK6_PSEUU      ------------------SAALDLAPLAAAVRVGDQARALELLREGRLDGVHYHDAVPDL
F9ZQ69_ACICS      ------------------GDAERVIGLLAASATVGDSALGWIDPRAGAGRANFLELAERA
A8ZX10_DESOH      ------------------EHRGGMEMVSRLVREGAAGEIVEALATPGHQDVTWTAPDQEE
B8FB95_DESAL      ------------------AKDSGIGELADCVVRGDAAGAAASLESGG--EIIYEPVNNPR
E8RCC9_DESPD      ------------------HEGSGIGTLARAVNSGAPEAVAAIL-DAAPPDLHIEETH-GA
Q2SQD7_HAHCH      ------------------HARSGIGRLAQAINAGDSEAALQVFRQPEFEDADWENLP-PS
B2JKV2_PARP8      ------------------GLESAIGRLSLAIRRGAAQEALDVMDIDPAVPCAAAFHEDMD
C7LVF6_DESBD      ------------------GQHSGIAALSTLIRDGQAQMAGELLVEGRTDLEMLPCTGQAN
RECD_ECOLI        ------------------GSDSGIGQLAAAINRGDK-TAVKTVFQQDFTDIEKRLLQSGE
Q1LST7_BAUCH      ------------------KDSSGISILANMINTGNNNDALILLNSSKYADIYYIQRHCEL
Q15V09_PSEA6      ------------------SEKSGIGRLARAINMGR--LANAKALFSDDVYQDVVWQTSDD
F6DBR2_THICA      ------------------NEQ--IKQLAQAVNQQQVEQVLALCQDANKTDDTTAINFKSV
Q6ANK0_DESPS      ------------------NDE--IKAIAIATNAG---------------NGHRAWQLLEK
Q2LTC7_SYNAS      ------------------DENSGIGQLSRAVNRGDKDRVFSILNSSRCSDIAWENLPDPL
F4HA57_GALAU      ------------------NQNTGIGQLAKAVNQRQAEESWQLFAEYNDIRVLPLFRQGEA
I1YH94_METFJ      ------------------SDESAIGKLSQLINQGDSGSVINILTLPDSD-----ISWRQT
D5VBZ2_MORCB      --------------------DEIQQLINCHTKIDFHPITHALMYNDTYQKLSQDYQDYFL
A5WER9_PSYWF      LLTHDEALQFQSVNIQLGSDATDREADDVETAVFNHQLINSLSNKKIISKLSQNYLPYLN
Q6FF15_ACIAD      LHEFEHQIAV----------PQALQPVSLLHDRDDMVQLEYLPPKVNLEHLTPYYQKLMQ
A5EVY1_DICNV      -----------------------------------------LTAALEHEDIALSPLARRP
D6YTF0_WADCW      -------------------ELKELVNFGKAVNEGR-------VVSYPKCVERIIPESQMV
C7PDT2_CHIPD      -------------------GDKGIGKFSKAIIANDQVAIHGFLAPGADEQVVIDETYSKE
D4H409_DENA2      ------------------DSNAGIGLLAAAAGRGDHKTALEVLLNDTTKKVEFLELDNNF
Q5QUQ9_IDILO      IADLANAINR--------QDNAATKQELEKAKVADEDYPVSLYEVSSLDDPAFEALVKRN
F8E604_FLESM      -------------------SDSDIAKAAGMIEKGESSRLKDFLVNHSGTGEGSVRLISHS
D0KVH2_HALNC      ------------------DSASDIGALARCVNAGDASGALTLLRTNKEQASVRLVADAAG
I0ICH2_PHYMF      -------------------PGGAIDRLARAVLAGDDDAALAQLRSADRDALATFTPAVRG
B4RLU6_NEIG2      -------------------DNSGIGCLARAAVSGDEGAWALFDRFPDELEHSECSPNARV
Q480P0_COLP3      -------------------GKGGIGLIANSVIKGDVKRSWRLLNDSLSQSTQEGFIQGDY
D5ELP9_CORAD      --------------------KSEVGQLARILLDEGRLPHAGELEVPLTDLGADWRGRLKQ
F5ZCK1_ALTNA      ------------------RFKGQVAEVATAIQAGKSKQALDAMHSDAATEKLLTENASSQ
L0DJ49_SINAD      ------------------LAEVTFQGVEFLEASEGSGVIEALLHRWTVEVIRALPDFDDL
A0Q7L6_FRATN      --------------------QQYINNLAASVLKGDVNIDSHQNENINFHSLRNLDTYLRE
G4QGN2_GLANF      TFLQTSMR-----------SQNEITQLSQCILQGKQKPFLSLLSPLKSGNNGSDGDNQQA
J9ZC99_LEPFM      -------------------SWDDFGRLAEGVRQGDAGTVLEILASGEKSGPIRWIEPRTG
I0IR81_LEPFC      -------------------GDSGVGQLSRWIRDGGVTPLDPDSLSGVVFRQGASLADFYQ
D3PC94_DEFDS      -------------------KNSGISRLAELIKFEKYNELEELIFSERGFDGLLFYDLNKN
G0AM73_BORBD      ---------------------EDSTLICKYINDNKNIQLKEIEKINLKKDLIEYTNNLYK
A9BB03_PROM4      ----------------FNVFWNQIQNLPLSSNVKSHSQKKNSMPSFLLEKLKAKQAEIQK
