CLUSTAL format seed alignment for MF_01496

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PSBC_GUITH        ------------------------------------------------------------
PSBC_PYRYE        ----------------------------------------------------MTKVFALG
PSBC_TRICV        ------------------------------------------------------------
PSBC_GALSU        ------------------------------------------------------------
PSBC_CYACA        ------------------------------------------------------------
PSBC_ARATH        ------------------------------------------------------------
PSBC_CITSI        ------------------------------------------------------------
Q2WGC8_SELUN      ------------------------------------------------------------
PSBC_CHAGL        ------------------------------------------------------------
PSBC_OEDCA        ------------------------------------------------------------
PSBC_BIGNA        -----------------------------------------------------MKVLELG
PSBC_MESVI        ------------------------------------------------------------
PSBC_OSTTA        ------------------------------------------------------------
PSBC_EUGGR        ------------------------------------------------------------
PSBC_CYAPA        ------------------------------------------------------------
PSBC_THEVL        ------------------------------------------------------------
PSBC_THEEB        ------------------------------------------------------------
B8HRV4_CYAP4      ------------------------------------------------------------
A2C3V5_PROM1      ------------------------------------------------------------
Q1PKP4_PROMR      ------------------------------------------------------------
A9BBF3_PROM4      ------------------------------------------------------------
Q7V6H9_PROMM      ------------------------------------------------------------
Q0IBR3_SYNS3      -----------------------------------------------------MKVCVPG
PSBC_PROHO        ------------------------------------------------------------
PSBC_SYNY3        ------------------------------------------------------------
Q118V6_TRIEI      ------------------------------------------------------------
B1XNM5_SYNP2      ------------------------------------------------------------
L8M3N9_9CYAN      ------------------------------------------------------------
K9YEM1_HALP7      ------------------------------------------------------------
K9TJB4_9CYAN      ------------------------------------------------------------
PSBC_SYNE7        ------------------------------------------------------------
Q7NI60_GLOVI      ------------------------------------------------------------
G1E7A3_KARVE      MLSKCKEFFRKRMPIILEYKEVLIKGILENKEVLIKGATMIALFLWQDHAGCMTIIQMAA
C6G428_HETTR      ------------------------------------------------------------
Q8WIE5_AMPOP      ------------------------------------------------------------
                                                                              

PSBC_GUITH        -------MKTLYSLRRFYHVETPFNSNV---GIAGRDIESTGFAWWSGNSRLINVSGKLL
PSBC_PYRYE        WLLKINLMKTLYSLRRFYHVETPFNTTV---GVGGRDIESTGFAWWSGNARLINVSGKLL
PSBC_TRICV        -------MKTLYSLRRYYHVETPFNSS-----IAGRDIESTGFAWWSGNARLINVSGKLL
PSBC_GALSU        -------MKILYSQRRFYHVEMPFNNRI---EFAGRSIESTGYAWWAGNARLINVSGKLL
PSBC_CYACA        ---------MLFN-----------KDKN---NIGGRSIESTGFAWWSGNARLINLSGKLL
PSBC_ARATH        -------MKTLYSLRRFYHVETLFNGT---LALAGRDQETTGFAWWAGNARLINLSGKLL
PSBC_CITSI        -------MKTLYSLRRFYPVETLFNGT---LAVAGRDQETTGFAWWAGNARLINLSGKLL
Q2WGC8_SELUN      -------MKTPYSPRRFCPVETLFDGT---LALGGRDQETTGSAWWAGNARLINLSGKSL
