CLUSTAL format seed alignment for MF_01497

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Q8F359_LEPIN          ------------------------------------------------------------
I4B7K1_TURPD          ------------------------------------------------------------
V5WJH4_9SPIO          ------------------------------------------------------------
B0SUI0_LEPBP          ------------------------------------------------------------
E1RBF1_SEDSS          ------------------------------------------------------------
H9UJW3_SPIAZ          ------------------------------------------------------------
F8F2C4_TRECH          ------------------------------------------------------------
M1NDA4_DESSD          ------------------------------------------------------------
A0A7U3YL12_DESPD      ------------------------------------------------------------
A9GAX6_SORC5          ------------------------------------------------------------
F2K2W1_MARM1          ------------------------------------------------------------
A6VVA6_MARMS          ------------------------------------------------------------
SRKA_ECOLI            ------------------------------------------------------------
Q6DB79_PECAS          ------------------------------------------------------------
J7U728_MORMO          ------------------------------------------------------------
B4EZ69_PROMH          ------------------------------------------------------------
F7YQB5_VIBA7          -----------------------------------------------------------M
A0KQT9_AERHH          ------------------------------------------------------------
H2G0Y6_OCESG          ------------------------------------------------------------
C4LD30_TOLAT          ------------------------------------------------------------
M4UBG7_9GAMM          ------------------------------------------------------------
Q47W24_COLP3          ------------------------------------------------------------
Q8EJX4_SHEON          ------------------------------------------------------------
Q5QZD6_IDILO          ------------------------------------------------------------
D3SG44_THISK          ------------------------------------------------------------
M4NI80_9GAMM          ------------------------------------------------------------
A0LAM7_MAGMM          ------------------------------------------------------------
A1WYJ5_HALHL          ------------------------------------------------------------
U5T4G0_9GAMM          ------------------------------------------------------------
H0PV35_9RHOO          ------MLGFRGKKDLFSPPGAA------------------------RANPSVVSKSCDN
E5AN68_MYCRK          MRVCCGCWRWAASRASTGAGGAAWRAGAGTGGGYFVCWRVGLLRTLPRAELRLVRVQRCS
D3HN92_LEGLN          ------------------------------------------------------------
Q12FW2_POLSJ          ------------------------------------------------------------
B1XYU3_LEPCP          ------------------------------------------------------------
S6CGS0_9GAMM          ------------------------------------------------------------
E1VFG6_9GAMM          ------------------------------------------------------------
C7RCL2_KANKD          ------------------------------------------------------------
Q2SQN6_HAHCH          ------------------------------------------------------------
K4KJN0_SIMAS          ------------------------------------------------------------
Q21FY1_SACD2          ------------------------------------------------------------
Q0VSQ2_ALCBS          ------------------------------------------------------------
M5DNS7_9GAMM          ------------------------------------------------------------
M1FET6_9ALTE          ------------------------------------------------------MRCQDY
E1VAL0_HALED          ------------------------------------------------------------
A0A060B7A1_9GAMM      ------------------------------------------------------------
Q6MH53_BDEBA          ------------------------------------------------------------
M4VMV6_9PROT          ------------------------------------------------------------
E1X502_HALMS          ------------------------------------------------------------
                                                                                  