Q9JRZ2_CHLPN      -------------------------KTSHRAKTGVVDQLTQSVLRGEMISFSPLPSISSA
                                                                              

RECD_BUCAP        YKKMINIIINNNKI-------------------------FWRKIYEKKNIKEIIKTFKNH
RECD_BUCBP        YNNIIFEITNSYSK-------------------------YWSALKQSLPFLKIINIFNNY
Q057F4_BUCCC      YLNMLKKIKLYYKK-------------------------YWNYVNKKKNPKKIIHKFNKY
Q72NZ2_LEPIC      FYPQIDRISSWKIQ-------------------------DSFCFDKPDFIQKFQEELKRF
B0SUE9_LEPBP      FYLHTANKTSKFHW-------------------------EPNALKDPKNKFIFESIVNEY
I6XV14_PSEPQ      ARDARGAALAGDG-------------------------------------DRAVRALEQH
K7S5A9_ACIA4      AADTLEAVNRGDD-------------------------------------EEALRLVDEH
D6Z1G4_DESAT      AENPTLRELVLAGF---------------------------RPCLQASSPAEALARMNDF
E6WXK6_PSEUU      LQDPARREHFLAHW---------------------------TALADAPSPAEALALAGRL
F9ZQ69_ACICS      WRSTQTRLEPVPS----------------------------GETEHAAWVRELLEAADTF
A8ZX10_DESOH      WRERLARTVTAWV---------------------------KDCLSVSANPEMVLDRLGSF
B8FB95_DESAL      TLPALLEEPLREG---------------------------FLPFITAKNPAQALEAFGGF
E8RCC9_DESPD      AQTPWLRDQIAQC---------------------------FLPLFAADTPLNALRALGQR
Q2SQD7_HAHCH      QLQSIIQQTAANA---------------------------YEPCFKADSVETALDAMNRF
B2JKV2_PARP8      AAPSEHTIHRLAAGFAA-------------YADALTAALFSTSANAASHAPALFDALNRF
C7LVF6_DESBD      LTATLTPLLREAF----------------------------RGLGGTTDPTRAFEIFGTL
RECD_ECOLI        D---YIAMLEEALA----------------GYGRYLDLLQARAEP--DLIIQAFNEYQ--
Q1LST7_BAUCH      D---YQRMVHDCVT----------------NYSNYLQLLNAGESP--ASIIEEFNRYR--
Q15V09_PSEA6      PKALVNRLLPDYQR----------------YFERVRQVCARGTLS--TQGIEVFALLQQQ
F6DBR2_THICA      K--HARDLKGFIQH----------------HYRAYFEQAAKVDSE--DAIRALFETFNQF
Q6ANK0_DESPS      R--AVEDWQAYIEG----------------NYRKYISSVQMLSG---SGAEDAFASLKKF
Q2LTC7_SYNAS      G--LPRLIEENLIH----------------YFRKYMQMVINNDN-----PEVIFDYFERF
F4HA57_GALAU      S---NQQVVDFAVQ----------------LYSDYFQFVQSENNWQPAEIAKAFMLFKQA
I1YH94_METFJ      T---SDDIHEVVTA----------------GYQAYIETVENQ-----ASHEKILHAFERY
D5VBZ2_MORCB      ASKRL-RFSFAKLS----------------------------SQDAIDSVKKLFKILDTY
A5WER9_PSYWF      KIHQLIKHPIAKSV----------------------------PEAVSLTVSELMSKFNRF
Q6FF15_ACIAD      GFETFAQQLKHYRL----------------------------HDYAESEVAAVIQAFDDY
A5EVY1_DICNV      NYDRLYEPYRDYVA----------------------------KVAAGAAVDVLLQQFDNY
D6YTF0_WADCW      WEQELTLIQEILRF--------------------------FPIHFTLEHTQ---EVFSAF
C7PDT2_CHIPD      LFAQFVAGYSAFIV--------------------------------EKDVRKALQLLNDL
D4H409_DENA2      ETAAGGYVLRHFES-----------------------------YSREQDQNLAIEAFNKF
Q5QUQ9_IDILO      LTTSGSLTLHVRNN----------------ADTNSNVTKTANAEDINKLAQEALQNLSNF
F8E604_FLESM      NLSEFFRENLLQHY---------------------------IDISKSDDIDKAYKKVFNY
D0KVH2_HALNC      HQPLRRIVQESLAP------------------WLAALNEPLSAENQDARASAIFAAHNKA
I0ICH2_PHYMF      LDSEAIDLLQQDDR----------------------------EAASLGEAEAFRLRIAGV
B4RLU6_NEIG2      ERLYRAHKAYWQAVK-------------------------------DGNIEAAYAGISDI
Q480P0_COLP3      LQAGYLQGDKSQKQQPSQLTLAQG---DLTTWLAPLVKQYYQPIEHCSTVSDAFVLLSQF
D5ELP9_CORAD      SLAAYKTVLLEGTD-----------------------------------ASVLLEVIGQV
