CLUSTAL format seed alignment for MF_01495

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PSBB_PROHO        ------------------------MGLPWYRVHTAVINDPGRLLAVHLMHTALVLGWAGS
B0CFM2_ACAM1      ------------------------MGLPWYRVHTVVLNDPGRLLSVHLMHTALVSGWAGS
Q46H52_PROMT      ------------------------MGLPWYRVHTVVINDPGRLLAVHLMHTALLAGWAGS
A9BDX1_PROM4      ------------------------MGLPWYRVHTVVINDPGRLLAVHLMHTALLAGWAGS
A8G2X6_PROM2      ----------MFSCLVSIVTRNLPMGLPWYRVHTVVINDPGRLLAVHLMHTALLAGWAGS
Q7NCI0_GLOVI      ------------------------MGLPWYRVHTVVTSDPGRLIAVHLMHTALVAGWAGS
U5QI51_9CYAN      ------------------------MGLPWYRVHTVVTSDPGRLIAVHLMHTALVAGWAGS
PSBB_THEVL        -------------------------GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGS
PSBB_THEEB        ------------------------MGLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGS
PSBB_NOSS1        ------------------------MGLPWYRVHTVVLNDPGRLISVHLMHTALVAGWAGS
PSBB_SYNY3        ------------------------MGLPWYRVHTVVLNDPGRLISVHLMHTALVAGWAGS
PSBB_SYNE7        ------------------------MGLPWYRVHTVVLNDPGRLIAVHLMHTALVAGWAGS
PSBB_GUITH        ------------------------MGLPWYRVHTVVLNDPGRLIAVHLMHTALVAGWAGS
PSBB_PORPU        ------------------------MGLPWYRVHTVVLNDPGRLIAVHLMHTALVAGWAGS
PSBB_TRICV        ------------------------MALPWYRVHTVVLNDPGRLIAVHLMHTALVAGWAGS
PSBB_CYACA        ------------------------MALPWYRVHTVVLNDPGRLISVHLMHTALVSGWAGS
PSBB_CYAPA        ------------------------MGLPWYRVHTVVLNDPGRLIAVHLMHTALVAGWAGS
PSBB_CHLRE        ------------------------MGLPWYRVHTVVINDPGRLISVHLMHTALVSGWAGS
PSBB_CHLVU        ------------------------MGLPWYRVHTVVLNDPGRLIAVHLMHTSLVSGWAGS
PSBB_NEPOL        ------------------------MGLPWYRVHTVVLNDPGRLIAVHLMHTALVSGWAGS
PSBB_OSTTA        ------------------------------------------------------------
PSBB_CHLAT        ------------------------MGLPWFRVHTVVLNDPGRLISVHLMHTALVSGWAGS
PSBB_BIGNA        ------------------------MGLPWYRVHTVVLNDPGRLIAVHLMHTSLVSGWAGS
PSBB_CICAR        ------------------------MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGS
PSBB_PINKO        ------------------------MGLPWYRVHTVVLNDPGRLISVHIMHTALVAGWAGS
PSBB_PHYPA        ------------------------MGLPWYRVHTVVLNDPGRLIAVHLMHTALVSGWAGS
C7B2H2_SELML      ------------------------MGLPWYRAHTVVSNDPGRSLPVHLMHTALVSGWAGP
PSBB_EUGGR        ------------------------MGLPWYRVHTVVLNDPGRFISVHLMHTALVSGWAGS
G1E7A1_KARVE      MFFTFDIVFDWLVMVDFFTDNEPLGFVPWFRVHMVVYNDPGRLISVHLVHTALVTYWAGT
D9IXH8_9ALVE      -------------------MGRQRRILPWYRVHSILFNDPGRLISVHLMHTALIAGWAGA
Q2I6P8_LINPO      ------------------------MGLPWFRVHICILNDPGRLISVHIMHNALVAGWSGV
Q9XQV0_HETTR      ------------------------MRLPWFRVHIVILNDPGRLISVHIMHTALVAGWAAV
Q1HCK7_AMPCA      ------------------------MRLPWFRVHIVVLNDPGRLISVHLMHTGLISGWAGL
                                                                              

PSBB_PROHO        MALYELAVFDPSDAVLNPMWRQGMFVLPFMTRLGVTHSWSGWTVTG-------EPWINEP
B0CFM2_ACAM1      MALYELAKYDPSDPVLNPMWRQGTFVMPVMTRIGVTHSWSGWTVTG-------EPWVTQP
Q46H52_PROMT      MALYELAIFDPSDPVLNPMWRQGMYVMPFMARLGITGSWNGWDITG-------ATGV---
A9BDX1_PROM4      MALYELAIFDPSDPVLNPMWRQGMYVMPFMARLGVTSSWKGWDITG-------GVGSF--
A8G2X6_PROM2      MALYELAIFDPSDAVLNPMWRQGMYVMPFMARLGITSSWNGWDITG-------ATGV---
Q7NCI0_GLOVI      MAFFEASVFNPEDPVLDPMWRQGMYVIPFMARLGVINSWSGWSVFG-------PFTADGL
U5QI51_9CYAN      MAFYEVATFNPSDPILNPMWRQGMFVIPFMTRLGVINSWSGWSVFG-------PFTSDGL
PSBB_THEVL        MALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITG-------ETGI---
PSBB_THEEB        MALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITG-------ETGI---
PSBB_NOSS1        MALYELAIYDPSDPVLNPMWRQGMFVLPFMARLGVTQSWGGWSVTG-------GTAT---