PSBC_CHAGL        -------MKTLYSPRRYYPVETLFNGT---LSVGGRDQETTGFAWWAGNARLINLSGKLL
PSBC_OEDCA        -------------------METLYNGT---LTLGGKDQESTGFAWWAGNARLINLSGRLL
PSBC_BIGNA        WLHKINRTRRLYSLRRYYHVETLFNGT---LVTGGRDQETTGFAWWSGNARLINLSGKLL
PSBC_MESVI        -------MKTLYSLRRFYHVETLFNGT---LSISGRDQESTGFAWWSGNARLINLSGKLL
PSBC_OSTTA        -------MKTLYSLRRYFHVETLFNST---LVVGGRDQESTGFAWWAGNARLINLSGKLL
PSBC_EUGGR        -------------------METLFNKK---LTVGGRDQESTGFAWWAGNARLINVSGKLL
PSBC_CYAPA        -------------------METLFNSS---VAVSGRDQQSTGFAWWSGNARLINLSGKLL
PSBC_THEVL        --------------------------------ATNRDQESSGFAWWAGNARLINLSGKLL
PSBC_THEEB        -------------------MVTLSSNS---IFATNRDQESSGFAWWAGNARLINLSGKLL
B8HRV4_CYAP4      -------MKTLSSPKRYFPVVTLSSSS---IMAGNRDQESSGFAWWAGNARLINLSGKLL
A2C3V5_PROM1      -------------------METPFNS---LLNAPNQSLEETGYAWYVGNARLINLSGRLL
Q1PKP4_PROMR      ----------MYSLRRFFHVETPFNN---LLRAPNQSIEETGYAWYVGNARLINLSGRLL
A9BBF3_PROM4      -------------------METPFNN---LLKAPNQSIEETGYAWYVGNARLINLSGRLL
Q7V6H9_PROMM      -------------------METPFKSGSILQNAGGYSLESTGYAWWAGNARFINLSGRLL
Q0IBR3_SYNS3      WHRLTSRTKTSSSLKRFCPVETPFNSG--LIATGGKDLDSTGFAWWSGNARLINLSGRLL
PSBC_PROHO        -------------------MVTLSDR------FVGSDLKTSGYPWWAGNARLINLSGKLL
PSBC_SYNY3        -------------------MVTLSNT----SMVGGRDLPSTGFAWWSGNARLINLSGKLL
Q118V6_TRIEI      -------------------MVTLSN-----SIIGGRDQQSTGFAWWSGNARLINLSGKLL
B1XNM5_SYNP2      ----------MYSLRRYYPVVTLSNA----PISGGRDIESTGFAWWAGNARLINLSGKLL
L8M3N9_9CYAN      -------------------MVTLSSP----SFGGGRDQESTGFAWWAGNARLINLSGKLL
K9YEM1_HALP7      -------------------MVTLSNT----FVGAGRDQESSGYAWWSGNARLINLSGKLL
K9TJB4_9CYAN      ------------------MQTAFNSS----MVMGGRDQETSGFAWWAGNARLINLSGKLL
PSBC_SYNE7        -------------------MVTLSSPS---VIAGGRDIDSTGYAWWSGNARLINLSGKLL
Q7NI60_GLOVI      -------------------METRFDQS---FDAQNIRVRQEDYAWWAGNARLINLSGKLL
G1E7A3_KARVE      RKNLDNPALDKSNILFFESDKELDQALSKAFANLSKNIKSTGFAWWSGNARIINNSGKLL
C6G428_HETTR      ---------------------MRVSCL------KKRTLIGSRYSWWSGNARFIELSGKFL
Q8WIE5_AMPOP      ---------------------MVVNSV------LARTLQGSRYAWWSGNARFIELSGKFL
                                                             .*: **:*:*: **: *

PSBC_GUITH        GAHVAHAGLMVFWCGAMTLFEVAHYIPEKPLYEQGLILLPHLATLGWGVGPGG---EIID
PSBC_PYRYE        GAHVAHAGIMVFWTGAMTLFEVAHFVPEKPLYEQGFILIPHLATLGWGVGPGG---EIFN
PSBC_TRICV        GAHVAHAGLMVFWAGAMVLFEVSHFVPEKPTYEQGFILIQHLATLGYGIGPGG---EITS
PSBC_GALSU        GAHVAHAGLIVFWTGAMTLFEVAHFLPEKPLYEQGCILLPHLATLGWGVGPTG---EIID
PSBC_CYACA        GAHVAHAGLIVFWTGAMTLFETSHFIPEKPLYEQGMILLPHLATLGWGVAPGG---EIVN
PSBC_ARATH        GAHVAHAGLIVFWAGAMNLFEVAHFVPEKPMYEQGLILLPHLATLGWGVGPGG---EVID
PSBC_CITSI        GAHVAHAGLIVFWAGAMNLFEVAHFVPEKPMYEQGLILLPHLATLGWGVGPGG---EVID
Q2WGC8_SELUN      GAHVAHAGSIVFRAGAMNSFEVAHLIPEKPMHEQGLISLPHLATLGWGVGPGG---EAVD
PSBC_CHAGL        GAHVAHAGLIVFWAGAMNLFEVAHFVPEKPMYEQGLILLPHLASLGWGVGPGG---EVID
PSBC_OEDCA        GAHVAHAGLIVFWAGAMNLFEVAHFVPEKPMYEQGLILLPHLATLGYGVGPGG---EIID
PSBC_BIGNA        GAHVAHAGLIVFWAGAMNLFEVAHFIPEKPMYEQGLILLPHLATLGYGVGPGG---EVID
PSBC_MESVI        GAHVAHAGLIVFWAGAMNLFEVAHFTPEKPMYEQGLILLPHLATLGWGVGPGG---EVID
PSBC_OSTTA        GAHVAHAGLIVFWAGAMNLFEVAHFVPEKPMYEQGLILLPHLAALGYGVGPGG---EVLD
PSBC_EUGGR        GAHVAHAGLIVFWTGAMNLFEVAHFVPQKPMYEQGLILLPHLATLGFGVGFDG---IVLD
PSBC_CYAPA        GAHVAHAGLIVFWTGAMTLFEVAHFIPEKPMYEQGLILLPHLATLGWGVGPGG---EVID
PSBC_THEVL        GAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGG---EVVD
PSBC_THEEB        GAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGG---EVVD