F5ZCK1_ALTNA      KPKNLSDKNRWLQDGVFIQPESK----FTISALKKLAQESYEPVFQAQSAKEALSLLNRV
L0DJ49_SINAD      IARRYLIGRTGFSE------------------------------QDQGRLTRLFDHFDRS
A0Q7L6_FRATN      YAKRYSQLEKCRNY------------------------------------KEALTELNKF
G4QGN2_GLANF      IQQLSLLMEEPTAPAIAWHENAYTPNGTINAELLASIAQRYQGIFESRNADEAIAQLKQY
J9ZC99_LEPFM      AIREIGKTLIEAWL----------------------------PVVESRSAEEAWEKLGQF
I0IR81_LEPFC      DVTRDFSPYMKAKD-----------------------------------LSGAFFALSGL
D3PC94_DEFDS      VIENIVDDFKKEIK------------------------------------ENYLQALNKI
G0AM73_BORBD      KIPTFNLKLLKESK-----------------------------------IEIILETLLEN
A9BB03_PROM4      ILSNSLETLNTVNTYPATIN----------------------NPEFDNTIKKLLKTLEEL
Q9JRZ2_CHLPN      IEVLKNRFVKSLRQ-----------------------------------------SEARL
                                                                              

RECD_BUCAP        QILCIVKNGFFGVNFINKILEEEMYKRNIFNKR---------------FYINNKLWYIGK
RECD_BUCBP        KILCILKNGLFGITELNLAIEKEMKKIGWIKKV---------------TIINGQTWYFGK
Q057F4_BUCCC      RILCIINKGIFGTKKINQYLDNYFIKINNKKK-------------------KKEFWYHGK
Q72NZ2_LEPIC      RCLTIFRSGYWGVDAIQTKIMNLAAQNLFFGKG-GNFFA---------KRLSKGIYFVGL
B0SUE9_LEPBP      RCLTILRNGYFGIEAIQGQILRYAKKQLTNPKNEFHLKY---------RQLSKSFYFEGM
I6XV14_PSEPQ      RLLCAHREGSFGTGHWQQAVRRHLAATLPGYAPEV-------------------GQYPGQ
K7S5A9_ACIA4      RLLCAHRQGPYGVEAWSRQMDSALSEALPGLGRG--------------------RWVVGE
D6Z1G4_DESAT      RLLCAHRRGPYGVEQLNSFCRQLLRAEGVLGEAAGRGAMGKEARGPADGLAPEGDYYRGQ
E6WXK6_PSEUU      RILTAVREGPQGAAGLNRRIEALLADRLAQHQPRTRS----------------DGFFHGR
F9ZQ69_ACICS      RILCALREGPWGVAGINARMTAQLRPPG-----------------------YSGDWYPGR
A8ZX10_DESOH      RVLCALREGPAGALALNRSVEHSLQRAGVVA--------------------SGRLWYAGR
B8FB95_DESAL      RVLCGVRQGPWGMNSANSLVEDIFARDGLILL-------------------RNYPWYEKR
E8RCC9_DESPD      RILCALREGPGGVEGINRLAETIFRRLGRIA--------------------TMERFYRGM
Q2SQD7_HAHCH      RILCAVKEGHGGVQEINQWVEAALQRKGLAP--------------------RYQLHYHGR
B2JKV2_PARP8      RILCATRLGARGVDHMNAAMAAQVRRAARMPLA------------------IGAQWFAGR
C7LVF6_DESBD      RLLSPVRKGPRGTEALNRLAREALHESA------------------------SNYWYPGR
RECD_ECOLI        -LLCALREGPFGVAGLNERIEQFMQQKRKIHRHPHS------------------RWYEGR
Q1LST7_BAUCH      -LLSMLRKGKFGVVCLNXCIEQTLIYYGLLKK--NS------------------STYAGQ
Q15V09_PSEA6      QVLCAQKEASWGVKQMNVLIESELNKHGAIELGRD--------------------FYIGR
F6DBR2_THICA      KILTATREGDFGLHTFNQLSQPD-------TILPH--------------------WYTGR
Q6ANK0_DESPS      MVLCGTRRGRRAVEGINQMVEEDLLRQGLRGSNSS--------------------WYIGR
Q2LTC7_SYNAS      RILCALRRGPFGVVYVNALLESMLRSERLIAGSGR--------------------WYPGR
F4HA57_GALAU      RLLSALRNGQFGVEQLNQRIAEQLRRKKYIRFQHTH------------------EWYLGK
I1YH94_METFJ      RVLSALRQGPQSVASINQMMSRYLGRR---GWRAAD------------------SYYVGR
D5VBZ2_MORCB      RILCASHLGTFGDDQINDYLSLAHRAVQKIPPS-------------------VSPWFHGR
A5WER9_PSYWF      RILTAGHNGEWGDHNINDYLTRWHMTQLKLPLG-------------------KSPWFHGR
Q6FF15_ACIAD      RILVAIRFGDFGLEHINKMVEQWLTQYLGILP--------------------VGGWYIGR
A5EVY1_DICNV      RILTKTRYGAYGTAAVNEQMKKRHLAQMGVNG--------------------KRAFYQGA
D6YTF0_WADCW      RVLSPLRNGIFGVDQLNSKLLQFAYQKAGDGE------------------------EYAV