PSBB_SYNY3        MALYELAIFDSSDAVLNPMWRQGMFVLPFMARLGVTSSWNGWSVTG-------ETGL---
PSBB_SYNE7        MALYELAIFDPSDAVLNPMWRQGMFVLPFMARLGVTQSWGGWSITG-------ETAV---
PSBB_GUITH        MALYELAVFDPSDPVLNPMWRQGMYVMPFMARIGVTDSWGGWSITG-------ESVS---
PSBB_PORPU        MALYELAVFDPSDPVLNPMWRQGMFVMPFMARLGVTDSWGGWSITG-------ESVS---
PSBB_TRICV        MALYELAVFDPSDPVLNPMWRQGMFVMPFMTRLGITDSWGGWSITG-------ESVS---
PSBB_CYACA        MALYELAVFDPSDPVLNPMWRQGMFVMPFMARLGVTDSWGGWSITG-------ESVS---
PSBB_CYAPA        MALYEIAVFDPSDPVLNPMWRQGMFVLPFMVRLGITNSWGGWTING-------ENVT---
PSBB_CHLRE        MALFEISVFDPSDPVLNPMWRQGMFVLPFMTRLGITQSWGGWTISG-------ETAT---
PSBB_CHLVU        MAFYELAVFDPSDPVLNPMWRQGMFVLPFMTRLGITQSWGGWTISG-------ETAA---
PSBB_NEPOL        MALYEISVFDPSDPVLNPMWRQGMFVIPFMTRLGVTKSWGGWSITG-------ESVS---
PSBB_OSTTA        ------------------MWRQGMFVLPFMTRLGVTNSWGGWTISG-------ESTS---
PSBB_CHLAT        MAFYELAVFDPSDPVLNPMWRQGMFVLPFMTRLGITKSWGGWNISG-------ESIS---
PSBB_BIGNA        MAFYELALFDPSDPILNPMWRQGMFVLPFMTRIGITQSWSNWSISG-------DSVV---
PSBB_CICAR        MALYELAVFDPSDPVLDPMWRQGMFVIPFMTRLGITNSWGGWNITG-------GTIT---
PSBB_PINKO        MTLYELAVFDPSDPVLDPMWRQGMFVIPFMTRLGIKDSWSGWNITG-------ETVI---
PSBB_PHYPA        MALYELAVFDPSDPILDPMWRQGMFVIPFMTRLGITKSWGGWSITG-------ETVN---
C7B2H2_SELML      MAPYELAVSDPSDPALDPMRRQGMSVIPLTTRPGVTESWSGWSIAG-------ETVT---
PSBB_EUGGR        MALYELAIFDPSDVALNPMWPQGMFVLPFMTRLGVTKSWGAWSVTG-------ESFS---
G1E7A1_KARVE      MTFYELGVTNNSEQILNPFWRQGSLVIPMMMRLGITASWKGWNITN-------LLYL---
D9IXH8_9ALVE      MTLYELNIFDPSDPVLNPMWRQGMYVLPFMARLGITNSSDKWNLFGSQDYYKSDTPNGTG
Q2I6P8_LINPO      MLLYELIIQDPSDPVLNPIWRQGCYVMPFVSRLGVVRSFYDWSLGIEL------------
Q9XQV0_HETTR      MTLYELIILDPTDPVYNPIWRQGAYVMPFISRLGVVRSLYDWSLGIEV------------
Q1HCK7_AMPCA      MALYELIVTDPSDPVYNPVWRQADYVIPQMAKLGVVSSSYGWSLTGS-------------
                                    .  *.  *:*   : *:  *   * :                

PSBB_PROHO        G----FLNAHFNFW-------SYEGVALMHIVLSGLFFLAAVWHWVYWDLDLFED---PR
B0CFM2_ACAM1      G----ILGAHLNFF-------SYEGVILMHILAAGLFFLAAVWHWINWDLDIYYP---DG
Q46H52_PROMT      ---------DPGFW-------SFEGVAAAHIVFSGLLMLAAVWHWTYWDLELWED---SR
A9BDX1_PROM4      ------DFDSLGFWGKALPYSTFEGVAVAHILFSGLLMLAAIWHWTYWDLELWED---SR
A8G2X6_PROM2      ---------DPGFW-------SFEGVAAAHIVFSGLLILASIWHWTYWDLDLWED---PR
Q7NCI0_GLOVI      GNRIDPNVANVGFW-------SFEGVAAAHIVLSGLLFLAACWHWVNWDLELFRN---PR
U5QI51_9CYAN      GN---PVTGDVGFW-------SFEGVAAAHIVLSGLLFLAACWHWVNWDLELFRN---PR
PSBB_THEVL        ---------DPGFW-------SFEGVALAHIVLSGLLFLAACWHWVYWDLELFRD---PR
PSBB_THEEB        ---------DPGFW-------SFEGVALAHIVLSGLLFLAACWHWVYWDLELFRD---PR
PSBB_NOSS1        ---------DPGFW-------SFEGVAAAHIVLSGLLFLAAVWHWVYWDLELFRD---PR
PSBB_SYNY3        ---------DPGFW-------SFEGVAAAHIVLSGLLFLAAVWHWVFWDLELFVD---PR
PSBB_SYNE7        ---------DPGYW-------SFEGVAIAHIVLSGLLFLAAVWHWVYWDLELFTD---PR
PSBB_GUITH        ---------NPGFW-------SFEGVALAHIGLSGLLFLAAVWHWVYWDLELFRD---PR
PSBB_PORPU        ---------NPGLW-------SLEGVALTHIVLSGMLFLAAIWHWVYWDLELFRD---PR
PSBB_TRICV        ---------NPGIW-------SFEGVALSHIILSGMCFLAAIWHWVYWDLELFRD---PR
PSBB_CYACA        ---------NPGLW-------SFEGVALTHIVLSGLLFLASIWHWVYWDLDLFRD---PR
PSBB_CYAPA        ---------DPGFW-------SFEGVAAAHIGLSGLLFLAAIWHWVYWDLELFRD---PR
PSBB_CHLRE        ---------NPGIW-------SYEGVAAAHIILSGALFLASVWHWTYWDLELFRD---PR
PSBB_CHLVU        ---------NPGVW-------SYEGVAAAHIVLSGLLFAASIWHWVYWDLELFRD---PR
PSBB_NEPOL        ---------NPGIW-------SYEGVATAHILLSGALFMAAIWHWVFWDLELFRD---PR
PSBB_OSTTA        ---------NPGLW-------SYEGVAASHIILSGLLFLAAIWHWVFWDLELFRD---PR
PSBB_CHLAT        ---------DPGLW-------SYEGVAATHIVLSGLLFLASIWHWVYWDLELFRD---PR