B8HRV4_CYAP4      GAHVAHAGLIVFWAGAMTLFEVAHFTPEKPMYEQGLILIPHIATLGWGVGPGG---DVTD
A2C3V5_PROM1      GAHIAHAGLIVFWAGAMMLFEVSHFTMDKPMWEQGLICMPHVAMFGYGIGPGG---EVTD
Q1PKP4_PROMR      GAHIAHSGLIVFWAGAMMLFEVNHFTFDKPMWEQGLICMPHVAMFGYGIGPGG---EVTD
A9BBF3_PROM4      GAHIAHTGLMVFWAGAMMLYEVSHFTFDKPMWEQGLILLPHVAMFGYGIGPGG---EVVD
Q7V6H9_PROMM      GAHVAHAGLMTFWAGAMLLFEVSHFTFDKPIFEQGLILMPHVAALGYGVGTGG---EIVD
Q0IBR3_SYNS3      GAHVAHAGLMVFWAGAMILFEVSHFTFDKPMYEQGVICMPHVATLGYGVGPGG---EVTD
PSBC_PROHO        GAHVAHAGLIVFWAGAMTLFEVAHFTPEKPLYEQGDILLPHLASLGWGVGPGG---EITD
PSBC_SYNY3        GAHVAHAGLIVFWAGAMTLFEVAHFIPEKPMYEQGLILLPHIATLGWGVGPAG---EVTD
Q118V6_TRIEI      GAHVAHAGLIVFWAGAMTLFEVAHFVPEKPMYEQGLILMPHVATIGWGVGPGG---EIVD
B1XNM5_SYNP2      GAHVAHAGLIVFWTGAMTLFEVAHFVAEKPMHEQGFILMPHLATLGWGVGPGG---EVID
L8M3N9_9CYAN      GAHVAHAGLIVFWTGAMTIFEVAHYVPEKPMYEQGMILLPHLATLGWGVGPGG---EVIS
K9YEM1_HALP7      GAHVAHAGLIVFWAGAMTLFEVGHFVPEKPMYEQGLILLPHLATLGWGVGPGG---EVID
K9TJB4_9CYAN      GAHVAHAGLIVFWAGAMTLFEVGHFIPEKPMYEQGLILLPHLATLGWGVGPGG---EVID
PSBC_SYNE7        GAHVAHAGLIVFWAGAMTLFEVAHFVPEKPMYEQGIILLSHLATLGWGVGPGG---EVVD
Q7NI60_GLOVI      GAHVAHAGLIVFWTGAMTLFELAHFETAKPMYEQGLILLPHLATLGWGLGTGANGFQVVD
G1E7A3_KARVE      GAHVAHASLIIFWCGAMTLFEVSHFIPEKPLYEQGCILLPHLTTLGWGVEPGG---EIVN
C6G428_HETTR      GAHLAHAGLIMFWSGSMTLFELSHFAPEKPLYEQGFILLPHLATLAFGVGPGG---EITD
Q8WIE5_AMPOP      GAHVAHAGLIMFWAGAMCLFEVAHHVPDRALYDQGFILLPHLATLGFGVGAGG---EIIS
                  ***:**:. : *  *:*  :*  *    :.  :** * : *:: :.:*:   .      .

PSBC_GUITH        VYPYFVVGVLHLISSAVLGFGGVYHSLIGPDTLEE-S---FPAFGYDWRDKNKITTILGI
PSBC_PYRYE        TYPYFVVGVVHLISSAVLGFGGLYHSLIGPDTLEE-S---FPFFGYDWRDKNKMTTILGI
PSBC_TRICV        TVPYFAVGVIHLISSAVLGFGGIYHSLLGPDTLEE-S---FPFFGYDWRDKNKMTTILGI
PSBC_GALSU        TYPYFVIGVLHLVSSAVLGFGGLYHSLIGPEILEE-S---YPFFGYDWRDKNKMTTILGI
PSBC_CYACA        TYPYFATGVIHLVSSAVLGFGGIYHSIVGPDVLED-S---FSFFGYDWRDKNKMTTILGI
PSBC_ARATH        TFPYFVSGVLHLISSAVLGFGGIYHALLGPETLEE-S---FPFFGYVWKDRNKMTTILGI
PSBC_CITSI        TFPYFVSGVLHLISSAVLGFGGIYHALLGPETLEE-S---FPFFGYVWKDRNKMTTILGI
Q2WGC8_SELUN      VSPYLASGVLHSISPAVPGFGGTHHSPIGPDTPEE-S---FPLFGHARRDRNKMTTIPGI
PSBC_CHAGL        TFPYFVSGVLHVISSAVLGFGGVYHAIIGPETLEE-S---FPFFGYVWKDKNKMTTILGI
PSBC_OEDCA        TFPYFVSGVLHLISSAVLGFGGVYHSLIGPETLEE-T---FPFFGYVWKDKNKMTNILGA
PSBC_BIGNA        TFPYFVSGVVHLISSAVLGFGGIYHSILGPETLEE-S---FPFFGYVWKDKNKMTTILGI
PSBC_MESVI        TFPYFVSGVLHLISSAVLGFGGVYHSLIGPETLEE-S---FPFFGYVWKDKNKMTTILGI
PSBC_OSTTA        TFPYFVSGVLHLISSAVLGFGGVYHSLIGPETLEE-S---YPFFGYLWKDKNKMTTILGI
PSBC_EUGGR        TYPFFVCGVLHLISSAVLGFGGVFHSLAGPDTLEE-S---FRFFGYTWKRKKKLAAILGI
PSBC_CYAPA        VYPYFVVGVLHLVSSAVLGFGGLYHAIIGPEVLEE-S---FPFFGYDWKDKNKMTTIIGI
PSBC_THEVL        TFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEE-Y---SSFFGYDWKDKNKMTTILGF
PSBC_THEEB        TFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEE-Y---SSFFGYDWKDKNKMTTILGF
B8HRV4_CYAP4      IFPFFVVGVVHLISSAVLGLGGIYHAIRGPETLEE-Y---SSFFGYDWKDKNKMTTILGF
A2C3V5_PROM1      VWPFFIAGVIHLVASGILGFGGVFHSLAGPEKLEE-D---FPFFSTDWRDKNQMTNILGF
Q1PKP4_PROMR      IMPFFQAGVVHLIASAVLGFGGIYHSLAGPEKLEE-D---FPFFSTDWRDKNQMTNILGY
A9BBF3_PROM4      VMPYFQAGVVHLVASAILGFGGIYHALAGPEKLEE-E---FPFFSTDWRDKDQMTTILGR