C7PDT2_CHIPD      RVLCAIREGEEGLYAINRNIEKILHDKRLIRVN--------------------AEFYENR
D4H409_DENA2      RILTPHRQMNGGTAHINTIAQQTLFRAGHTDNT--------------------KHFYHGM
Q5QUQ9_IDILO      QILTALREGPWGVKAVNQKVGEILGVNAN-------------------------TWYEGR
F8E604_FLESM      QILTPLKRGRFSTESINNYFINALKTYFHLPKL--------------------RSYFNGM
D0KVH2_HALNC      QVLCALRHGPYGVTGLNRWIEDMLRRSGALAVT--------------------GDWYIGR
I0ICH2_PHYMF      RVLTALRDGPSGEAGLNQRLLGATAPGARTEQP--------------------STWPAGC
B4RLU6_NEIG2      VVLAAWRQ---DAEDFNEAYCSYVRRKMNIPEH--------------------LAYFAGE
Q480P0_COLP3      RVLCATRQGDYGVERLNEVIKSYLGKNNAPYQQHQ------------------QTLYHGQ
D5ELP9_CORAD      RVLCAVRGGEYGVEAINDLLGEFVLGRGVAMEQ----------------------PQNGL
F5ZCK1_ALTNA      RWLTPIRKGDMGVEGLNALVFDAIKHNIKRREG---------------------FFYQGQ
L0DJ49_SINAD      RVLCLTRVLPSGADRINDRLHDQAFAATPAGSFRA------------------DDLLPGE
A0Q7L6_FRATN      RILVANKNLEIGTDKLNQKIEKFMSKPIDSNYK-------------------------GK
G4QGN2_GLANF      RLLSPTKKGRLGTEFLNTQIEQQLRKRFSHVNV--------------------GQIYRGM
J9ZC99_LEPFM      ALLGAVREGPLGTRTVNRLLRNHFENRSG-------------------------CYRRFV
I0IR81_LEPFC      GVLSPLRDGQRGVVEISRNLGQILFSNYSRSPE---------------------RSQRGH
D3PC94_DEFDS      KILTPFKRGDFGTEFLNFYVDKKLKKSFGATD-----------------------WYTGR
G0AM73_BORBD      IILSSKNFGKFGTKTLNEIIKTYLKKTYGS--------------------------FIGQ
A9BB03_PROM4      AVLCPRRFGLWSVEHVHQALLGNSLEEGVMH------------------------WPEGT
Q9JRZ2_CHLPN      CVLTPMRHGPWGVLNLNTMIHQRLARSDP---------------------------DLRI
                    *   .                                                     

RECD_BUCAP        PIIITENNQCLGIFNGEIGITNLSQKN---------------------TLQVSFLKKDN-
RECD_BUCBP        PILILKNNEEMNLFNGECGLTLLDANK---------------------KLKVFFLPKNQE
Q057F4_BUCCC      PIIIKKNNIFLKLMNGDIGICLYKKKK---------------------KKIYFLLSTGK-
Q72NZ2_LEPIC      PILITRNDKSRKLFNGDIGIVLKTEST---------------------GELRAVFPIEG-
B0SUE9_LEPBP      PIIIQSNDPMRKLFNGDIGLVVSIHS-----------------------ELRAVFPIED-
I6XV14_PSEPQ      PLIVTRNSD--VVSNGDVAVIVD---S-------------------DGRLLAAVDRG--G
K7S5A9_ACIA4      PVIVNRNMRQLEINNGDCGVVVT---E-------------------DPVPTVVLPGGS-G
D6Z1G4_DESAT      PVLVVANSYESRLFNGDLGIIWPSPDD-------------------AGQLMAFFPSAQ-G
E6WXK6_PSEUU      LLLVTENHYRHRLFNGDIGICLR--DA-------------------QGQLMAWFPGEMPD
F9ZQ69_ACICS      PVLVRRNDPIAGVYNGDLGLVLP--DT-------------------QGRLQVYFSRGPQL
A8ZX10_DESOH      PVMVLKNDYSLELFNGDVGITLWDG---------------------DRL--SVFFKDDRG
B8FB95_DESAL      PVVVNRNDAEMNLFNGDHGVYMDG---------------------------KAAFPGLQE
E8RCC9_DESPD      PILIQRNDYGLGLFNGDTGILWPD----------------------DQGRLQAWFAEENG
Q2SQD7_HAHCH      PVMVTRNDYSLGLFNGDVGLIWRDP---------------------ASGQLRAWFPDADG
B2JKV2_PARP8      PIMVTRNDYALGLFNGDIGIALPG----------------------ADGALRVFFRGADG
C7LVF6_DESBD      PVMILENDYNLGLFNGDVGIALH-----------------------VEGTLRVFFAGTEG
RECD_ECOLI        PVMIARNDSALGLFNGDIGIAL-DRGQ--------------------G--TRVWFAMPDG
Q1LST7_BAUCH      PIILLHDIQSLGLYNGDIGLIL-SESK--------------------NNKLHAYFILPNN
Q15V09_PSEA6      PVMLKQNDHSLGLFNGDIGIAMPDEEN--------------------EGLMKVWFVTEQN