Q8F359_LEPIN          ----------------------------MADFFQLNPGEILTLAEKAG----YEPSGHCM
I4B7K1_TURPD          ----------------------MQQKRETDYFYQLTPDEIIDAVIKLG----LEPSGHIS
V5WJH4_9SPIO          -----------------------------MDFYQLDPPAILRAVESAG----FSCSGHIH
B0SUI0_LEPBP          -------------------------MNIHHSFYQLTPDTILNAIESLG----YETTGRYF
E1RBF1_SEDSS          ---------------------MENEKPPAGIFDYIEPDGIISAVEISY---GINLDGTWS
H9UJW3_SPIAZ          -------------MSWYDNPPHNDSAESPGDFDDLTPQAVLRSVEAGF---DLRLSGSIT
F8F2C4_TRECH          ------------------------MRIMQAPFNCLTPDLITDSIEEAF---GISLENLIY
M1NDA4_DESSD          -------------------MPSLNSIPHPDSFPELGPDTVLNLVESAL---DIRCSNICR
A0A7U3YL12_DESPD      ----------------MEPHEQRQPASPRAPFAHLTPERILREVETAL---GRDCSNLCR
A9GAX6_SORC5          ----------------------MSTTTPTDLFLSLTPHKVIEAVEAA----GVHCNRVCY
F2K2W1_MARM1          -------------------------MHSEHPFSQLIPDVIIDAVESSSD---QYTNYQIY
A6VVA6_MARMS          -------------------------MTATHSFSSLLPDAILDAVESTG----LWSDSRIY
SRKA_ECOLI            ------------------------MNNSAFTFQTLHPDTIMDALFEHG----IRVDSGLT
Q6DB79_PECAS          ---------------------MAAMNSSVFNFQTLFPDLIVDALLDVG----LRVDSGLT
J7U728_MORMO          ---------------------MQTITPPVFTFQDFRPDRLIDSLSRYG----IWLDSGLT
B4EZ69_PROMH          -----------------------MAISASFNFQGLSPDSIWDALINIG----FYPDSGLT
F7YQB5_VIBA7          RAGLLINSNFVTNGKGLSNGPFLIMTKASFHFDALTPDTMWYALESIG----IRAESGFL
A0KQT9_AERHH          -----------------------MVDDMRFNYSDLNPDLIMDALDLSG----LRIDSGLI
H2G0Y6_OCESG          -----------------------------MDYYQLTPDVIADALASVG----IYVDRGLM
C4LD30_TOLAT          -------------------------MQSSFQFQSLTPELILSALAAQG----LYPESGLT
M4UBG7_9GAMM          ------------------------MQDANFSYLSLTPERQLDALASIG----IYPQTGLI
Q47W24_COLP3          --------------------------MASFDFSALSPDLIIDGLESAG----FSVDSGLL
Q8EJX4_SHEON          --------MNQEKLDLRKSAADDTHSGAAFAFQALTPDLILDAIESLG----VYPETGLL
Q5QZD6_IDILO          -------------------MNDFTENASDFAFQGLTPDLVVNALESVG----LYPASGLL
D3SG44_THISK          ------------------------MNTQPHPYDALKPTVILDAVETTG----LRCDGRLL
M4NI80_9GAMM          --------------------------MNAAPYASLSPDLVLDAVSACG----LWPDGRLL
A0LAM7_MAGMM          -----------------------MSDDAQTPYSNLSPDAVLNAVERSG----WRCDGRQL
A1WYJ5_HALHL          -------------------------METHHPFETLDPDTVLNAVEAVGG---VRSDGRLL
U5T4G0_9GAMM          ---------------------MTESLPGDHPFASLQPALLLDMVEAAG----VDADGRLL
H0PV35_9RHOO          GTMPFP-----------------TTPMSPLPFETLTPDLILDALESC----GLAPDGRLL
E5AN68_MYCRK          GRAPLRHNGGMEPNDRSFNNPPRADAGAPAPYAGLTPERVLDALDAVLARGGRRTDGRLL
D3HN92_LEGLN          -----------------------MNHENQTPYTQLHPNAILDAIEST----GLLCTGSLI
Q12FW2_POLSJ          -----MTEKSKATAPAAL-----------HAYEPLTPDLVLDALASVG----LAGDGRLM
B1XYU3_LEPCP          -----MNDIAPDDLPPAYRLPAPQQATDEQPYAGLTPYAVLDALDAAG----LRGDGRIL
S6CGS0_9GAMM          ---------------------------MSHPYDRLSPDRVLDAIESAG----FLPSGHVP
E1VFG6_9GAMM          ------------------------MSDELEEYARLSPEDVILAVESVG----FLSDARIL
C7RCL2_KANKD          ----------------------MSEQSQAHPFNKLTPDFILDAIEALG----FYSDGRIL
Q2SQN6_HAHCH          -----------------------MTAPNTHPFDALTPEFIMDAVESQG----YLCDGRIF
K4KJN0_SIMAS          -------------------------MSQPHPYAALTPDRVLDAIESTG----RLTDARVF
Q21FY1_SACD2          MTDHTDTSNDNVGNTIQADASPVAVNLANTPFHTLTQDTVLDAVESLG----YVSDLRVF
Q0VSQ2_ALCBS          ---------------------------MSHPFDNLTPDYMLDAVDAAG----FLSDGRLL
M5DNS7_9GAMM          --------------------------MSSHPYATLTPERVMDAVDSLG----YLCDARIL
M1FET6_9ALTE          ASDDTGYTGRQIHDGSEFMTEHSDNVISGHPYDALKPDALLDAMEDAG----FAVSGRLF
E1VAL0_HALED          ------------------------METSIHPFARLEPARVVAAVESLG----FWLPGEPF
A0A060B7A1_9GAMM      ---------------------------MPHPFSTLSPDTVMSAAESVG----IWPAGEPF
Q6MH53_BDEBA          -------------------------MDKSSSFYSLDPEKVLLAAEHAG----FYPTGEFT
M4VMV6_9PROT          ------------------------MQTDSQNFYQLDPNLILATAEQNN----FFVTGELI
E1X502_HALMS          ------------------MATQTWGDKETQFFYELSPEKILSCVESLG----FKTTGRAM