PSBB_BIGNA        ---------NPGIW-------SYEGVAASHIILSGLLFMAAIWHWVYWDLELFID---KR
PSBB_CICAR        ---------NPGIW-------SYEGVAGAHIVFSGLCFLAAIWHWVYWDLEIFCD---ER
PSBB_PINKO        ---------NPGIW-------SYEGVAGAHIMFSGLMFLAAIWHWVYWDLEIFYD---ER
PSBB_PHYPA        ---------NAGIW-------SYEGVAAVHIVLSGLLFLAAIWHWVYWDLELFRD---ER
C7B2H2_SELML      ---------NAGIR-------SYEGVATAHIVPPGLLLLAAIWHWVYWDSEISSD---ER
PSBB_EUGGR        ---------DPGIW-------SYEGVAVAHIILSGLLFLAAIWHWVYWDLDLFRD---PA
G1E7A1_KARVE      ---------NPGVW-------SFEGVAITHYILAFLLFLAASWHWVWWDLDLFSD---EK
D9IXH8_9ALVE      VLNWWTRTGNQGGW-------TFESVALAHFGLSGMLILASMWHWYYWNLDLFENDNVFF
Q2I6P8_LINPO      --------ESNYFW-------TYETVSGAHILLSGLFILAAFWHWSYWDLDVFVS---VV
Q9XQV0_HETTR      --------TNNPYW-------TYETVAVSHILLSGFSILAAFWHWAYCYLDLFVS---ST
Q1HCK7_AMPCA      --------SNPAVW-------TMEVVAATHILFSGLLILAAFWHWAYWDLELFIN---AS
                                       : * *   *   .   : *: ***     ::        

PSBB_PROHO        TGEPALDLPKIFGGHLFLLGFLCFNFGTFHLTGIFGPGMWVSDA----------------
B0CFM2_ACAM1      SSEPASDWPKIFGLHLLTLGIVCFGFGSLHLTGILGPGMWVSDP----------------
Q46H52_PROMT      TGEPALDLPRIFGIHLFLAGLTCFGFGAFHCSSV---GIWVSDP----------------
A9BDX1_PROM4      TGEPALDLPRIFGIHLLLAGLTCFGFGAFHLSAV---GMWVSDS----------------
A8G2X6_PROM2      TGEPALDLPRIFGIHLLLAGITCFGFGAFHCANV---GIWVSDP----------------
Q7NCI0_GLOVI      NGELGLDLPKIFGIHLLLSGLACFGFGAVHMQTI---GMWVSADPIYVELGKYGNLLQGM
U5QI51_9CYAN      NGELGLDLPKIFGIHLLLAGILCFGFGAVHLQTV---GMWYSLDPLYVEAGKYGDYIQRL
PSBB_THEVL        TGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDP----------------
PSBB_THEEB        TGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDP----------------
PSBB_NOSS1        TGEPALDLPKMFGIHLFLSGLLCFGFGAFHLTGLFGPGMWISDP----------------
PSBB_SYNY3        TGESALDLPKMFGIHLFLSGLLCFGFGAFHLTGVWGPGMWVSDP----------------
PSBB_SYNE7        TGEPALDLPKMFGIHLFLSGLLCFGFGAFHLSGLWGPGMWVSDP----------------
PSBB_GUITH        TGNPALDLPKIFGIHLVLAGLLCFGFGAFHVTGAWGPGIWVSDA----------------
PSBB_PORPU        TGEPALDLPKIFGIHLLLSSLLCFGFGAFHVTGLFGPGMWVSDG----------------
PSBB_TRICV        TGEPALDLPKIFGIHLFLSGLLCFGFGAFHVTGLFGPGIWVSDA----------------
PSBB_CYACA        TLEPALDLPKVFGIHLVLSSLLCFGFGAFHVTGLFGPGIWISDA----------------
PSBB_CYAPA        TGEPALDLPKMFGIHLFLSGLLCFGFGAFHLTGLFGPGMWVSDA----------------
PSBB_CHLRE        TGKTALDLPKIFGIHLFLSGLLCFGFGAFHVTGVFGPGIWVSDP----------------
PSBB_CHLVU        TSNPALDLPKIFGIHLFLSGVLCFGFGAFHVTGIFGPGIWVSDP----------------
PSBB_NEPOL        TGEPALDLPKIFGIHLFLSGLLCFGFGAFHVTGLYGPGIWVSDP----------------
PSBB_OSTTA        TQQPALDLPKIFGIHLFLSGVLCFGFGAFHVTGLFGPGIWVSDP----------------
PSBB_CHLAT        TGKPALDLPKIFGIHLFLSGLLCFGFGAFHVTGLFGPGIWVSDP----------------
PSBB_BIGNA        TMFPVLDLPKIFGIHLLLSGILCFGFGAFHVTGLFGPGIWVSDP----------------
PSBB_CICAR        TGKPSLDLPKIFGIHLFLAGVGCFGFGAFHVTGLFGPGIWVSDP----------------
PSBB_PINKO        TGKLCLDLPKVFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDP----------------
PSBB_PHYPA        TGKPSLDLPKIFGIHLFLSGVLCFAFGAFHVTGLFGPGIWVSDP----------------
C7B2H2_SELML      TGTFALDLPKISGVHPSPPGVPRFGFGASHVTGLLGPGIWVSDP----------------
PSBB_EUGGR        SGELKLDLPRVFGVHLFLSGALCLAFGVFHVTGVFGPGIWVSDP----------------
G1E7A1_KARVE      N-ESLLDLPKIFGIHLTLASILAFTFGTFHLTGVIGPGFWINED----------------
D9IXH8_9ALVE      QNVTTLDYLLLFSIHLTLASALCFGFGALHLTGTWGPGVWMNDR----------------
Q2I6P8_LINPO      SGNFVLDLNRIFGLHLSLAAIVCFGFGLAHLTGFFGPGFWTSDS----------------
Q9XQV0_HETTR      TGKLVLDLNRIFGIHLCLAALLCFGFGLAHLTGFGGPGMWTSDS----------------
Q1HCK7_AMPCA      TGKRVLDLNKIFGIHLFLASLTCFGFGYAHLGGIFGPGMWASDE----------------
                        *   : . *    .   : **  *       *.* .                  