F6DBR2_THICA      AIMIEKNDPATGLYNGDIGLCLPDIENP------------------NSGQLKVYFILGE-
Q6ANK0_DESPS      PILISQNDYNLGLYNGDIGICLPDED----------------------GMLKVWFETGSG
Q2LTC7_SYNAS      PIMINRNDYSLGLFNGDVGLTLPEHG---------------------GSGLSVFFRDSEG
F4HA57_GALAU      PVIILQNDNNSRLFNGDIGLVLPDKNG----------------------DLKVWF-EAEQ
I1YH94_METFJ      PILITQNQYRQQLFNGDIGIVLPDETG----------------------QLKACF-KVAE
D5VBZ2_MORCB      VVMITKNLYDLGLFNGDIGICLWGS-----------------------SGLSVYFEGEAL
A5WER9_PSYWF      PVMVLQNNYELGLFNGDIGICLQTQQK-------------------GEGGRLEVFFENKI
Q6FF15_ACIAD      PVMMTYNDYQLGLSNGDIGICFRHRT---------------------QYDQFEVYFPSLD
A5EVY1_DICNV      PVMVTRNNYAHGVFNGDIGICLAD-----------------------ERGQMLVYFREDF
D6YTF0_WADCW      PIMITRNHAKRGLFNGETGVLVREK--------------------GSTPYALGKNDYAIF
C7PDT2_CHIPD      PVILTRNYYEHGLFNGDTGIIRTDEQG----------------------VLMAWFEDSNG
D4H409_DENA2      PVMVVENDYSLNIFNGETGLILGN------------------------SELKSCFAHDKD
Q5QUQ9_IDILO      PVMVTKNDYGLKLNNGDIGLTFKDPEHGH----------------LRVAFPDQTNKSENK
F8E604_FLESM      PVLINKNDYTNRLFNGDLGLIFGEKS---------------------AELKICFPSQEDS
D0KVH2_HALNC      PIMVTRNDPALRLANGEIGITLPYVNPESPQSPPS----------LRVAFVNEIIEKGES
I0ICH2_PHYMF      PVLVTRNDPETGLSNGDLGLLERPDGR-----------------------PPEVAFEAAE
B4RLU6_NEIG2      PIMIRQNDYALELFNGDIGLIMEDVGR---------------------QGSLAAYFADAD
Q480P0_COLP3      PIMINENDYRLGLYNGDIGIIWKVIDQAGKTHLMACFEDTTLESKSAESKVDESTETSQL
D5ELP9_CORAD      PFIIRSNDKNLGLANGDCGVFRVNEGG--------------------DLLAYLPAAELGG
F5ZCK1_ALTNA      PIMIVKNNHPQRLSNGEVGIIWPDFNG----------------------KLLAWFETQDG
L0DJ49_SINAD      PVMMQVNDYSRMLFNGDQGLILSVSEG-------------------GRPAPMVVFRRADE
A0Q7L6_FRATN      PIMITQNSYSLGLFNGDVGIIWPDDTG------------------------KLRAYFDGK
G4QGN2_GLANF      PIMIVQNDYRLNLFNGDIGVIWPNENG--------------------HLEACFSAPESLE
J9ZC99_LEPFM      PVIVTENSVESGFMNGDPGLLEMEGNT----------------------AIRAFFQGPGQ
I0IR81_LEPFC      PVVVLKNSSELDLSNGDVGIIPFPWWG---------------------DPGRVYFPRGEG
D3PC94_DEFDS      QLIINKNDYSNGLYNGDMGVAVVEDKK-----------------------YLMFYDSLNK
G0AM73_BORBD      IIMITKTDYKNKLFNGERGVIFNENSK-----------------------FYALFQRKDE
A9BB03_PROM4      PVICGENQQELGLSNGDIGVIFGSNNE-------------------RRLIFRVITEKQTL
Q9JRZ2_CHLPN      PIMVTSRYETWGLFNGDTGLLCLKTQK-----------------------------LHFP
                   .:         . **: .:                                        

RECD_BUCAP        FIENIPIEILKNYKTSWSITVHKAQGSEFNNISLILPN--------------KNLKILKK
RECD_BUCBP        QIYSIPIHLVPEHQTNWTMTVHKSQGSEFSEVVLILPT--------------IMTSILTK
Q057F4_BUCCC      -IKKFNPEILFHYKTAWSTTIHKSQGSEFLSVNIIIPN--------------YFSNKFSK
Q72NZ2_LEPIC      KLFQFALDTLPEHEPAFVMSVHKSQGSEYDTILIYLPD----SIEEE-----KSNGLLNR
B0SUE9_LEPBP      RLYSFALDTLPDHEPAFFLTIHKSQGSEYKSILLYLPPMNVLDVDSE-----NNLSILNR
I6XV14_PSEPQ      QAELLNPLLLEAAQELHAMTIHKSQGSQFERVSVILPPQGSP--------------LLTR
K7S5A9_ACIA4      APRRLPCALVASLRPLQAMTVHKAQGSQFNRVTVILPPPDSP--------------LLTR
D6Z1G4_DESAT      APRMLPPGRLPRHETAFAMTIHKSQGSEFNQVAVVLPPEDSP--------------LLSR
E6WXK6_PSEUU      APRAFHPAALPAHSSAFAMTVHKAQGSEFNEVWLVLPARDSR--------------VLSR