                                                     :  :                         

Q8F359_LEPIN          ALNSLENRVFDLRLE--------------------DGSHIISKFYRPGRWNRTQILEEHK
I4B7K1_TURPD          QLNSMENRVFDLRLE--------------------SGKHIVTKFYRPGRWSREQILEEHA
V5WJH4_9SPIO          QLNSLENRVFDVRLE--------------------DSSHLVVKFYRPGRWSREAIADEHA
B0SUI0_LEPBP          ILNSVENRVYDIETT--------------------KAGRIVVKFYRPGKWNYHQILEEHS
E1RBF1_SEDSS          AFPSYVNRVYGLRDE--------------------DGNRYVVKLYRPGRWSVSAIEEEHG
H9UJW3_SPIAZ          PYNSYINRVYELTDE--------------------DGQSFMAKFYRPGRWDEAAILEEHR
F8F2C4_TRECH          PYPSYINRVYGLQDT--------------------DDKEYVAKFYRPGRWSQQQIREEHQ
M1NDA4_DESSD          QLNSYINRVFELQAV--------------------DGKGLVIKFYRPGRWSKTAIQDEHD
A0A7U3YL12_DESPD      SYNSYINRVFELADA--------------------EGNGLVAKFYRPGRWSRQALQDEHD
A9GAX6_SORC5          PLNSFENRVYEVERE--------------------DRTRVIAKFYRPGRWTREQILEEHR
F2K2W1_MARM1          PLNSYENRVYQVGME--------------------DGPALIAKFYRPDRWSNKQILEEHT
A6VVA6_MARMS          PLNSYENRVYQIGIE--------------------EASPVIAKFYRPDRWNEAQIREEHQ
SRKA_ECOLI            PLNSYENRVYQFQDE--------------------DRRRFVVKFYRPERWTADQILEEHQ
Q6DB79_PECAS          ALNSYENRVYQFADE--------------------DRKRFVVKFYRPERWSESQIQEEHI
J7U728_MORMO          ELNSYENRVYQFTDE--------------------NRTRYVVKFYRPARWNEAQIREEHD
B4EZ69_PROMH          ELNSYENRVFQFMDE--------------------HKQRYVVKFYRPQRWSYSQIKEEHE
F7YQB5_VIBA7          ALNSYENRVYQFIDE--------------------ERQRYVVKFYRPQRWSVEQIQEEHD
A0KQT9_AERHH          ELNSYENRVYQFQDE--------------------DRRRYVVKFYRPGRWSRAQILEEHD
H2G0Y6_OCESG          ALNSYENRVYRFQSE--------------------DDGTLVAKFYRPGRWSRAQVEQELS
C4LD30_TOLAT          PLNSYENRVYLFQAE--------------------DRERYVVKFYRPERWNQQQLQEEHH
M4UBG7_9GAMM          ALNSYENRVSLFTDE--------------------NDIRYVVKFYRPQRWSKEQLLEDHH
Q47W24_COLP3          ALNSYENRVYQFHDD--------------------NLVKYVTKFYRPQRWQLAQINEEHD
Q8EJX4_SHEON          ALNSYENRVYQFRSD--------------------EGQRYVVKFYRPDRWSDAQIQEEHD
Q5QZD6_IDILO          ALNSYENRVYQFADD--------------------DRKRYVAKFYRPQRWRTEQINEELE
D3SG44_THISK          ALNSYENRVYQIGIE--------------------DATPVIAKFYRPGRWSDQAIVEEHA
M4NI80_9GAMM          ALNSYENRVWQVGLERDGLE---------------PATPVIAKFYRPGRWSDAAIVEEHA
A0LAM7_MAGMM          ALNSFENRVYQIGLE--------------------DGSFVVAKFYRTGRWSDAAILEEHR
A1WYJ5_HALHL          PLNSYENRVYMVGVE--------------------GGPAVVAKFYRPDRWDDAQIREEHA
U5T4G0_9GAMM          ALNSYENRVYQLGVE--------------------DRAPMILKAYRPGRWSDAAILEEHA
H0PV35_9RHOO          ALNSYENRVYQVGME--------------------DGPMLVVKFYRPARWSDEAIAEEHA
E5AN68_MYCRK          ALNSYENRVYQVGIE--------------------DAAPLVAKFYRPGRWSDEAILEEHA
D3HN92_LEGLN          ALNSYENRVYQIGIE--------------------NDEPLIAKFYRPNRWSSEAILEEHQ
Q12FW2_POLSJ          ALSSYENRVYQVHLENTVGSDDL------------AGDIVVVKFYRPGRWSDAQIVEEHT
B1XYU3_LEPCP          QLNSYENRVFQVHLEDER--------------------VVVAKFYRAARWSDAQILEEHQ
S6CGS0_9GAMM          ALGSYENRVYQVGIE--------------------DSPPVIAKFYRPERWDEATILEEHA
E1VFG6_9GAMM          ALNSYENRVYQVGIE--------------------ESDPMVAKFYRPSRWTDAQILEEHA
C7RCL2_KANKD          TLNSYENRVYQIGIE--------------------EQQPIIAKFYRPERWTQEQILEEHE
Q2SQN6_HAHCH          ALNSYENRVYQVGIE--------------------GADPLIAKFYRPNRWSREQILEEHE
K4KJN0_SIMAS          PLNSYENRVYQVGIE--------------------GGQPLIAKFYRPDRWTRDQILEEHR
Q21FY1_SACD2          PLNSYENRVYQVGIE--------------------GEAPLIAKFYRPNRWSLQQIREEHT
Q0VSQ2_ALCBS          QLNSFENRVYQVGQE--------------------EGPPVIVKFYRPQRWSDEQILEEHA
M5DNS7_9GAMM          ALNSYENRVYQVGIE--------------------DQLPLIAKFYRPGRWSRAAITEEHQ
M1FET6_9ALTE          ALNSYENRVYQIGLD--------------------EGPPVIAKFYRPGRWTEASIREEHS
E1VAL0_HALED          ALNSYENRVYLVHDD--------------------ERRRWVVKFYRPGRWSDAQIQEEHD
A0A060B7A1_9GAMM      ALNSYENRVLMFRDD--------------------DGKRWVVKFYRPDRWADEVIQEEHD
Q6MH53_BDEBA          QLNSYENRVFDIKLEQPCTPDAQ-------------SNNVIAKFYRPQRWSKEAILEEHE
M4VMV6_9PROT          QLNSYENRVFDIKLENEMSLNKNSASSNSISHNSVINNSIIAKYYRPNRWSRETILDEHR
E1X502_HALMS          VLNSMENRVYEIEIYSDSPNPSE--------------HFLISKFYRPGRWSKEQIQDEHD
                         *  ***  .                            : * **. :*    : ::  