PSBB_PROHO        -----------YGLTGHIEHIAPEWGPAGFNPFNPGGVVAHHIAAGITLMIGGVFHLTAR
B0CFM2_ACAM1      -----------YGLTGHVQGVSPDWRPFAFDPYNPTGLVTHHISAGIALIIGGIFHTVSR
Q46H52_PROMT      -----------YGLTGHVEKVAPVWGAEGFNPFNAGGIVANHVGAGLLGIIGGIFHITNR
A9BDX1_PROM4      -----------YGLGGHVEKVAPVWGADGFNPFSAGGIVANHIGAGLLGIIGGVFHITNR
A8G2X6_PROM2      -----------YGLTGHVEPVSPSWGVDGFNPFNPGGIVANHIAAGLLGIIGGIFHITNR
Q7NCI0_GLOVI      ----------NPEALGVVVPTGFAWGADGFNPYNPAGIAAHHVAAGIVGILGGIFHIAVR
U5QI51_9CYAN      AANIPKDAFGNFKSTGIVVPTGFAWGADGFNPYNPAGIAAHHVAAGIVGILGGIFHIAVR
PSBB_THEVL        -----------YGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVR
PSBB_THEEB        -----------YGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVR
PSBB_NOSS1        -----------YGVTGSVQPVAPEWGPDGFNPFNPGGVVAHHIAAGIVGIIAGLFHLTVR
PSBB_SYNY3        -----------YGLTGHVQPVAPEWGPAGFNPFNPGGVVAHHIAAGIVGIIAGLFHLTVR
PSBB_SYNE7        -----------YGLTGHVQPVAPAWGPEGFNPFNPGGIVAHHIAAGVVGIVAGLFHLTVR
PSBB_GUITH        -----------YGITGKVQPVAPTWGPEGFNPFNPSGVASHHIAAGILGFIAGIFHIAVR
PSBB_PORPU        -----------YGVTGKVLPVAPAWGPEGFNPFNPGGVASHHIAAGTVGILAGVFHLTVR
PSBB_TRICV        -----------YGVTGKVQPVAPAWGADGFNPFNPGGIAAHHIAAGIFGIFAGIFHLTVR
PSBB_CYACA        -----------YGLTGRIQSVAPAWGPEGFNPFNPGGIASHHIAAGTVGILAGVFHLNVR
PSBB_CYAPA        -----------YSITGRVQPVAPAWGPEGFNPFNPGGVVSHHIAAGIVGILAGLFHLSVR
PSBB_CHLRE        -----------YGLTGRVQPVAPSWGADGFDPYNPGGIASHHIAAGILGVLAGLFHLCVR
PSBB_CHLVU        -----------YGITGTVQAVAPSWDATGFDPYNPGGISAHHIAAGILGVLAGLFHLCVR
PSBB_NEPOL        -----------YGITGSVQPVEPAWGPEGFDPFNPGGIASHHIAAGILGILAGLFHLSVR
PSBB_OSTTA        -----------YGLTGAVEPVAPAWGAEGFDPYNPGGIAAHHIAAGIVGILAGLFHLSVR
PSBB_CHLAT        -----------YGITGRVQPVAPAWGAEGFDPFNPGGIASHHIAAGILGILAGLFHLTVR
PSBB_BIGNA        -----------YGLTGKVQQISPAWGADGFDPFNPGGVASHHIAAGILGIIAGLFHLSVR
PSBB_CICAR        -----------YGLTGRVQSVNPAWGVDGFDPFVPGGIASHHIAAGTLGILAGLFHLSVR
PSBB_PINKO        -----------YGLTGKIQPVDPAWGAEGFDPFVPGGIASHHIAAGILGILAGLFHLSVR
PSBB_PHYPA        -----------YGLTGKVQPVVPAWGAEGFDPFVPGGIASHHIAAGILGILAGLFHLSVR
C7B2H2_SELML      -----------YGLTGRIEPVAPVWTAAGFDPFVPGGIASHHIAAGILGILAGLFHPSAR
PSBB_EUGGR        -----------YGLSGKIEPVIPSWGAEGFDPYNVGAIASHHIAAGLLGLIAGGFHVLVR
G1E7A1_KARVE      ----------SYGLVGNIQGLAPELGFQGFNPFNPTGIVSHHIFSGIIGILASIFHLNIR
D9IXH8_9ALVE      -----------FGLNPHLVYVQPEWGGEGFNPFNLSGVPAHHIAAGTLGLLGGYFHLRVR
Q2I6P8_LINPO      -----------FGIVGSVRFVKPVYSLIGLSPFCYGVISSNHIGAGFFGIFLGLWHISTR
Q9XQV0_HETTR      -----------FGIVGSVRFVKPVYSVIGLTPFCYGVISSNHIVAGFFGIAVGLWHVSSR
Q1HCK7_AMPCA      -----------TAVAGAVRAITPNYSILALSPFSFGTIVAHHTVAGIIGVGVGIWHISSR
                                   :          .: *:    : ::*  :*   .  . :*   *

PSBB_PROHO        PPERLYTALRMGNVETALASAIAAVFGAAFVVAGTMWYGHVTTPIELFGPTRYQWDQGYF
B0CFM2_ACAM1      PSERLYNALSMGNVETVLSSSVAFVAAAAFVMVGTMWYGSATTPIELFGPTRYQWDSGYF
Q46H52_PROMT      PGERLYRALKLGSLEGVLASALAAVLFVSFVVAGTMWYGSATTPVELFGPTRYQWDSGYF
A9BDX1_PROM4      PGERLYRNLRMGSLEGVLASALAAVLFVSFVVAGTMWYGSATTPIELFGPTRYQWDSGYF
A8G2X6_PROM2      PGERLYKALRLGSLEGVLASALAAVLFVSFVVAGTMWYGSATTPIELFGPTRYQWDSGYF
Q7NCI0_GLOVI      PPERLYRALRMGNIETVLASALAAVFFAAFVVAGTFWYGTATNPVELFGPVRYFWDAQVY
U5QI51_9CYAN      PPERLYRSLRMGNIETVLASALAAVFFAAFVVAGTFWYGSATNPVELFGPVRYSWDAQLY
PSBB_THEVL        PPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYF
PSBB_THEEB        PPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYF
PSBB_NOSS1        PPERLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGNATTPIELFGPTRYQWDQGYF
PSBB_SYNY3        PPERLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGNATTPIELFGPTRYQWDKGYF
PSBB_SYNE7        PPERLYKALRMGNIETVLSSSLAAVFFAAFVVAGTMWYGNAATPVELFGPTRYQWDQGYF
PSBB_GUITH        PPQRLYRALRMGNIETVLSSSIAAVFFAAFITTGTMWYGSATTPIELFGPTRYQWDSGYF
PSBB_PORPU        PPQRLYRALRMGNIETVLSSSISAVFFSAFITCGTMWYGSATTPIELFGPTRYQWDSGYF
PSBB_TRICV        PPQRLYRALRMGNIETVLSSSIAAVFFAAFVTSGTMWYGAAATPIELFGPTRYQWDSGYF
PSBB_CYACA        PPQRLYRALRMGNIETVLSSSIAAVFFASFVVSGTMWYGAASTPIELFGPTRYQWDSGYF
PSBB_CYAPA        PPQRLYKALRMGNIETVLSSSISAVFFAAFIVAGTMWYGSAATPVELFGPTRYQWDQEYF
PSBB_CHLRE        PSIRLYFGLSMGSIETVLSSSIAAVFWAAFVVAGTMWYGSAATPIELFGPTRYQWDQGFF
PSBB_CHLVU        PPQRLYNGLRMGNIETVLSSSIAAVFWAAFVVSGTMWYGSAATPIELFGPTRYQWDLGFF
PSBB_NEPOL        PPQRLYKALRMGNVETVLSSSIAAVFWAAFVVSGTMWYGSAATPIELFGPTRYQWDQGFF
PSBB_OSTTA        PPQRLYKALRMGNVETVLSSSIAAVFWAAFVVGGTMWYGCAATPIELFGPTRYQWDQGFF
PSBB_CHLAT        PPFRLYKALRMGNIETVLSSSIAAVFWAAFVVAGTMWYGSAATPIELFGPTRYQWDLGFF
PSBB_BIGNA        PSQRLYDALKMGNIETVLSSSIAAVFWAAFVVAGTMWYGSAATPIELFGPTRYQWDQGYF
PSBB_CICAR        PPQRLYKGLRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYF
PSBB_PINKO        PPQRLYVGLRMGNIETVLSSSIAAVFFAAFIVAGTMWYGSATTPVELFGPTRYQWDQGYF
PSBB_PHYPA        PPQRLYKGLRMGNVETVLSSSIAAVFFAAFVVAGTMWYGSAATPVELFGPTRYQWDQGFF
C7B2H2_SELML      PPQRSHKSLRMGNVETVSSSSIAAVPLAALVVAGTMWYGSATTPVEPFGPTRYQWDLGFY
PSBB_EUGGR        PSQRLFVLLRMGNIETVLSSSIAAVFWSAFVVSGTMWYGSASTPIELFGPTRYQWDKGYF
G1E7A1_KARVE      PALGLYRGLRMNDIETVLSSSIAAVFFSGFIVAGTMWYGSATSPISLFGPTRYQWDSGFF
D9IXH8_9ALVE      PGLYLFLWAHMGNIETILASGIAALLFAALLTTASMWYGTVLTPITLFGPTRYQWDSGFF
Q2I6P8_LINPO      PGPLLYKLLGMGNIESVLSSSISSVFFSAFVTSGLMWYGSVSTALELFGPSRYHWDNGYF
Q9XQV0_HETTR      PGPTLYKLLGMGNIEGALSSSIAAVFFTAFITSATMWYGSLSTALELFGPSRYHWDNGYF
Q1HCK7_AMPCA      PGAFIYQAVRMYSIESVLASSIIAVFFTALITSSASWYGSLTQPVELNGPTRYHWDNAYF
                  *    .    : .:*   :*.:  :   .::  .  ***    .:   ** ** **   :

PSBB_PROHO        TQEIQRRVDSQLAE--GASLSEAWSSIPEKLAFYDYVGNSPAKGGLFRVGAMDSGDGIAE
B0CFM2_ACAM1      QTEIQRRVQS----------GQTWDQIPEKLVFYDYIGNSPAKGGLFRTGAMNSGDGIAR
Q46H52_PROMT      KTEINRRVQESMND--GASKAEAYASIPEQLAFYDYVGNSPAKGGLFRVGAMVNGDGVPS
A9BDX1_PROM4      KTEINRRVQASINE--GASKEEAYAAIPEKLAFYDYVGNSPAKGGLFRAGALVNGDGVPT
A8G2X6_PROM2      KTEINRRVQAAIDN--GATREEAYESIPEKLAFYDYVGNSPAKGGLFRVGALVNGDGLPT
Q7NCI0_GLOVI      DKKVNELVTANVAK--GMSRAEAENAVPLRLRFYDYVGNSPAKGGLFRGGPMNNGDGVAT
U5QI51_9CYAN      DERIDQLVAANIAK--GMSPKQAEDAVPLRLRFFDYVGNSPAKGGLFRGGPMNNGDGIAN
PSBB_THEVL        QQEINRRVQASLAS--GATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQ
PSBB_THEEB        QQEINRRVQASLAS--GATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQ
PSBB_NOSS1        HQEIERRVQSSVAQ--GASLSEAWSQIPEKLAFYDYVGNSPAKGGLFRTGPMVKGDGIAQ
PSBB_SYNY3        QEEIQRRVDSQLAE--GASLSEAWSTIPEKLAFYDYVGNSPAKGGLFRTGAMNSGDGIAQ
PSBB_SYNE7        RQEIARRVDTAVAS--GASLEEAWSSIPEKLAFYDYVGNSPAKGGLFRTGQMNKGDGIAQ
PSBB_GUITH        QQEIERRVENSLNE--GLSLSEAWSRIPDKLAFYDYVGNNPAKGGLFRAGPMNKGDGIAE
PSBB_PORPU        QQEIEKRVENAIAD--GAAPSEAWSRIPDKLAFYDYIGNNPAKGGLFRAGPMNKGDGVAE
PSBB_TRICV        QQEIERQVETSVSE--GLSESQAWSRIPDKLAFYDYIGNNPAKGGLFRAGPMNKGDGIAE
PSBB_CYACA        QQEIEKRVEESLSN--GLSLPEAWSNIPDKLAFYDYIGNNPAKGGLFRAGPMNKGDGIAE
PSBB_CYAPA        HQEMERRVQKDVAA--GASLSEAWNRIPAKLAFYDYIGNNPAKGGLFRAGPMNKGDGIAE
PSBB_CHLRE        QQEIQKRVQASLAE--GASLSDAWSRIPEKLAFYDYIGNNPAKGGLFRTGAMNSGDGIAV