F9ZQ69_ACICS      APLRLHPRRLGDATSAYALTVHKAQGSEFQRVLLILPPEDSP--------------VLSR
A8ZX10_DESOH      GVRKFHPGRIPEHETVYAMTVHKGQGSEFEKVVFVMPDRDGP--------------VLTR
B8FB95_DESAL      ELRHYARSMLPAHDTAFAMTVHKSQGSEFESVLLILPGENSP--------------VLTR
E8RCC9_DESPD      EVRPVSLARLPSWQVSYAITVHKAQGSEFDEVLLLLPQEDAP--------------VLSR
Q2SQD7_HAHCH      PLRSIPLYRLPAHETVYAMTIHKSQGSEFDHCVVALPETDQP--------------VLTR
B2JKV2_PARP8      ALRAVSPAALPPHDTAFALTVHKSQGSEFDHAVLMLPSTFSR--------------VLSR
C7LVF6_DESBD      -LESHSPARLPRHETCYAMTVHKSQGSEFGHTVLILPEEPCP--------------VLGR
RECD_ECOLI        NIKSVQPSRLPEHETTWAMTVHKSQGSEFDHAALILPSQ-RTPVV-------------TR
Q1LST7_BAUCH      SIKVVATSYLPKYATAFAITVYQSQELKFTHAALVLPDEICSPIF-------------TR
Q15V09_PSEA6      TLRGVLPSRLPPHDTVYAMTIHKSQGSEFDHVYLCLPRIETRSQAR----------LLSR
F6DBR2_THICA      SLRAFVPSRLPSHQTAFAMTIHKSQGSEFAHVMIVLGNELNSKTES----------LITK
Q6ANK0_DESPS      TFIRFLPVALSDYDTVFAMTVHKSQGSEFTEVMMVLPIEDNP--------------VLCR
Q2LTC7_SYNAS      NFRRFAPFRLPEHETVYAMTVHKSQGSEFDEVLMILSDRDSP--------------LLTR
F4HA57_GALAU      GFREVLSSRVPSVEPAYVMTVHKSQGSEFTRTVLVLPAEYNP--------------LLSK
I1YH94_METFJ      TFQWVSLNRLPAHETVFAMTIHKSQGSEFDEVSVLLPDEFSP--------------VLNR
D5VBZ2_MORCB      RMVAVDMLSDTVVSTAYAITVHKSQGSEWQKVAIIFDGNSERL--------------LSK
A5WER9_PSYWF      QGIAVNLLNDELIATAYAMTIHKSQGSEFDHVAVTFDNSNSRL--------------LSK
Q6FF15_ACIAD      KWIAANRLPKN-IQTAFALTIHKSQGSEFRHTAIVFDHMAQKV--------------LSQ
A5EVY1_DICNV      AVPLLFLKSDD-LDFAYALTIHKAQGSEFEQVALLLDKQEEG---------------LTR
D6YTF0_WADCW      GDRSIPALLLPAFEYAFCMSVHKSQGSEFEHVFLVMPQGSE---------------WFGR
C7PDT2_CHIPD      ELKAILPGYLTEAETVFAMTIHKSQGSEFKEVMVILPRAKDVP-------------ILTR
D4H409_DENA2      KIRHITPARLPAHVPAYSMTVHKSQGSEFDHVLFILPDSDSA--------------ILTR
Q5QUQ9_IDILO      GVRWVLPSRLTHIETVYAMTVHKSQGSEFKHTVMVLPDHDSP--------------VLSK
F8E604_FLESM      SFRQFRLKDIYGYEFAYCLTVHKSQGSEFDNVVLVLPEKSD---------------FLSR
D0KVH2_HALNC      PIRWIAPGRLTACETAFALTVHKAQGSEFDHSVLVLPAMPNP--------------VLTR
I0ICH2_PHYMF      GLRRVALALIPGARPGHAMTVHKAQGSEAHRVFVVLPDRDTE--------------VLSR
B4RLU6_NEIG2      GFKKVAVSCLPEFEPAFAMTVHKSQGSEYREVWLLPPSDAPSDEGD------DALSGLSK
Q480P0_COLP3      TIRQILPSRLPQFESVYAMTIHKTQGSEFSHVAMVISATQSEQQTLQQGKQQGGSRLLSR
D5ELP9_CORAD      EPRSYTPYALPNWDPAFALTIHKSQGSEYDSVVVVLPEMKRQ--------------FLSW
F5ZCK1_ALTNA      NLRSISLSRVPAFETVFAMTIHKSQGSEFKYVVLLLPKPESEK----------AAGLFHR
L0DJ49_SINAD      FVTHRIGSLRSVLRRSYAMTVHKSQGSEFDRVALILPDADIP--------------LNTR
A0Q7L6_FRATN      DAKAFSLNMLPKYESVYAMTIHKTQGSEFDEIVIILPAEDNE--------------ALSK
G4QGN2_GLANF      PHVAFSITSLPVFEMVYAMTIHKTQGSEFEHIDILLPNIPAGDAALQ------NNQHLSR
J9ZC99_LEPFM      TMRVASPLLMPAWEEAFALTVHKSQGSEFDHVTVLLGSESNA--------------LLSR
I0IR81_LEPFC      GEKTVPIEILPPWESALALTVHKSQGSEFSRVHLLLPRLFHP--------------FLTR
D3PC94_DEFDS      EYLKFPESLISGYDLGFALTVHKSQGSEFDNVYFILGNKDHQ--------------MLTK
G0AM73_BORBD      KYKKINLDLLTNYEFSFATTIHKSQGSEYKHIKVILENNP----------------FLTK
A9BB03_PROM4      EPKLIHPSRLRKVDPAYALTIHKSQGSEVNDVVLLWPDDS--------------------
Q9JRZ2_CHLPN      QHEPIDSRALSQYVYNYVMSVHKSQGSEYDEVIVIIPKGSE---------------VFGV
                                     :::: *  :     .                          