Q8F359_LEPIN          FLQDLKEEEIPVCSPILFQDGNS------------LSLFQEK-IFYSFWPRVGGRSPDEL
I4B7K1_TURPD          FLFELAEDEIPALAPLKF-DGQ--------------SLFEEQGIYFAIWPRTGGREPEEL
V5WJH4_9SPIO          MLFRLQSMDVPVCAPLRR-DGE--------------SLFLQDGLLFAIWPRTGGRLIDEF
B0SUI0_LEPBP          FLQELSAEEIPVLAPITI-DGK--------------SVFEWEGIYFAIWPLRNGRIVEEI
E1RBF1_SEDSS          FLLECAAEEVPVVAPLSGVDGRTLHFLE----CPAIS----GSYPFALFPLRSGRLFETD
H9UJW3_SPIAZ          FIQDCVALEIPTVAPLPDADGDTLITVELEGVVSGLT----KEYSFAVFPKRSGRNFDAE
F8F2C4_TRECH          FLQDLYLGECPVVLPIPDQEGATLQTLNLETYNPNSDQIDELIFHFALFPKQTGRAFDPE
M1NDA4_DESSD          FLLELHKQEIPVIPPLIQSNGETLGVHQENL-------------YFSVFPRCGGRSYDEF
A0A7U3YL12_DESPD      FLLELAAEEIPVIAPLPLSDGSTLGCCDQT--------------FFAVFPRKGGRCVDEL
A9GAX6_SORC5          FLAELADAEIPVCPTRPFPDGETLKQIDHI--------------PYCLFERMGGRAPDEL
F2K2W1_MARM1          ALSLLEKKGVPVAAPLAFNGQ--------------TLFE-HANFRLSLTNKVIGNAPEAE
A6VVA6_MARMS          TLLKLKAAGVPVVAPLEFNGE--------------SLLR-HNDMYFCLSPRLVGQHPEAD
SRKA_ECOLI            FALQLVNDEVPVAAPVAFNGQ--------------TLLN-HQGFYFAVFPSVGGRQFEAD
Q6DB79_PECAS          FALQLAEDEVPIVAPVSLNGQ--------------TLNV-YEGFHFAVFPSIGGRQYEMD
J7U728_MORMO          LTLTLAQAGLPVAAPLAFDGD--------------TLLS-QDGYLFALFPSVGGRAYETD
B4EZ69_PROMH          FVLALKEAQVSVAAPIEVKGE--------------TVHLSNEGFYFALFPSIGGRAYETD
F7YQB5_VIBA7          FTRELYAAEIPIAEPLLINGA--------------TLHH-YQGYHFALFNSVDGRQFEVD
A0KQT9_AERHH          FAARLNEAEIPVAAPIAFAGE--------------TLLE-HLGYPFAIWQSVGGRQFEVD
H2G0Y6_OCESG          FVSAAAAQGVRVAEPLQRDGH--------------SLFE-YQGLLFSVWRSVPARAFEPD
C4LD30_TOLAT          LTQHLVANDVPLIAPLSFQSD--------------SLHY-IDGFYYAIWPYRAGRAVELD
M4UBG7_9GAMM          FSLTLKEQGCLLAEPVTLNEQ--------------TLFL-FEGYYFSLFRALSARNMEID
Q47W24_COLP3          FSFELEEQELPIVAPLKINGQ--------------SLFE-HQGYHFAVFPCRGGRIFEVD
Q8EJX4_SHEON          FALALAEQEIPMAVPTAVQGH--------------TLHH-FQGFRFALFPSIGGRAFEVD
Q5QZD6_IDILO          FVEELAQAEVPAVSALELQGK--------------RLHE-FEGYRFCVYTSIGGRAFEPN
D3SG44_THISK          FSQELAAREVPVVAPLAGQDGE-------------TLHH-HQGFRFAVYPRCGGRTPDLE
M4NI80_9GAMM          FTQELADAELPVVAPLA-FDGR-------------TLLH-HGGFRYALTPRRGGRAPELE
A0LAM7_MAGMM          FTQELAALELPVVPPLVTAAGE-------------TLFH-DGNFRVALFPRRGGRTPDLE
A1WYJ5_HALHL          FSEELVAAEVPVVAPLR-CGAG-------------TLAH-SHGFRIALYPMRGGRMLEVD
U5T4G0_9GAMM          FAVELAGHEIPVVAPID-LNHQ-------------TLHQ-AAGFRFALYPRRGGHAPELD
H0PV35_9RHOO          FVTELAAREIPVVPPIS-VGGH-------------TLLR-HQDLRFAVFPRVGGRAPELS
E5AN68_MYCRK          FVAQLAEHEIPAVPAIT-LNGH-------------ALHE-IDGFRFALFERRGGRAPELD
D3HN92_LEGLN          FSLELVQHEIPIISPLI-INDQ-------------TLHH-YHDFRFALFPRRGGHALELD
Q12FW2_POLSJ          FAAELMAAEIPVVGPLVLEGA--------------TLHR-FGGFSFSVSPSRGGRRPELD
B1XYU3_LEPCP          FALELAAAEVPAVPPLVLAAGLGIEPAPRLLGTPPTLAD-WQGWRYAASPRCGGRAPELD
S6CGS0_9GAMM          FSSELAAAEIPVVAPLARAGH--------------TLFE-HAGFRFALFPRQGGRAPEPG
E1VFG6_9GAMM          FVAALVDAEIPVVAPWVKAGSGA--------DGAGSLHH-YQGYRFALFPRKGGQAPEPG
C7RCL2_KANKD          FTTELAESELPVVAPLSLHS--------------KTLFE-YDGFYYALYPRKGGHAPELD
Q2SQN6_HAHCH          FCYELVEAELPVVAPLRMNDG-------------ETLPQ-AGEFHFSLFPRKGGHAPELD
K4KJN0_SIMAS          FTAELHAEGLSVVPPLTDTEG-------------QSLWH-FAGFDFALFARQGGYPPELD
Q21FY1_SACD2          FSLALAELEIPVVPPIANAEG-------------ETLFE-YGDHRFSLSQRRGGHAPSLD
Q0VSQ2_ALCBS          FSLFLAERDLPVVAPIEKGG--------------TSLFH-CDDFSFAVFRRAGGHAPELA
M5DNS7_9GAMM          FLFELEREELPVVAPILHGG--------------ESVFE-FDGFYFALFPRRGGHAPELS
M1FET6_9ALTE          FTKELEAADIPVVAPLTLPNG-------------DTLGQ-SGPFRFAVFPQRGGQAPDVS
E1VAL0_HALED          FLAELEAADVAVAAPWRDEQG-------------VSLHR-AEGFRFALYPQLPGQAPELE
A0A060B7A1_9GAMM      FLQELAAANVPVVAPWRDQHG-------------KSLHT-YQQFRFTLYPQCSGQAPELD
Q6MH53_BDEBA          FLLSLKAEGIPAVAPLLQG--------------HDSTLQEVDGMYVAFFPKVLGRMPQEF
M4VMV6_9PROT          FIQELKSEGIEVASTYTLK--------------NNSSVDMVDGIYYSFFEKVRGRMVQEL
E1X502_HALMS          FLLELDESEVPVIAPLVIDG-------------QSVFTDEVSGLYYCLFPKKGGRAPDEM
                                    .                                      .   .  