Q7V6H9_PROMM      IYPFFHCGVMHLIISAVFGLGGVYHSLAGPEKLQDYS---SPFFRLDWKDKNQMTNILGY
Q0IBR3_SYNS3      LFPFFVVGVLHLISSAVLGLGGLYHALRGPEILEN-Y---STFFSQDWRDKNQMTNIIGY
PSBC_PROHO        ITPYFIVGVLHLISSAVLGLGGVYHTLRGPETLEQ-Y---SDFFSQDWKDKNQMTNILGF
PSBC_SYNY3        IFPFFVVGVLHLISSAVLGLGGIYHALRGPEVLEE-Y---SSFFGYDWKDKNQMTNIIGY
Q118V6_TRIEI      IFPFFVVGVLHLISSAVLGLGGIYHAVRGPETLED-Y---SSFFGYDWKDKNQMTNIIGY
B1XNM5_SYNP2      TFPYFVVGVLHLISSAVLGLGGIYHAVRGPETLEE-Y---SSFFGYDWKDKNQMTNIIGY
L8M3N9_9CYAN      TYPYFVVGVLHLISSAVLGLGGIYHALRGPETLED-Y---SDFFSQDWKDKNQMTNIIGY
K9YEM1_HALP7      TFPYFVVGVLHLISSAVLGLGGIYHAVRGPETLEE-Y---SSFFGYDWKDKNKMTSIIGF
K9TJB4_9CYAN      TFPYFVVGVLHLISSAVLGLGGIYHAVRGPETLEE-Y---SSFFGYDWRDKNKMTTILGF
PSBC_SYNE7        TFPYFVVGVLHLISSAVLGLGGIYHALRGPESLEE-Y---STFFSQDWKDKNQMTNIIGY
Q7NI60_GLOVI      TWPYFVVGVLHLISSAVLGFGGIYHSIWGPDILSG-------FFGYDWKDKNKMTTILGI
G1E7A3_KARVE      LYSFFITGVLHLISSSMLSFGGIYHSLKGPIFLET-N---WPFFGYDWRDKSKMTSILGS
C6G428_HETTR      TYSYFVCGVLHLISSGVLALGGIYHSIFGPERLEETT--YGFLFGYQWQDRFRMTAILGA
Q8WIE5_AMPOP      LHEYFVIGVLHMMAALVLGLGGIYHAVFGPEKLEESASANSTLFAFNFKDRFRVTCILGA
                     ::  **:* : . : .:** .*:  **   .         *    : : ::: * * 

PSBC_GUITH        HLVILGFGALLLVIKAIYVGGLYDTWAPGGGD-----VRIIDN--PTLNPAVIFGYVLKS
PSBC_PYRYE        HLVLLGIGAFLLVIKALFIGGVYDTWAPGGGD-----VRFVSN--PTLNPLVIFGYVLKS
PSBC_TRICV        HLCLLGVGSFLLVIKAMYLGGVYDTWAPGGGD-----VRLITT--PTLNPIVIFGYVFRS
PSBC_GALSU        HLILLGIGAFLLVIKAMFFGGVYDTWAPGGGD-----VRYINN--PTLNPLVIFGYLLKS
PSBC_CYACA        HLILLGIGAFLLVIKALFIGGIYDTWAPGGGD-----IRFITN--PTLNPAIIFSYLLKS
PSBC_ARATH        HLILLGVGAFLLVFKALYFGGVYDTWAPGGGD-----VRKITN--LTLSPSVIFGYLLKS
PSBC_CITSI        HLILLGIGAFLLVFKALYFGGVYDTWAPGGGEM----LRKITN--LTLSPSVIFGYLLKS
Q2WGC8_SELUN      HPILLGIGALLSVSKAPYSGGAYDTWAPGGGD-----VREITN--LTAGPGVIFGHSPKS
PSBC_CHAGL        HLVLLGFGALLLVAKAVWFGGVYDTWAPGGGD-----VRVITN--PTYDPSIIFGYLLKS
PSBC_OEDCA        HLIILGIGAWLLVWKALYFGGVYDTWAPGGGD-----VRIITN--PTTNPSVIFGYLLKS
PSBC_BIGNA        HLILLGLGSWLLVLKASYFGGVYDTWAPGGGD-----VRLITD--ATISPATIFGYLLKS
PSBC_MESVI        HLIVLGVGAYLLVWKACYFGGVYDTWAPGGGD-----VRIITD--PTLSPAVIFGYLLKS
PSBC_OSTTA        HLVLLGIGAWLLVWKAMYFGGVYDTWAPGGGD-----VRVISY--PTYDPSVIFGYLLKS
PSBC_EUGGR        HLCFLGLGALLLAWKAMYGGGVYDTWWPGGGD-----VRSITN--PTLNPFIIFGYLVKS
PSBC_CYAPA        HLILLGSGALLLVLKAMFFGGVYDTWAPGGGD-----VRVISN--PTLNPTVIFSYITKS
PSBC_THEVL        HLIVLGIGALLLVAKAMFFGGLYDTWAPGGGD-----VRVITN--PTLDPRVIFGYLLKS
PSBC_THEEB        HLIVLGIGALLLVAKAMFFGGLYDTWAPGGGD-----VRVITN--PTLDPRVIFGYLLKS
B8HRV4_CYAP4      HLIVLGLGALLLVAKAMFFGGLYDTWAPGGGD-----VRLITN--PTLNPATIFGYLTRS
A2C3V5_PROM1      HLVVLGVGALLWSINWMYIGGAYDTWAPGGGE-----VRLIN---PTLDPRIIFGYLLST
Q1PKP4_PROMR      HLIVLGVGALAWSVNWCFIGGAYDTWAPGGGE-----VRLVN---PTLDPRVILGYLFRS
A9BBF3_PROM4      HLCVLGLGAIAFAANWQFLGGLYDTWAPGGGE-----VRLIT---PTTDPGIIFGYLFQT
Q7V6H9_PROMM      NLIFLGWGALALILKACFFGGIYDTWAPGGGD-----VRLITS--PTLDPGVIFGYVFSS
Q0IBR3_SYNS3      HLILLGVGCLLLVFKAMFFGGVYDTWAPGGGD-----VRLITN--PTLDPGVIFGYLFRA
PSBC_PROHO        HLIVLGIGASLFVFKAMFFGGLYDPWVPGGGG-----VRVITN--PTLSPSVLFGYLFRS
PSBC_SYNY3        HLILLGCGALLLVFKAMFFGGVYDTWAPGGGD-----VRVITN--PTLNPAIIFGYLLKA
Q118V6_TRIEI      HLIILGLGAFLLVIKAVFLGGVYDTWAPGGGD-----VRVITN--PTLNPAVIFGYLLKA