PSBB_CHLVU        QQEIERRVQTNLSE--GKSASQAWAEIPEKLAFYDYIGNNPAKGGLFRAGAMNSGDGIAV
PSBB_NEPOL        QQEIEKRVQGSLAS--GASLSDAWAKIPEKLSFYDYIGNNPAKGGLFRAGAMNSGDGIAA
PSBB_OSTTA        QQEIEKRVQTSVAG--GASLSTAWSTIPEKLAFYDYIGNNPAKGGLFRSGPMDNGDGIAA
PSBB_CHLAT        QQEIEKRVQASLAG--GASLSEAWSSIPEKLAFYDYIGNNPAKGGLFRAGPMNNGDGIAA
PSBB_BIGNA        QQEIERRVQANIDN--GNSIDKAWSLIPEKLAFYDYIGNNPAKGGLFRVGAMNSGDGIAV
PSBB_CICAR        QQEIYRRVGAGLAE--NQSLSEAWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAV
PSBB_PINKO        QQEIDRRVRAGLAE--NLSLSEAWSKIPEKLAFYDYIGNNPAKGGLFRAGAMDNGDGIAV
PSBB_PHYPA        QQEIDRRIRASKSE--NLSLSEAWSKIPEKLAFYDYIGNNPAKGGLFRAGAMDNGDGIAV
C7B2H2_SELML      QQETDRRIRSARAG--NIGLPEAWSKIPEKSASHDHIGSNPAKGGSSRAGATDSGDGIAV
PSBB_EUGGR        QEEIERRVQASLSD--GCSLSEAWGAISPKLAFYDYIGNNPAKGGLFRSGPMNNGDGIAT
G1E7A1_KARVE      QQHIENLVEAYYTR--GFSKEQAWSKIPDRLAFYDYIGNNPGKGGLFRAGSMTRGDGVAK
D9IXH8_9ALVE      QTQVDELVTDNLAK--YGSLAKAYQQLPDRLLFYDYIGNNPGKGGLFRAGALNKGDGVAK
Q2I6P8_LINPO      SIDIERRVNNIVGKNFDLLLNKAWEQVPEKLVFYDYIGCNPSKGGLFRSGPMIKGDGIVQ
Q9XQV0_HETTR      SLDIERRVKSVD----SVFLNKGWEEVPEKLVLYDYIGCNPAKGGLFRSGPQLKGDGVVQ
Q1HCK7_AMPCA      NQEIETQVQLSRAA--GLSLNASYDEVPDKLYLYDYLGSNPAKGGLFRAGPITKGDGIIE
                         :                  :. :   .*::* .*.***  * *    ***:  

PSBB_PROHO        EWLGHPVFQDGAGRA-LSVRRLPNFFENFPVILTDG-DGVVRADIPFRRSESQYSFEQTG
B0CFM2_ACAM1      AWEGHPTFTDSEGRE-LFVRRMPNFFETFPVVLTDK-DGVVRADIPFRRAESRYSFEQKG
Q46H52_PROMT      GWQGHISFTDSDGND-LEVRRIPNFFENFPVILEDK-DGNVKADIPFRRAEAKYSIEQTG
A9BDX1_PROM4      GWQGHVSFSDKEGNE-LEVRRMPNFFENFPVILEDK-DGNVRADIPFRRAEAKYSFEQTG
A8G2X6_PROM2      GWQGHIAFQDKDGND-LEVRRIPNFFENFPVILEDK-EGNVRADIPFRRAEAKYSFEQTG
Q7NCI0_GLOVI      GWLGQPVFKDKEGRE-LRVVHLNTLYETQPVVLVDS-NNIPRADIPFQRSESQLSFEQTG
U5QI51_9CYAN      GWLGHPIFKDKEGRT-LRVMHLNTLYETQPVVLIDK-DGIPRADIPFQRSESQLSIEQTG
PSBB_THEVL        AWKGHAVFRNKEGEE-LFVRRMPAFFESFPVILTDK-NGVVKADIPFRRAESKYSFEQQG
PSBB_THEEB        AWKGHAVFRNKEGEE-LFVRRMPAFFESFPVILTDK-NGVVKADIPFRRAESKYSFEQQG
PSBB_NOSS1        SWQGHGVFKDAEGRE-LTVRRLPNFFETFPVILTDA-DGVVRADIPFRRAESKYSFEQSG
PSBB_SYNY3        EWIGHPIFKDKEGRE-LEVRRMPNFFETFPVIMTDA-DGVVRADIPFRRSESKFSVEQTG
PSBB_SYNE7        GWLGHAVFKDKNGDV-LDVRRLPNFFENFPIVLTDS-KGAVRADIPFRRAEAKFSFEETG
PSBB_GUITH        AWLGHPVFQDKEGRE-LTVRRMPAFFETFPVILVDK-DGIIRADIPFRRAESKYSVEQVG
PSBB_PORPU        AWLGHPVFQDKEGRE-LSVRRMPAFFETFPVILVDK-DGIIRADIPFRRAESKYSIEQVG
PSBB_TRICV        AWLGHPIFRDKDGRE-LTVRRMPAFFETFPVILVDK-DGIIRADIPFRRAESKYSIEQVG
PSBB_CYACA        AWLGHPVFQDKEGHE-LIVRRMPAFFENFPIILVDK-DGIIRADIPFRRAESKYSIEQVG
PSBB_CYAPA        SWLGHATFKDKEGRE-LTVRRMPTFFETFPVVLIDK-DGVLRADIPFRRAESKYSIEQMG
PSBB_CHLRE        GWLGHASFKDQEGRE-LFVRRMPTFFETFPVLLLDK-DGIVRADVPFRKAESKYSIEQVG
PSBB_CHLVU        GWLGHAVFKEKQGNE-LFVRRMPTFFETFPVVLVDK-DGVVRADVPFRRSESKYSIEQVG
PSBB_NEPOL        GWLGHPVFTDKAGNE-LFVRRMPTFFETFPVLLVDK-DGVVRADVPFRRAESKYSIEQVG
PSBB_OSTTA        GWLGHATFTDKNGRE-LFVRRMPTFFETFPVILIDG-DGVVRADVPFRRAESKYSIEQVG
PSBB_CHLAT        GWLGHAVFKDKEGRE-LFVRRMPTFFETFPVLLLDK-DGVVKADVPFRRAESKYSVEQVG
PSBB_BIGNA        GWLGHPIFKDKLGNE-LFVRRMPTFFETFPVLLVDE-NGIVKADIPFRRAESKYSIEQVG
PSBB_CICAR        GWLGHPIFRDKEGRE-LFVRRMPTFFETFPVVLVDG-DGIVRADVPFRRAESKYSVEQVG
PSBB_PINKO        GWLGHPIFKDKEGNE-LFVRRMPTFFETFPVVLVDK-EGIVKADVPFRRAESKYSVEQVG
PSBB_PHYPA        GWLGHAVFKDREGHE-LFVRRMPTFFETFPVVLVDE-EGIVRADVPFRRAESKYSVEQVG
C7B2H2_SELML      GRLGHATPRDKEGHE-PFVRRMPTLLETSPVVLVDE-EGIARADVPSRRAESKYSAEQVG
PSBB_EUGGR        AWLGHAVFIDKEGNS-LFVRRMPTFFETFPVILLDQ-NGVVRADIPFRRAESKYSIEQVG