Q8F359_LEPIN          SPENLKIIGRLLARIHNVGQSQ-SFKHR---ITLNSKT---------YGTDPLENLLQGE
I4B7K1_TURPD          SEIDLQILGRLLARVHNVGASAKSESCR---PAFNSDR---------FVREPLEVLREKH
V5WJH4_9SPIO          TLPLIRRLGSYIARIHLAARDL-QLTNR---PVMNRQY---------MLERHSSLLLDEH
B0SUI0_LEPBP          QSKDLERVGALLGRIHSVGKRS-KIVSR---PSLDIPS---------YGLSALQYILDKK
E1RBF1_SEDSS          RDEDYLRIGSLIGRLHRISRQG-KAHVR-----QEWLP-------SLSKNHLEMLLEQNL
H9UJW3_SPIAZ          SEDDWLRLGSLVGRMHTAARQR-PASHR-----LVCNPA------TIRRTFLQELEAANA
F8F2C4_TRECH          TDEDWIRLGSLAGRIHVSGRKS-PKLSR-----YRLDA-------FRLKYYIDELLKAGL
M1NDA4_DESSD          NEDQWLEIGRLIGRSHAVGAIH-PANNR-----ITMLPG------QSTTDQIAFILKSGV
A0A7U3YL12_DESPD      LDEQWLEVGRLLARVHQVGERR-RPRDR-----VTLHPA------ETTAAQVALLCDSGL
A9GAX6_SORC5          GDELFVRLGRLAARIHNVGAAS-AAEHR-----VRLSAD------TYAREDLGWLVERKL
F2K2W1_MARM1          DLDDLFQIGELIGETHSVLTKL-PLIGRQSPSLIESIESQIKWLLASPSDVSKTQTS---
A6VVA6_MARMS          NLDQLYQIGELIGQLHKTLSTT-PFKERISVSPLSQMDDAANQILTGRTVFGHSELSEEL
SRKA_ECOLI            NIDQMEAVGRYLGRMHQTGRKQ-LFIHR---PTIGLNE---------YLIEPRKLFEDAT
Q6DB79_PECAS          NEEQLEWVGRFLGRIHQTGQKS-LFTER---PTIGVNE---------YLHEPYRLLETCP
J7U728_MORMO          NLDQLESTGRLLGRLHQISRER-CFEHR---PAIGLQE---------YLLTPREILAQCP
B4EZ69_PROMH          NLFQLEEVGRTLGRIHQIGRKK-SYQYR---PTLSVAD---------YLVAPKLEFEQSD
F7YQB5_VIBA7          NMDQLEGVGRFLGRIHHISATR-TFVHR---PTISLDE---------YLYQPKQLLENAS
A0KQT9_AERHH          NLDQLEWVGRYLGRIHQIGASR-PFHHR---VRLDVES---------MLHEPRQLLASGE
H2G0Y6_OCESG          NLEQLEALGEQLARLHCVGETL-SLDLR---PVLDPAT---------ELARSRSVLERQA
C4LD30_TOLAT          NLMQLEAVGQALGRWHASVTGY-VLQHR---PAFDVVN---------RLTTSVSYLLQYK
M4UBG7_9GAMM          NIDQLYDIGIALGKMHRISSVQ-PFEHR---ESLNIQN---------MLTAPIEALQKSP
Q47W24_COLP3          NLNQLEWMGRFIARIHAVSSQN-DFIQR---PDFNSDE---------LLFQARETIKASN
Q8EJX4_SHEON          NLEQLEFVGRFIGRMHQYGAQS-VFQAR---EPLNPQI---------LGDEPLAWLKQSE
Q5QZD6_IDILO          DLDELERLGRQIGRMHAVAQAG-KFKVR---ETIDYEG---------FVEQSVVELHQSA
D3SG44_THISK          QSVTLQRIGRFIARIHEVGHST-PFHER---ITLEPGT---------LGEQARQDVLASG
M4NI80_9GAMM          AIDQLQWLGRLIARLHLIGARA-PFVHR---GRLDRDT---------MVQQPMLAVLASS
A0LAM7_MAGMM          HGETLKRIGRLMGRMHGVAAQR-PFEHR---ETLDIQS---------FAIDSYQFLLSSG
A1WYJ5_HALHL          NRDVLRRLGAYLGRIHVVGGGG-AFDHR---LSLDPGD---------HGRRARDWLLAGN
U5T4G0_9GAMM          NADTREWLGRLLGRMHTVGEAG-VFEHR---PVLDADV---------MGRQSRDWLLAAG
H0PV35_9RHOO          DPATLEWMGRFIGRIHAVGALE-AYRYR---PALDIVS---------FGEEPRDWLLANH
E5AN68_MYCRK          DSATLQWLGRFIGRIHAIGRQR-DYVAR---GALDIDT---------FGHEPRAYLLSSG
D3HN92_LEGLN          NSEQLEWMGRFIGRIHRISAFK-SFEHR---MQLNPQT---------YGHNPYKLLLEQN
Q12FW2_POLSJ          NLEVLEWIGRFLARIHTVGSAQ-PFVHR---PALNLQTFGYASRDILLAGGAHGSHGSHG