B1XNM5_SYNP2      HLILLGCGALLLVFKAMFFGGVYDTWAPGGGD-----VRIISN--PTLNPAVIFGYLFKA
L8M3N9_9CYAN      HLILLGCGAFLLVFKAMFFGGVYDTWAPGGGD-----VRIITN--PTLDPGVIWGYLTKA
K9YEM1_HALP7      HLIILGIGALLLVFKAVFFGGVYDTWAPGGGD-----VRVINN--PTLNPAAIFGYLLSS
K9TJB4_9CYAN      HLIVLGLGALLLVLKAMFFGGVYDTWAPGGGD-----VRVITN--PTLNPAVIFGYLAKS
PSBC_SYNE7        HLILLGLGAFLLVFKAMFFGGVYDTWAPGGGD-----VRIISN--PTLNPAVIFGYLLKS
Q7NI60_GLOVI      HLILLGIGCFLLVAKACWFGGIYDPWFFDNNNQWAGQVRTVTN--PTLDPTVIFGYVLKS
G1E7A3_KARVE      HLIVLGLGCGLLIFKGCTIGGVYDTWGPGGGD-----VRIVMS--PTINPNVIFGYVLKS
C6G428_HETTR      HLGTIGLASTLLFVKAVYLGGLYDTWASGGGD-----VRIIKDSSLTLNPYILGRYLVRA
Q8WIE5_AMPOP      HLVALGIAS-LLVVYLGLTNGLYDAFAPGGGD-----VRVVKQ--VTTSAYVIGSYLIKA
                  :   :* ..          .* **.:  ...      :* :     * ..  :  :   :

PSBC_GUITH        PWGGDGWIVSVNNMEDVVGGHIWIGFTCIAGGFWHILTKPFAWARRAYVWSGEAYLSYSL
PSBC_PYRYE        PFGGDGWIVSVNNMEDLVGGHVWIGIICIAGGIWHILTKPFAWARRAFVWSGEAYLSYSL
PSBC_TRICV        PFGGDGWVVSVNNMEDIIGGHIWVGLLCIIGGIWHIFTKPFAWARRAFVWSGEAYLSYSL
PSBC_GALSU        PFGGDGWIISVNNMEDLIGGHIWIGLICIGGGIWHILTKPFGWARRAFVWSGEAYLSYSL
PSBC_CYACA        PFGGEGWIVGVNNMEDVIGGHIWIGVTCVIGGIWHILTRPFSWARRAFVWSGEAYLSYSL
PSBC_ARATH        PFGGEGWIVSVDDLEDIIGGHVWLGSICIFGGIWHILTKPFAWARRALVWSGEAYLSYSL
PSBC_CITSI        FFGGEGWIVSVDDLEDIIGGHVWLGSICIFGGIWHILTKPFAWARRALVWSGEAYLSYSL
Q2WGC8_SELUN      PFGGEGWIVSADNSEDATGGHLRLGSIRILGGISHILTKPFAWARRASVRSGEAYSPYSL
PSBC_CHAGL        PFGGEGWITSVDNMEDIIGGHIWIGFICIFGGIWHIVTKPFAWARRAFVWSGEAYLSYSL
PSBC_OEDCA        PFGGDGWIVSVDNMEDIIGGHIYIGTINILGGLWHVFTQPWAWTRRAFVWSGEAYLSYSL
PSBC_BIGNA        PFGGDGWIVSVDNMEDIIGGHIWIGTLEIFGGIWHITTKPWPWARRAFVWSGEAYLSYSL
PSBC_MESVI        PFGGEGWICSVDNMEDVIGGHIWIGNLLIFGGIWHILTKPWAWARRAFVWSGEAYLSYSL
PSBC_OSTTA        PFGGDGWIISVDNMEDVIGGHIWIGTTLIIGGFFHIFTKPFAWARRAFVWSGEAYLSYSL
PSBC_EUGGR        PFGGEGWIVSVDSMEYVIGGHIWIGILLVSGGFWHICSRPSPWVVRTFVWSGEAYLSYSL
PSBC_CYAPA        PWGGDGWIVSVDNMEDIIGGHIWLAFICIIGGVWHILTKPFSWARRALVWSGEAYLSYSL
PSBC_THEVL        PFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSL
PSBC_THEEB        PFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSL
B8HRV4_CYAP4      PFGGDGWIVGVNNLEDVVGGHIWVGLICIAGGIWHILTKPFGWARRAFVWSGEAYLSYSL
A2C3V5_PROM1      PWGGGGWMVGVNSMEDIVGGHVYLGVIEIIGGLFHIFTQPYGWARRAFIWNGEGLLSYAL
Q1PKP4_PROMR      PWGGAGSIIGVNSIEDIVGGHVYVGITAIIGGIFHIFTKPFGWARRAFIWNGEGLLSYAL
A9BBF3_PROM4      PWGGGGNMVGVNSVEDIVGGHYYLGIIELIGGHFHMQTKPFGWARRAFIWNGEALLSYAL
Q7V6H9_PROMM      PWGGTGWITGVNSMEDLIGGHIYVAALLFVGGHFHIATKPWGWVRRAFIWNGEAYLSYAL
Q0IBR3_SYNS3      PFGGEGWIIGVNSMEDIIGGHIWLGLTCIFGGIWHVVTKPFGWVRRAFIWNGEAYLSYSL
PSBC_PROHO        PFGGEGWLIGVNNMEDVVGGHIWVALHCFIGGAWHLITRPFNWARRSLVWSGEAYLSYSL
PSBC_SYNY3        PFGGEGWIISVNNMEDIIGGHIWIGLICISGGIWHILTKPFGWARRALIWSGEAYLSYSL
Q118V6_TRIEI      PFGGEGWIIGVNNMEDIIGGHIWIGLICISGGIWHILTKPFGWARRAFIWSGEAYLSYSL
B1XNM5_SYNP2      PFGGEGWMIGVNNMEDIIGGHIYVGLICIFGGIWHILTKPFGWARRALVWSGEAYLSYSL
L8M3N9_9CYAN      PFGGEGWIISVNNMEDIIGGHIWIGLICISGGVWHILTKPFGWARRALIWNGEAYLSYSI
K9YEM1_HALP7      PFGGDGWIIGVDNMEDIIGGHIWVGLICIAGGVWHILTKPFGWVRRAFVWSGEAYLSYSL
K9TJB4_9CYAN      PFGGEGWLMGVDNMEDIIGGHIWVGFTCIIGGVYHILTKPFGWVRRAFIWSGEAYLSYSL
PSBC_SYNE7        PFGGDGWIVSVDNLEDVIGGHIWIGLICISGGIWHILTKPFGWVRRAFIWNGEAYLSYSL