G1E7A1_KARVE      SWVGHVIFEDYDGNE-LIVRRIPTFYETFPLMLTDKITGDYRVDIPFRRAESKYSVEQVE
D9IXH8_9ALVE      TWLGHPIFYDGNTNEILTVRRMPTFFETFPVTLTDR-YGVLRVDIPFRRAESKFSIEQQG
Q2I6P8_LINPO      NWLGHASFE--MGTLSLTVRRMPAFFETFPVILIDQ-GGSVRADIPFRRAESRYSIEQTS
Q9XQV0_HETTR      NWLGHANFE--MGTLSLAVRRMPAFFETFPVILIDQ-GGSLRADIPFRRAESRYSIEQSN
Q1HCK7_AMPCA      NWVGQPDFQ--IGSIKLQVRRAPSFFETFPVLLVDK-GGSLRADIAFRRSSSRYSIEQTG
                     *:             * :   : *. *: : *   .  :.*:. :::.:: * *:  

PSBB_PROHO        VTVSFYGGALDGQTFTNPSDVKKFARRAQLGEAFDF--DTE---TLGSDGVFRTSTRGWF
B0CFM2_ACAM1      VSVSFEGGTLNGQTFTDAPSVKKYARKAQLGEPFEF--DRE---TLGSDGVFRTSTRGWF
Q46H52_PROMT      VTATVYGGELNGQTFTDPVIVKRLARKSQLGEAFKF--DRD---RYKSDGVFRSSPRAWF
A9BDX1_PROM4      ITATVYGGELSGQTFSDPVVVKRLARKAQLGESFKF--DRD---RYKSDGVFRSGPRAWF
A8G2X6_PROM2      ITATIYGGDLNGQTFTDPAVVKRLARKAQLGEAFKF--DRE---TYKSDGVFRSSPRAWF
Q7NCI0_GLOVI      VTVSFVGGKLNGQSFEDPAQVKSYAKRAQLGELIEF--DTK-----DADGVFRTSTRGWF
U5QI51_9CYAN      VTVSFVGGKLDGQSFEDPAQVKKYAKAAQFGELIEF--DRNLPGGTEADGVFRTSTRGWF
PSBB_THEVL        VTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEF--DTE---TLNSDGIFRTSPRGWF
PSBB_THEEB        VTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEF--DTE---TLNSDGIFRTSPRGWF
PSBB_NOSS1        VTVSFYGGDLDGKTFTDPADVKKYARKAQGGEIFEF--DRE---TLNSDGVFRTSPRGWF
PSBB_SYNY3        VTVSFYGGALDGQTFSNPSDVKKFARKAQLGEGFDF--DTE---TFNSDGVFRTSPRGWF
PSBB_SYNE7        ITASFYGGSLNGQTITDPAQVKKYARKAQLGEAFEF--DTE---TLNSDGVFRTSPRGWF
PSBB_GUITH        VTVSFYGGKLNGQTYTDAPTVKKYARKAQLGEVLEF--DRT---TLESDGVFRSSPRGWY
PSBB_PORPU        VTASFYGGKLNGQVFNDAPSVKKYARKAQLGEVFEF--DRT---TLESDGVFRSSPRGWF
PSBB_TRICV        VTVDFYGGKLNGQTFKDAPTVKKFARKAQLGEVFEF--DRT---SLESDGVFRSSPRGWY
PSBB_CYACA        VTCSFYGGKLNNQSFKDASTVKKYARKAQFGEVFEF--DRT---ILDSDGVFRSSPRGWF
PSBB_CYAPA        VTVSFYGGKLDGQTFTDAPTVKKYARKAQLGEAFEF--DRE---TLKSDGVFRSSARGWF
PSBB_CHLRE        VSVTFYGGELDGLTFTDPATVKKYARKAQLGEIFEF--DRS---TLQSDGVFRSSPRGWF
PSBB_CHLVU        VSVTFYGGELDGVTFNDPATVKKYARRAQLGEIFEF--DRA---TLQSDGVFRASPRGWF
PSBB_NEPOL        VSVTFYGGELDGVTFNDPSTVKKYARRAQLGSVFEF--DRA---TLQSDGVFRSSPRGWF
PSBB_OSTTA        VNVTFYGGELDGLTFTDPATVKKYARRAQLGEVFEF--DRA---TLQSDGVFRSSPRAWF
PSBB_CHLAT        VTVTFYGGELDGVTFKDPATVKKYARRAQLGEVFEF--DRA---RLKSDGVFRSSPRGWF
PSBB_BIGNA        VSATFYGGELNNATFTDPATVKKYARRAQLGEIFEF--DRT---TLKSDGVFRSSPRAWF
PSBB_CICAR        VTVEFYGGELNGVSYSDPATVKKYARRAQLGEIFEL--DRA---TLKSDGVFRSSPRGWF
PSBB_PINKO        VTVEFYGGGLDRVSFGDPAIVKKYARRAQLGEIFEL--DRA---TLKSDGVFRSSPRGWF
PSBB_PHYPA        VTVEFYGGELNGVSFSDPATVKKYARRAQLGEIFEF--DRA---TLKSDGVFRSSPRGWF
C7B2H2_SELML      VTAEFCGGELDGVSFSDPATVKKHARRAQLGEIPES--DRA---TSKPDGVPRSSPRGWS
PSBB_EUGGR        VTVRFFGGSFDTLSFNDPATVKRYARHAQLGEIFDF--NRS---ILQSDGVFRSSPRGWF
G1E7A1_KARVE      LTCKIYGGKLNGQKFTDSSTVKKYIRRAQLGEIFEFRDDRK-HPTWKRDGLFRVSNRGWF
D9IXH8_9ALVE      TVCKYFGGLKDGQELYAVAAVKAAARKAVLGEQFDF--DRQ---QFNSDGVFRASPRTWY
Q2I6P8_LINPO      VVLYFQGGILSGVEYSTPSLVKSYARKSQFGEIFTF--DKK---TGQTDGVFRTSPRCWY
Q9XQV0_HETTR      VVLYFSGGTLNGIELSAPSLVKGYARKAQFGEIFTF--DKK---TGGADGVFRTSPRGWY
Q1HCK7_AMPCA      VTCTINGGAYGGSELNTAPIVKNYARKSQFGSIFSF--DRK---TLRSDGVFRTSIRGWY
                        **  .         **   : :  *.      :         **: * . * * 

PSBB_PROHO        TFGHACFALLFFFGHIWHGARTLFRDVFAGI-DADL-GEQIEFGAFQKLGDLTTRKS---
B0CFM2_ACAM1      AFSHSCYALLFFFGHWWHGARTIFKDVFEGV-DPNLPEEQVEWGVFQKVGDTTTRA----
Q46H52_PROMT      TYAHLCFGLLFLFGHWWHAARTLFGDRFSGI-DPE-LGDQVEFGLFKKLGDESTRRVPGR