B1XYU3_LEPCP          DPAVLEWIGRFLARLHLVGQAR-PFEHR---LRLD------GSR---IARAAVAWLCDQD
S6CGS0_9GAMM          DLDQLEWIGRFLGRIHQAGSAR-PFRHR---PALEVHR---------YGHAARAAVLESP
E1VFG6_9GAMM          DLDQLYRIGMLLGRMHAVGRKQ-EFSVR---PRLSLER---------YLETPIAAVCRDG
C7RCL2_KANKD          DLDSLFTLGRFIGRIHALGEIK-PYQFR---PSLTVET---------FGQQSFEYLM-EH
Q2SQN6_HAHCH          NFDSLLTLGRLLARIHAVGAVK-PFQHR---PRIDTQS---------FGRDAVALVR-EQ
K4KJN0_SIMAS          NLDHLHTLGCHLGQLHAIGKRE-PFQFR---PSLDARS---------FGHDSAAFLL-DG
Q21FY1_SACD2          DMDTLYRMGQHLGRIHALGQVE-DYSHR---PALTLED---------FGIRSREYLLAND
Q0VSQ2_ALCBS          NDDHLEQLGRTLARWHACGSDR-PYTMR---PTLQIVD---------DIR-TASTFLCDD
M5DNS7_9GAMM          NEDDLELLGRWLGRLHNIGSRK-PFAER---ATIRGGD---------DIRLAAEQVLKCG
M1FET6_9ALTE          VEDTLYRLGQWLGQIHNVGAAR-KFSHR---PDLSVASIP------TGIEQNNELLLKGN
E1VAL0_HALED          NPAHLFALGEVIGAMHAVGESG-RFAHR---RTLNLDD---------MLAEACDGVLSSP
A0A060B7A1_9GAMM      NPSHLFALGNALGRLHAVSSRK-AFVYR---PTLEWQG---------DIHDAEARVIESK
Q6MH53_BDEBA          LSGELHKVGRLMAQVHNVGARK-PAPHR---PVLDTSY----------YGGWETLDHLQD
M4VMV6_9PROT          TPSHFKKLGRWLARLHNVGSQK-IAEHR---SFIGPSN----------DGKWDQLDQLLS
E1X502_HALMS          NIDDLEILGRTLARLHTIGASK-KAEHR---LKITPQV----------YGRQNLNYLLNA
                              *   .  *           *                                

Q8F359_LEPIN          WIPSSCKKE-YLETTNQILDLFQENMKS--VPFHRIHGDCHKGNLLFGKEG---------
I4B7K1_TURPD          FLKDNHALE-YAELAERIAHHYDVHHEE--LPLLRIHGDLHKGNILNGSEG---------
V5WJH4_9SPIO          LLPPQHIAS-YRERVAQLGEWIQAMENE--LTFQPVHGDCHTGNILHGNES---------
B0SUI0_LEPBP          FITNSALADRYQKNARSAFAIFESLTKEYQIPSQRIHGDCHKGNLLISADG---------
E1RBF1_SEDSS          V-SSSLRRHFEGLCLHCIETIEPLF---SHQPLLRLHGDCHRGNILERPGE--------G
H9UJW3_SPIAZ          V-PGPHHAEFFELAHELLERIEPLF---KDIPLQRVHGDCHRGNILERPGE--------G
F8F2C4_TRECH          I-PEESLSDFLFITTKAFELLKNHN---ESIQSMCLHGDFHRGNLIYNSET--------G
M1NDA4_DESSD          IKQAPVASRFAAICTEILSEIKPMF---EGVALARIHGDCHFSNIIYRPGE--------S
A0A7U3YL12_DESPD      I-PVDLREAYARIATQIIELVQPLF---ARGEAIRIHGDCHRGNLIHRPGE--------S
A9GAX6_SORC5          I-PAPVERRYLAAARAVADAAEERL---RGVDVHRIHGDLHPGNLLLRDG---------A
F2K2W1_MARM1          TLPHALQKEFITLFDSLMQMSKDVMSQSGSIQRQTIHGDCHASNLLKSITG---------
A6VVA6_MARMS          QLPEKLKPIYIRQIATLRDMCETSIKSYWPTRLRPIHGDSHRSNLMLHDDQ---------
SRKA_ECOLI            LIPSGLKAAFLKATDELIAAVTAHW-RED-FTVLRLHGDCHAGNILWRD----------G
Q6DB79_PECAS          LIPKIHRHSFLQATRQLIDTVETYW-HSD-WRPLRLHGDCHPGNILWRD----------G
J7U728_MORMO          LIPQARRDSFIATLDTLIRETSARW-HDD-WHAIRLHGDCHPGNILWRD----------E
B4EZ69_PROMH          LVPTQLKSQFIDAIDKIIHEVSPKL-SDSTWKKLRLHGDCHPGNILWRD----------E