RECD_BUCAP        DILYTGITRTRKQLNIFS------TKEIFIKTVLKN------------------------
RECD_BUCBP        ELIYTAVTRSKKKLTIYS------DENIFIKSLKKNIIRYSGLSIHQKIKF---------
Q057F4_BUCCC      ELFYTAISRAQKKVTIYA------NKKILNKIINNNKERYSGLKKKIEELNIFS------
Q72NZ2_LEPIC      QVLYTAITRAKKQVILAG------NPQTWEIGIANFQNRNTGFRI---------------
B0SUE9_LEPBP      RILYTAITRAKERVILLG------DFQTWEFGLQSFRKRYTGIHIP--------------
I6XV14_PSEPQ      ELLYTAVTRAESGVQLYG------SPEALRKAIGTRARRASGLVRTTAPGNEKR------
K7S5A9_ACIA4      ELIYTAITRARRGLTVVG------TRESVSRAVAQPSRRRSGLARLWERRSQRDRQVGAG
D6Z1G4_DESAT      ELLYTAVSRARSRVHLFG------PEQVLSRAVDRRVTRASGLAEILTRTENGHISAPI-
E6WXK6_PSEUU      ELVYTGLTRARDSLHLCA------DPSILGTALSRHVSRVSGLAWRLGAGRSR-------
F9ZQ69_ACICS      ELLYTAVTRARREFIAVT------PLETLGRILGRHGRRMSGLATRLFPEVSGH------
A8ZX10_DESOH      ELVYTALTRARSHIEIIG------KKDIIEAAVSRSVSRRSGLVEAINNDQD--------
B8FB95_DESAL      ELLYTAVTRTRSRLRIVG------AMPSIKKAVLSPTRRPSGLQDALWKTE---------
E8RCC9_DESPD      ELLYTGITRARRRFSLFG------PRALLLRAVRRRLVRYSGLAGIV--ARIGGHPPGEE
Q2SQD7_HAHCH      ELLYTGVTRAKKRISVWG------PRHLLIKSIKRPTQRMSGLARRIWGELQPAGPAVDD
B2JKV2_PARP8      ELVYTAVTRARERVEVVG------SRAVLMRAIATPTQRDSGLAARIAEAMEAGGR----
C7LVF6_DESBD      ELLYTALTRAKKRFTLLG------TAEQVKDAIESPARRDSGLGEMLTST----------
RECD_ECOLI        ELVYTAVTRARRRLSLYA------DERILSAAIATRTERRSGLAALFSSRE---------
Q1LST7_BAUCH      ELLYAGVTKARKFLSIYAP-----DNEILADIITHPTQRRSGLTDRLRRMME--------
Q15V09_PSEA6      ELLYTGLTRAKKSFNLYS------DEQALSISVARRCQRGSGLAKRLLP-----------
F6DBR2_THICA      ELLYTAITRAKTQVTVVA------NQELLAQCVSNPIQRHSGLADCLS------------
Q6ANK0_DESPS      ELIYTGYYPGQ-GVCANG------CGKTDIYCFACPF-----------------------
Q2LTC7_SYNAS      ELIYTGVSRAKKGLLLWG------REDIIRQAISRRIKRTSGLRDALWESADVSDS----
F4HA57_GALAU      ELIYTAITRAKQTFTVFS------REAIWKAAVRTQTQRYSGLAQQIKQIFKEKESEDVI
I1YH94_METFJ      ELLYTALTRAREKVAFLS------SELTLRQTIETRHHRESGLSEQLGING---------
D5VBZ2_MORCB      ELIYTAVTRAKSAVHIYS------THDALINAINTPTVRQTGLDKVSDGQQS--------
A5WER9_PSYWF      ELIYTAVTRAKKKVSIFS------TKRALQKAVQTPTQRYTGLALQFEQKAAVD------
Q6FF15_ACIAD      ELIYTAITRAKQAVSLLV------DQDALLQSLIIRTTRKSGLIKKINKDIILVSLPKE-
A5EVY1_DICNV      ELVYTGITRAKKQLLLET------TPAILLKAMQTPTQRLTGLSTFF-------------
D6YTF0_WADCW      EMVYTAVTRAKKKLTLWG------EETVIAEALGKCCRRFSGLEERISPFLMSRP-----
C7PDT2_CHIPD      ELLYTGVTRAKQKVYVQS------SAEVLLLTATRFVERASGIGQRFADDRP--------
D4H409_DENA2      ELFYTAVTRAKTKLTVIS------TKDAVRKCLSAKIERSSGLFI---------------
Q5QUQ9_IDILO      ELLYTGITRAKERLSLVGS-----GLKVI-------------------------------
F8E604_FLESM      ELIYTAVTRARHSVVIIG------NPDILAEAVSVKTTRMSGLREKIHGVTP--------
D0KVH2_HALNC      ELIYTAITRARHRFTLVSAPTDT-TFTVLKQGIASRVQRSGQLGAKLARLDD--------
I0ICH2_PHYMF      ELLYTALTRVADRGGERGRLSILGPEAVLRAAIRRKGLRRGGLVAALSAAPP--------
B4RLU6_NEIG2      ELLYTAITRAREKFVFFG------GKKTFCQAVNTVKVRQTALGSMLERVFSQE------
Q480P0_COLP3      ELLYTGITRAKKQLTIAA------NQRVWQQGVTAQVKRHSGLYLDFDKV----------