A9BDX1_PROM4      TYAHACFGLLYLFGHWWHAARTLYRDTFAGI-DPD-LGDQVEFGLFKKLGDESTRRVPGR
A8G2X6_PROM2      TYAHLCFGLLFLFGHWWHASRTLYKGRFAGI-DAD-IGDQVEFGLFKKLGDETTRRIPGR
Q7NCI0_GLOVI      VLAHGIFALLFFFGHIWHGARTLFLDVFTGV-DPTRQEEEFEYGVFKKLGDPTTRRDETE
U5QI51_9CYAN      VLAHGIFALLFFFGHIWHGARTLFLDVFTGV-DPTRQEEEFEYGVFKKLGDATTRREEVA
PSBB_THEVL        TFAHAVFALLFFFGHIWHGARTLFRDVFSGI-DPELSPEQVEWGFYQKVGDVTTR-K---
PSBB_THEEB        TFAHAVFALLFFFGHIWHGARTLFRDVFSGI-DPELSPEQVEWGFYQKVGDVTTR-RKEA
PSBB_NOSS1        TFGHAVFALLFFFGHLWHGARTIYRDVFAGV-EADLE-EQVEWGLFQKVGDKSTRVRKEA
PSBB_SYNY3        TFGHAVFALLFFFGHIWHGSRTLFRDVFAGV-DPGLE-EQVEFGVFAKVGDLST--RKEA
PSBB_SYNE7        TFGHASFALLFFFGHIWHGSRTLFRDVFAGI-EADLG-EQIEFGAFQKLGDPTT--RKTA
PSBB_GUITH        TFGHANFALLFFLGHLWHGSRTLFRDVFSGI-GAEVT-EQVEFGAFQKLGDRSTK-KQGA
PSBB_PORPU        TFGHANFALIFFFGHLWHGSRTIFRDVFAGI-GAEVT-EQVEFGAFQKLGDRSSK-KQGA
PSBB_TRICV        TFGHANFALLFFFGHLWHGGRTIFRDVFTGI-GAEVT-EQVEFGAFQKLGDKSTK-KQGA
PSBB_CYACA        TFGHANFALLFFFGHLWHGSRTLFRDVFAGI-GAEVT-EQVEFGVFQKVGDKTTK-KQGY
PSBB_CYAPA        TFGHASFALIFFFGHLWHGGRTLFRDVFAGI-GEEVT-EQVEFGAFQKVGDKTTR-KQEA
PSBB_CHLRE        TFGHVCFALLFFFGHIWHGARTIFRDVFAGI-DDDIN-DQVEFGKYKKLGDTSSL-REAF
PSBB_CHLVU        TFAHLCFALLFFFGHIWHGARTIFRDVFAGI-DADLD-EQVEFGAFLKLGDTSTR-RQSV
PSBB_NEPOL        TFGHLWFALLFFFGHIWHGARTIFRDVFGGI-DPDLD-DQVEFGAFQKLGDVTTR-RQAV
PSBB_OSTTA        TFAHVSFALLFFFGHIWHGARTIFRDVFAGI-DPDLD-EQVEFGAFQKLGDVTTR-RQAV
PSBB_CHLAT        TFGHLCFALLFFFGHIWHGARTIFRDVFAGI-DPDLD-EQVEFGAYQKLGDPSTR-KQAV
PSBB_BIGNA        TFGHLIFALLFFFGHIWHGARTLFRQVFAGI-DPDLD-EQIEFGTFLKLGDTSTR-RQSV
PSBB_CICAR        TFGHVSFALLFFFGHIWHGARTLFRDVFAGI-DPDLD-AQVEFGAFQKLGDPSTK-KPVV
PSBB_PINKO        TFGHATFALLFFSGHIWHGARTLFRDVFAGI-DPDLD-SRIEFGAFQKLGDPTTK-RQVV
PSBB_PHYPA        TFGHATFALLFFFGHIWHGARTLFRDVFAGI-DPDLD-AQVEFGAFQKLGDPTTK-RQII
C7B2H2_SELML      TFGHATFALLSSSGHIRHGARTPFRDVLAGT-DPDPD-AQAELGTSQKSGDPTTK-RQAV
PSBB_EUGGR        TFGHLSFALIFFFGHIWHGARTLFKYLLAGI-DPHLE-EEIEFGTFEKLGDDTTK-KELV
G1E7A1_KARVE      TFFHLVFSLLFFFGHLWHGGRTLFNDIFWGIGKPEETIEKVEFGQFKKLGDETTKKSGTI
D9IXH8_9ALVE      AFGHAIFAFFFFFGHLWHAGRTLFEELLTGV-DSEVF-DFVKFGGMSKVGGKFVYRRAPM
Q2I6P8_LINPO      SFSHVTLAFIFFFGHLWHAGRALFRDIWTGV--SIISLYQVEYGRNEKLGEDVNNASALI
Q9XQV0_HETTR      SFGHVCFSFLFFFGHLWHGGRALFRDIWTGV--TIENALKVEYGLNEKLGDGATKTTAFL
Q1HCK7_AMPCA      TFSHVSLALFFFLGHLWHAARAFFKEIWTGV--SFNKVEVIEYGYNEKLGDEGTATRSFR
                     *   .::   **  *..*: :     *                              

PSBB_PROHO        -----------
B0CFM2_ACAM1      -----------
Q46H52_PROMT      A----------
A9BDX1_PROM4      A----------
A8G2X6_PROM2      V----------
Q7NCI0_GLOVI      AA---------
U5QI51_9CYAN      -----------
PSBB_THEVL        -----------
PSBB_THEEB        V----------
PSBB_NOSS1        -----------
PSBB_SYNY3        -----------
PSBB_SYNE7        A----------
PSBB_GUITH        V----------
PSBB_PORPU        V----------
PSBB_TRICV        V----------
PSBB_CYACA        V----------
PSBB_CYAPA        G----------
PSBB_CHLRE        -----------
PSBB_CHLVU        -----------
PSBB_NEPOL        -----------
PSBB_OSTTA        -----------
PSBB_CHLAT        -----------
PSBB_BIGNA        -----------
PSBB_CICAR        S----------
PSBB_PINKO        -----------
PSBB_PHYPA        TRLI-------
C7B2H2_SELML      -----------
PSBB_EUGGR        -----------
G1E7A1_KARVE      -----------
D9IXH8_9ALVE      TITNYILNNNY
Q2I6P8_LINPO      -----------
Q9XQV0_HETTR      -----------
Q1HCK7_AMPCA      -----------