F7YQB5_VIBA7          FIPLHLQNTFFSDLSLLINKIEQQW-PAK-SAAIRLHGDCHPGNILWRD----------G
A0KQT9_AERHH          WLPSGLAKSFFGVLDELIKHVSDAM-TLD-VAQISLHGDCHPGNILWRD----------G
H2G0Y6_OCESG          RIPAALRQGLFSALERLIDGVSEHY-RSA--TLIGIHGDCHGGNLLWHQ----------G
C4LD30_TOLAT          PWGKT-KLPWEELLARLQLQLQEHE-LFS-VPQLALHGDCHAGNILWRD----------A
M4UBG7_9GAMM          YVPRFIRPKLFRCMHEIKTVVTEKL-AAQTYTSIRLHGDCHSSNIMLHQE---------Q
Q47W24_COLP3          YVPKSLTTAFFTILDQVIAVAAEQYLPAQGMQQIRLHGDCHAGNILWRDE---------G
Q8EJX4_SHEON          LVPTSLRVAFFTVVEQVLAKVNTLW-AQQRFKPIRLHGDLHPGNILWTPD---------G
Q5QZD6_IDILO          LLPAELKDAFFAILDPLSERLRSTP--LQDFEYQRLHGDCHIGNILQYEE---------Q
D3SG44_THISK          YLPPGLQTVYRDLSADLISRMQRNTEAVGPVPQLRLHGDTHPGNILWTD-----DGPH--
M4NI80_9GAMM          LLPTALQTNYRAAATRLDEAIAARLEALGPLRQLRLHGDCHPGNVLWTD-----AGPH--
A0LAM7_MAGMM          FVPPALEQAYQSLAETLVAQAQGCFERAGNFQSIRLHGDCHAGNILWTD-----EGPH--
A1WYJ5_HALHL          WLPPHLEEAYRTVTDDLLEAMAACWERAGAVHAIRLHGDFHPGNVLQTE-----EGFH--
U5T4G0_9GAMM          WIPEGVEASYRAVTDELLAAIDEARENAAGCAFIRLHGDFHPGNILWTD-----QGPH--
H0PV35_9RHOO          FIPDDLLAAWHSTVDQALDGVHRCFDRAGSYATLRLHGDCHGGNVLWSE-----AGPAPG
E5AN68_MYCRK          FVPVELRQAYETISQLALDAVQASFERAGDVRALRVHGDCHQGNVLWTD-----AGPH--
D3HN92_LEGLN          FIPDYLIPNFCKTAETALQKIEQIFKSIVHVDQIRLHGDCHAGNVLWNE-----SGPH--
Q12FW2_POLSJ          YLPLDMESRWRKAFEEAMLVAQTVFESVGDARSLRLHGDCHPGNILWTPEGLPLAGPH--
B1XYU3_LEPCP          LLPPDALAGWRQASLAALDQVDELFTRAGNLQLLRVHGDCHAGNVLWTD-----AGPH--
S6CGS0_9GAMM          LLPNAFRERYAGLSQALLDTIDEAFREI-EPAALRLHGDCHHGNILWT-----DSGPH--
E1VFG6_9GAMM          FLPATLCDRYRKITDTLRIKLNALPWE--AVQWIRTHGDCHAGNVLWTR----DDGPW--
C7RCL2_KANKD          AVPREYHLPYRTLAEDILKEVGKQWQAVGELDYIRTHGDCHIGNILWRDDN---------
Q2SQN6_HAHCH          FVPSELRASYDSLTRDLLQALEEIIGDGGDYVYIRTHGDCHVGNILWRDDA---------
K4KJN0_SIMAS          FIPSSLQEAYRTLSRDLLVKVDAAFARF-TPKLLRLHGDCHPGNILWRDEV---------
Q21FY1_SACD2          FIPKTLLAAYQTVSEQLIDKMQSVITNI-NYRSIRLHGDCHPGNVLQREDS---------
Q0VSQ2_ALCBS          VVDLNYRGQYRDVTGQILEKVAQQLNES-AFPLLNVHGDCHTGNILWRPNAD----NQGG
M5DNS7_9GAMM          LMPDDFRPAYESLIRDLLAHIDQQYPAD-KLKTLRLHGDLHTGNLLLREDV---------
M1FET6_9ALTE          WVPRDLRPAWDSLMVDLLRLCRTRINDAGNINTLRLHGDCHAGNILCREER---------
E1VAL0_HALED          WLDQRQRRAYTRVTDSLRSALVDRGWAPE--RSIRVHGDCHLGNMLGRDEV---------
A0A060B7A1_9GAMM      RLSKHQQRAYHNVVQKILRHLEKHPIASN--QMIRTHGDCHLGNVLGRDES---------
Q6MH53_BDEBA          WITPELRDRYNIAAEDILYAIDDSFDTS---EFIRIHGDCHKGNLLNNGK---------E
M4VMV6_9PROT          RVAPEVVGRYEAAAVRIFEELDERLAQLSDQDFIRLHGDLHRGNILEDSTG--------D
E1X502_HALMS          KVIPSHLEKTYNDLVLEVCNISEPYFNE--EKFIRIHGDCHLGNIIRRGDA--------S
                                                          *.* * .*::              