D5ELP9_CORAD      ELVYTAITRGKRHVSLIL-------PDALIGQHLPRVQRRSGLREELLVDYK--------
F5ZCK1_ALTNA      GLVYTGLTRAKEGCLIIA------NTTTFSAMVERRDKRFSGLSEAIKMCVLEGE-----
L0DJ49_SINAD      EILYTALTRSRGAVTLVG------SRDTFAQGVARSARRYSGVAERVRAAPRPPQTDLES
A0Q7L6_FRATN      QLLYTAITRAKYKLTIIS------EQSSLRDIAQKDIKRNSNISELVSLSD---------
G4QGN2_GLANF      ELLYTGVTRAKNSLGIIA------SLSVLKECIGKTSTRLSGLKSKLSV-----------
J9ZC99_LEPFM      SLLYTAVTRARKRLTVYA------SRGVLREALSNAGGRSTGLFQALLATGRKESAPG--
I0IR81_LEPFC      ELLYTAVTRARESLVVWG------DFPVFLEGVHHQSTRHSALGDFLWSPSSIV------
D3PC94_DEFDS      ELIYTAITRAKKRVIIIG------DKQILFNAIKRKTDRKSAIGKLLYES----------
G0AM73_BORBD      ELMYTAITRAKDSLEIIS------NKETIIKLSKKSSKRDSKILEHVNSFKEIDK-----
A9BB03_PROM4      ---YICDQQIKQDKRNEN-----YDKSLMYTALTRAKNKFDLILPEAQSN----------
Q9JRZ2_CHLPN      SILYTAITRAKYRVSVWG------DPETLHKIIKKSNY----------------------
                     *                                                        

RECD_BUCAP        ---------------------
RECD_BUCBP        ---------------------
Q057F4_BUCCC      ---------------------
Q72NZ2_LEPIC      ---------------------
B0SUE9_LEPBP      ---------------------
I6XV14_PSEPQ      ---------------------
K7S5A9_ACIA4      LGDGQAVGEPGLDEAAGDGHR
D6Z1G4_DESAT      ---------------------
E6WXK6_PSEUU      ---------------------
F9ZQ69_ACICS      ---------------------
A8ZX10_DESOH      ---------------------
B8FB95_DESAL      ---------------------
E8RCC9_DESPD      ATRAGAGD-------------
Q2SQD7_HAHCH      KPDEPSGDGVQLDLW------
B2JKV2_PARP8      ---------------------
C7LVF6_DESBD      ---------------------
RECD_ECOLI        ---------------------
Q1LST7_BAUCH      ---------------------
Q15V09_PSEA6      ---------------------
F6DBR2_THICA      ---------------------
Q6ANK0_DESPS      ---------------------
Q2LTC7_SYNAS      ---------------------
F4HA57_GALAU      KGNSGIE--------------
I1YH94_METFJ      ---------------------
D5VBZ2_MORCB      ---------------------
A5WER9_PSYWF      ---------------------
Q6FF15_ACIAD      ---------------------
A5EVY1_DICNV      ---------------------
D6YTF0_WADCW      ---------------------
C7PDT2_CHIPD      ---------------------
D4H409_DENA2      ---------------------
Q5QUQ9_IDILO      ---------------------
F8E604_FLESM      ---------------------
D0KVH2_HALNC      ---------------------
I0ICH2_PHYMF      ---------------------
B4RLU6_NEIG2      ---------------------
Q480P0_COLP3      ---------------------
D5ELP9_CORAD      ---------------------
F5ZCK1_ALTNA      ---------------------
L0DJ49_SINAD      VNWK-----------------
A0Q7L6_FRATN      ---------------------
G4QGN2_GLANF      ---------------------
J9ZC99_LEPFM      ---------------------
I0IR81_LEPFC      ---------------------
D3PC94_DEFDS      ---------------------
G0AM73_BORBD      ---------------------
A9BB03_PROM4      ---------------------
Q9JRZ2_CHLPN      ---------------------