Q7NI60_GLOVI      PFGGDGWIISVDNLEDIIGGHIWIGAVCIAGGIWHIVTKPFGWAQRSFIWSGEAYLSYSL
G1E7A3_KARVE      PFGGDGWIISVDTLEDLIGGHIWVSFLCVFGGIWHIFTAPFTWVRRVFIWSGEAYLSYSL
C6G428_HETTR      PFGSEGWIISINNMEDLVGGHYWVGIYTLIGGVWHIQTRPFGVVVRGFTWSGEAYLAYSL
Q8WIE5_AMPOP      PFGGQGWIISINNLEDFLGGQLVVGFGCILGGIWHILSTPQPIFVRGFTYSGEAYLGYSL
                   :*. * : . :  *   **:  :.   . **  *: : *     *    .**.   *::

PSBC_GUITH        VAVSLMAFIASQYAWYNNTVYPSEFYGPTGPEASQSQAFTFLVRDQRLGASVSSAQGPTG
PSBC_PYRYE        GALSIMGLTASNFVWYNNTAYPSEFYGPTGPEASQAQAFTFLVRDQRLGANVASSQGPTG
PSBC_TRICV        AAISLMGFTAALYSWYNNTAYPSELYGPTGPEASQSQAFTFLVRDQRLGANVSSAQGPTG
PSBC_GALSU        AALSLMGFIACIYVWYNNTAYPSEFYGPTGPEASQAQAFTFLVRDQRLGENVASAQGPTG
PSBC_CYACA        GALALMGQTAAEYAWYNNTVYPSEFYGPTAAEASQAQAFTFLVRDQRLGANIASTQGPTG
PSBC_ARATH        AALSVCGFIACCFVWFNNTAYPSEFYGPTGPEASQAQAFTFLVRDQRLGANVGSAQGPTG
PSBC_CITSI        GALAVFGFIACCFVWFNNTAYPSEFYGPTGPEASQAQAFTFLVRDQRLGANVGSAQGPTG
Q2WGC8_SELUN      GALSVSGSTARCSVRSNNTVHPSESHGPTGPEASQAQASTFLARDQRPGANAGSAQGPTG
PSBC_CHAGL        GAISAMGFIACCFVWFNNTAYPSEFYGPTGPEASQAQAFTFLVRDQRLGANIGSAQGPTG
PSBC_OEDCA        AAISVMGFVACCMSWFNNTAYPSEFYGPTGPEASQSQAFTFLVRDQRLGANVASAQGPTG
PSBC_BIGNA        AAISLMGFIACCMSWFNNTAYPSEFYGPTGPEASQSQAFTFLVRDQRLGANVASAQGPTG
PSBC_MESVI        GAIATMGWIACCFSWFNNTAYPSEFYGPTGPEASQAQAFTFLVRDQRLGANIASSQGPTG
PSBC_OSTTA        ASVSLMAFIAAVFVWFNNTVYPSEFFGPTGPEASQAQAFTFLVRDQRLGANIASAQGPTG
PSBC_EUGGR        GAVATMGFIAVPMVWFNNTVYPSEFYGPTGPEASQAQAFTFLIRDQRLGTNIASAQGPTG
PSBC_CYAPA        AALALMGFIANCFVWFNNTAYPSEFFGPTGPEASQAQAFTFLVRDQRLGANVGSAQGPTG
PSBC_THEVL        GALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTG
PSBC_THEEB        GALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTG
B8HRV4_CYAP4      GALSLMAFIASAMVWFNNTVYPSEFYGPTNAESSQSQSFVFLMRDQKLGANVASTQGPTG
A2C3V5_PROM1      GGICVASFVASCFIWFNNTAYPSEFYGPTNAEASQAQSFTFLVRDQRIGANVGSTMGPTG
Q1PKP4_PROMR      GGICVASFIASTFIWFNNTAYPSEFYGPTNAEASQAQSFTFLVRDQRIGANVGSTMGPTG
A9BBF3_PROM4      GGLCVASFYASVFVWFNNTAYPSEFYGPTNAEASQAQSFTFLVRDQRIGANVGTTMGPTG
Q7V6H9_PROMM      AGLSCCGFIATAYIWFNVTAYPSEFYGPSNAEASQAQSFTFLVRDQRLGANIGTAMGPTG
Q0IBR3_SYNS3      GALSFMSFICSAFIWFNNTAYPSEFWGPTNAEASQAQSFTFLVRDQRMGANIGSAMGPTG
PSBC_PROHO        GALSLMGFIASMFVWFNNTVYPSEFYGPTGSEASQAQSFTFLIRDQRLGANIASAQGPTG
PSBC_SYNY3        GALSLMGFIASVFVWFNNTAYPSEFYGPTGMEASQSQAFTFLVRDQRLGANIASAQGPTG
Q118V6_TRIEI      GALSLMGLIAAAFVWFNNTAYPSEFYGPTNAEASQAQSFVFLVRDQKLGANIGSAQGPTG
B1XNM5_SYNP2      GALSLMAFIATCFVWFNNTAYPSEFYGPTNAEASQSQALIFLARDQSMGANVGSAQGPTG
L8M3N9_9CYAN      GAVSLMSFVASCYIWFNNTAYPSEFYGPTNAEASQAQAFTFLARDQRLGANIGSSQGPTG
K9YEM1_HALP7      GALSLMGFVASAMVWFNNTAYPSEFYGPTNAEASQAQAFLFLARDQRLGANIATSQGPTG
K9TJB4_9CYAN      GALSLMGFVAASFVWFNNTAYPSEFYGPTNAESSQAQAFTFLVRDQRLGASIGTAQGPTG
PSBC_SYNE7        GALSLMGFIASTMVWYNNTVYPSEFFGPTAAEASQSQAFTFLVRDQRLGANIGSAQGPTG
Q7NI60_GLOVI      GALSLMGFIASAYVWFNNTAYPSEFYGPTEMEASHAQNFVFMARDIKLGTDIGAAQGPTG
G1E7A3_KARVE      GALGVMGLVAAVYIWYNNTAYPSEFYGPSGPEASQSQAFTFLVRDQKLGAKIASAQGPTG
C6G428_HETTR      SALSLMGFIAAVYAWYNNTAYPSEFYGPTGPEASQAQGFTFLVRDQKLGIKVASSQGPTA
Q8WIE5_AMPOP      AALGTMGLIAAVYVWYNVTAYPSEVYGPSGMEASQSQAFTFLVRDQKLGAKIASAVGPTG
                   .:   .  .      * *.:***  **:  *:*::*   *: **   * . .:: ***.

PSBC_GUITH        LGKYLMRSPSGEIILGGETQRFWDLRAPWIEPLR---------------GPNGLDLNKIK
PSBC_PYRYE        LGKYLMRSPSGEIIFGGETMRFWDLRAPWVEPLR---------------GPNGLDLNKIK
PSBC_TRICV        LGKYLMRSPSGEIIFGGETMRFWDLRAPWVEPLR---------------GPNGLDINKIK
PSBC_GALSU        LGKYLMRSPSGEVIFGGETMRFWDLRAPWLEPLR---------------GPNGLDLNKIK
PSBC_CYACA        LGKYLMRSPTGEVILGGETMRFWDLRAPWLEPLR---------------SSNGLDLNKIK
PSBC_ARATH        LGKYLMRSPTGEVIFGGETMRFWDLRAPWLEPLR---------------GPNGLDLSRLK
PSBC_CITSI        LGKYLMRSPTGEVIFGGETMRFWDLRAPWLEPLR---------------GPNGLDLSRLK
Q2WGC8_SELUN      LGKYPMRSPTGEIIFGGETMRSWDPRAPWLEPLR---------------GPNGLDLSKLK
PSBC_CHAGL        LGKYLMRSPTGEIIFGGETMRFWDLRAPWLEPLR---------------GPNGLDLSKLK
PSBC_OEDCA        LGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLR---------------GPNGLDLNKLK
PSBC_BIGNA        LGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLR---------------GPNGLDLNKLK
PSBC_MESVI        LGKYLMRSPSGEIIFGGETMRFWDCRAPWIEPLR---------------GPNGLDLNKLK
PSBC_OSTTA        LGKYLMRSPTGEIIFGGETMRFWDMRAPWVEPLR---------------GPNGLDLSKLK
PSBC_EUGGR        LGKYLMKSPTGEIIFGGETMRFWDFRGPWLEPLR---------------GPNGLDLNKLK
PSBC_CYAPA        LGKYLMRSPSGEIIFGGETMRFWDTRAPWLEPLR---------------GANGLDLTKIK
PSBC_THEVL        LGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLR---------------GPNGLDLNKIK
PSBC_THEEB        LGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLR---------------GPNGLDLNKIK
B8HRV4_CYAP4      LGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLR---------------GPNGLDLDKIK
A2C3V5_PROM1      LGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLR---------------GPNGLSLEKIQ
Q1PKP4_PROMR      LGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLR---------------GPNGLSLEKIQ
A9BBF3_PROM4      LGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLR---------------GENGLSLDKVQ
Q7V6H9_PROMM      LGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLR---------------GPNGLSLDKLQ
Q0IBR3_SYNS3      LGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLR---------------GPNGLSLDKLQ
PSBC_PROHO        LGKYLMRSPTGEVIFGGETMRFWDFRGPWLEPLR---------------GPNGLDLDKLN
PSBC_SYNY3        LGKYLMRSPSGEIIFGGETMRFWDFRGPWLEPLR---------------GPNGLDLDKLR
Q118V6_TRIEI      LGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLR---------------GPNGLDLSKLK
B1XNM5_SYNP2      LGKYLMRSPTGEIILGGETMRFWDFRGPWLEPLR---------------GPNGLDLDKIR
L8M3N9_9CYAN      LGKYLMRSPTGEIILGGETMRFWDFRGPWLEPLR---------------GPNGLDLDKVR
K9YEM1_HALP7      LGKYLMRSPTGEIILGGETMRFWDFRGPWLEPLR---------------GPNGLDVDKIR
K9TJB4_9CYAN      LGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLR---------------GPNGLDLRKLK
PSBC_SYNE7        LGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLR---------------GPNGLDLDKLT
Q7NI60_GLOVI      LGKYLMRSPSGQVIYGGETMRFWSIKTPLDEMLKEGVEIQNNKLVYPVGGTTGYSVEKIM
G1E7A3_KARVE      LGKYLMRSPSGEVIFGGETMRFWDMRAPWVEPLR---------------GPNGLDLNKLR
C6G428_HETTR      LAKYLMRSPSGEVIFGGETMRFWSVQGGWVEPLR---------------TSFGLDIYKIQ
Q8WIE5_AMPOP      LAKYLMRSPTGEIIFGGETMRFWSASTGWLQGFR---------------DAKGFDVNKFR
                  *.** *:**:*::* **** * *.      : ::                  * .: :. 

PSBC_GUITH        NDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNYVSPRSWLTTSHFFLGFAFYIGH
PSBC_PYRYE        NDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNYVSPRSWLTTSHSFLGFFLFIGH
PSBC_TRICV        NDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNYVSPRSWLCCSHFFLAFFFLIGH
PSBC_GALSU        NDIQPWQERRAAEYMTHAPLGSINSVGGVATEINSFNYVSPRSWLTTSHFVLGFFLFVAH
PSBC_CYACA        NDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNYVSPRSWLTTSHFFLGFFIFIGH
PSBC_ARATH        KDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLSTSHFVLGFFLFVGH
PSBC_CITSI        KDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNYVSPRTWLSTSHFVLGFFFFVGH
Q2WGC8_SELUN      RDIQPRQERRSAEYMTHAPLGSPNSVGGVATEINAVNYVSPRSRSATSHFVLGFFFFVGH
PSBC_CHAGL        KDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLSTSHFVLGFFFFVAH
PSBC_OEDCA        NDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINATNFVSPRSWLATSHFCLGFFFFVAH
PSBC_BIGNA        NDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINAVNFVSPRSWLATSHFVLGFFFFIGH
PSBC_MESVI        NDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNFVSPRSWLATSHFTLAFFFFVGH
PSBC_OSTTA        NDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINSTNFVNPRSWLATSHYVLGFFFFVGH
PSBC_EUGGR        NDVQPWQERRAAEYMTHAPLGSLNSVGGVATEINAVNFVNPRSWLATSHFVLAFFFFVGH
PSBC_CYAPA        YDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNYVSPRSWLSTSHFVLGFFLFIGH
PSBC_THEVL        NDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGH
PSBC_THEEB        NDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGH
B8HRV4_CYAP4      NDVQPWQIRRAAEYMTHAPNGSINSVGGLITEPNSFNYVNPRAWLAGSHFILAFFFLVGH
A2C3V5_PROM1      NDIQPWQVRRAAEYMTHAPNASINSVGGIITEPNAVNFVNLRQWLAGAQFFLGWFTFVGH
Q1PKP4_PROMR      NDIQPWQVRRAAEYMTHAPNASINSVGGIITEPNAVNFVNLRQWLAAAQFFLGWFTFIGH
A9BBF3_PROM4      NDIQPWQVRRAAEYMTHAPNASINSVGGIITEPNAVNFVNLRQWLASAHFFLGWFTFVGH
Q7V6H9_PROMM      NDVQPWQVRRAAEYMTHAPNASINSVGGIITEPNSVNFVNLRQWLAGHAFFLAWFTIVGH
Q0IBR3_SYNS3      NDIQPWQVRRAAEYMTHAPNASLNSVGGIITEPNSVNFVNLRQWLGAAQFVLAFFFLVGH
PSBC_PROHO        NDVQPWQIRRAAEYMTHAPLASINSVGGVITEPNSVNYVNLRQWLAGSHFILGFFFLIGH
PSBC_SYNY3        NDIQPWQVRRAAEYMTHAPLGSLNSVGGVITDVNSFNYVSPRAWLATSHFVLGFFFLVGH
Q118V6_TRIEI      NDIQPWQVRRAAEYMTHAPNGSINSVGGIITDINGFNYVNPRAWLAAAHFILGFFFLIGH
B1XNM5_SYNP2      NDIQPWQLRRAAEYMTHAPNASINSVGGIITEPNSFNFVNLRQWLAGSHFVLSFFFLVGH
L8M3N9_9CYAN      NDIQPWQLRRAAEYMTHAPNASINAVGGIITEANSFNFVNIRQWLASFQFIMAFFFLVGH
K9YEM1_HALP7      NDIQPWQLRRAAEYMTHAPNGSINSVGGIITEPNSFNYVNLRQWLAGSHFILGFFFLIGH
K9TJB4_9CYAN      NDIQPWQIRRAAEYMTHAPNGSINSVGGIITEANGFNYVNPRAWLAGAHFILGFFFLVGH
PSBC_SYNE7        NDIQPWQARRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRAWLATSHFVLAFFFLVGH
Q7NI60_GLOVI      TEIQPWQIRRAAEYMTHAAIGSLNSVGGVATEINTINYTSPRIWLSGSHFILGFFLLIGH
G1E7A3_KARVE      TDIQSWQIRRAAEYMTHAPLGSLNSVGGVATEINSVNYVSPRSWLCCAHFFFGFFLWVGH
C6G428_HETTR      SDIQSWQERRAAEYMTHAPLGALNSVGGVATEVNSVNYVSPRSWLTSSHWVFGYFILVGH
Q8WIE5_AMPOP      YDIQTWQERRAADFMTHAPIGSLNSVGGIPTEINAINYVSPRSWLVSSHWFLGFSLFVGH
                   ::*. * **:*::****. .: *:***: *: *  *:.. *         :.:   :.*

PSBC_GUITH        LWHAGRARAAAAGFEKGINRENEPVLTLRPID
PSBC_PYRYE        LWHAGRARAAAAGFEKGINRENEPVLSMRPLD
PSBC_TRICV        WWHSGRARAAAAGFEKGINRANEPVLSMRPID
PSBC_GALSU        LWHAGRARAAAAGFEKGINRENEPVLSMKLID
PSBC_CYACA        LWHAGRARAAAAGFEKGINRENEPVLSMRPLD
PSBC_ARATH        LWHAGRARAAAAGFEKGIDRDFEPVLSMTPLN
PSBC_CITSI        LWHAGRARAAAAGFEKGIDRDFEPVLSMTPIN
Q2WGC8_SELUN      SRHAGRARAAAAGSERGIDRDPEPVPPMTPLN
PSBC_CHAGL        LWHAGRARAAAAGFEKGIERETEPVLFMSPLD
PSBC_OEDCA        LWHAGRARAAAAGFEKGIDRFNEPTLSLRPLD
PSBC_BIGNA        FWHAGRARAAAAGFEKGIDRDDEPVLSLKPLD
PSBC_MESVI        LWHAGRARAAAAGFEKGIERETEPVLFMKPLD
PSBC_OSTTA        LWHAGRARAAAAGFEKGIDRDTEPVLSMRPLD
PSBC_EUGGR        LWHAGRARAAAIGFEKGIDRSREIARKLKPLD
PSBC_CYAPA        LWHAGRARAASGGFEKGLDRENEPVLSMKLLD
PSBC_THEVL        LWHAGRARAAAAGFEKGIDRESEPVLSMPSLD
PSBC_THEEB        LWHAGRARAAAAGFEKGIDRESEPVLSMPSLD
B8HRV4_CYAP4      LWHAGRARAAAAGFEKGIERETEPVLAMPDLD
A2C3V5_PROM1      LWHAGRARAAAAGFEKGISRSQEPALSMPDLD
Q1PKP4_PROMR      LWHAGRARAAAAGFEKGIDRKSEPALEMPDLD
A9BBF3_PROM4      LWHAGRARAAAGGFEKGIDRKNEPALSMPDLD
Q7V6H9_PROMM      WFHAGRARAVAAGFEKGTDRKTEPALSMPDLD
Q0IBR3_SYNS3      LWHAGRARAAAAGFEKGIDRQAEPTLAMPDLD
PSBC_PROHO        LWHAGRARAAAAGFEKGIDRKTEPVLSMSDLD
PSBC_SYNY3        LWHAGRARAAAAGFEKGIDRETEPTLFMPDLD
Q118V6_TRIEI      LWHAGRARAAEGGFEKGLDRQTEPVLSMPNLD
B1XNM5_SYNP2      LWHAGRARAAEAGFEKGIDRETEPVLNMNELD
L8M3N9_9CYAN      LWHAGRARAAAGGFEKGINRETEPVLAMPDLD
K9YEM1_HALP7      LWHAGRARAAAAGFEKGIVRETEPVLSMPDLD
K9TJB4_9CYAN      LWHAGRARAAAAGFERGIDREDEPVLAMTELD
PSBC_SYNE7        LWHAGRARAAAAGFEKGIDRATEPVLAMRDLD
Q7NI60_GLOVI      LWHAGRARAANAGFEKGIVRGTEGA-------
G1E7A3_KARVE      LWHAGRARAAAAGFEKGINRYTESVLAMRLLD
C6G428_HETTR      WWHGGRARASALSSERGLSRIYEPVLYMRPID
Q8WIE5_AMPOP      WWHSARARAAAVSIELGLSRLYEPALYMRPID
                    *..****   . * *  *  * .