Q8F359_LEPIN          WFFVDFDDCLQGPAIQDFWMLLSKGKE--GIEEREYILSGYREFRDFDDRWFDLVEILRA
I4B7K1_TURPD          WFLLDFDDSLVGPAVQDVWMLFP-GDENLNAHARSVFLAAYREFRHFEERWLALAETLRA
V5WJH4_9SPIO          LFFLDFDDSMRAPAVQDMWMIISDSPER-QELKAGAFLEGYREFLEFPGESQKYIELLRA
B0SUI0_LEPBP          FSILDFDDFLHGPIVQDFWMLLPFGEAD-RKHEFFDFFAGYCMFADFDENWLKLIEPLRI
E1RBF1_SEDSS          LMLIDFDDMSNGPAVQDLWLLLPDRIG-ACEYQFSLLQEGYGQFSALSPGSALLIEPLRF
H9UJW3_SPIAZ          LLLIDFDDMMMGPAVQDLWLLLPERAD-NCPAEFNLIVEGYEQFQPFDYRWKGLIEPLRA
F8F2C4_TRECH          LSIIDFDDMCEGPAVQDLWLLLPGHHR-DSRRELELILEGYTEFMEFNQEELKLIEDLRF
M1NDA4_DESSD          FFLIDFDDMVMGPAIQDLWMLLPGTPR-ESLFEIDLFLEGYETFHHFDRRTLRLVEPLRA
A0A7U3YL12_DESPD      FFLIDFDDMAVGPPVQDLWMLLPGPPE-ECPVELDLLLEGYETFRSVDRASLRLIEPLRA
A9GAX6_SORC5          LRVLDFDDMVVGPAVQDLWLLLPGRDE-AARQQRELFIEGYEELRRFDRSTLGLIEPLRG
F2K2W1_MARM1          MVLLDFDDIQTGYPCQDIWLHLTAKEH--HQQQLSELIEGYESHHPFDRRSLALIDAFKL
A6VVA6_MARMS          FHLLDFDDCQNGVAVQDLWLHITQTEN--PRQQLSEIIEGYETYLPFETRELDLVDVFKC
SRKA_ECOLI            PMFVDLDDARNGPAVQDLWMLLNGDKA-EQRMQLETIIEAYEEFSEFDTAEIGLIEPLRA
Q6DB79_PECAS          PLFVDLDDARNGPAIQDLWMLLHGDRR-EQRIQLDILLEAYSEFADFQEKELALIEPLRA
J7U728_MORMO          PWLVDFDDARNGPAVQDLWMLLSGDTD-SRRYQLDILLDAYQEFCDFDTRELALIEPLRA
B4EZ69_PROMH          VVMVDFDDSRMGSAIQDFWMLLSGSKQ-DQLIQLDTLLESYNEYQDFDVRELSLIEPLRA
F7YQB5_VIBA7          PMFVDLDDARNGPAVQDLWMLLNGELQ-DKRMQLDIILESYQEFHDFNPAELKLIEPLRG
A0KQT9_AERHH          PMFVDLDDCRSGPAIQDLWMMLSGERH-EQLIQLDTLLAGYEEFMEFDPRELALIEPLRA
H2G0Y6_OCESG          PWLLDFDDCRRGPAVQDLWMMLSGSRQ-EQLVQLDTLLAGYETVREFNAAELALIEPLRA
C4LD30_TOLAT          PVLLDLDDCVMGPAIQDIWMLLSGDAR-EQRQQIYTILDGYEEFCEFDERQLSFIEPLRT
M4UBG7_9GAMM          IYLVDFDDCKMGPAIQDIWMLLHGSRQ-DKQLQLNMLLDGYQEEFDFDFSEFSLIEPLRS
Q47W24_COLP3          PHFVDLDDCRTGPAIQDLWMMLSGDRQ-QQLLQLDTLLMGYEEFFTFENDQLLLIESLRT
Q8EJX4_SHEON          PGFVDLDDARMGPAIQDLWMMLTGDRA-QQQLQLEVLLEAYEEFCEFDTRQLALIEPLRA
Q5QZD6_IDILO          LTFVDFDDCRSGPAVQDLWMMLNGSHQ-EQTLQMDALLTGYEDFCEFDTAQLILIEPLRS
D3SG44_THISK          --FVDLDDACNGPAMQDLWMFLSGEPP-EMAGQLRDLLGGYETFMRFDRRELGLINTLRT
M4NI80_9GAMM          --FVDFDDARSGPAVQDLWMLANDE------RALDAVLEGYRQFRDFDHAELALIPALRA
A0LAM7_MAGMM          --FVDFDDARMGPAIQDLWMCLSGDRE-ERAVQMNHLLDGYETFFEFDYRQLHLIEALRT
A1WYJ5_HALHL          --LVDLDDSCTGPAIQDLWMLLPGERA-ERESFLEAVLEGYRTFCDLDLRELHLIEPLRT
U5T4G0_9GAMM          --LVDLDDCRTGPAIQDLWMLLSGDRH-ERTLQLSDLIAGYEQFRAFDPRELHLLEALRT
H0PV35_9RHOO          PQFVDFDDSRMGPAVQDLWMLLSGTRE-EMSRQLGDVLAGYEDFHEFAPRELHLVEALRT
E5AN68_MYCRK          --FVDFDDSRMAPAIQDLWLLLPGERA-QASRALGHVLAGYEDFCEFDSRELHLIEAFRT
D3HN92_LEGLN          --IVDLYDCLMGPAIQDIWMLLSGEKE-QMDLQLEKILRGYCEFHDFNPRERHLIEALRT
Q12FW2_POLSJ          --FVDLDDARSGPAVQDLWMLLSGDRA-QCTRQLGALVDGYEEFREFDRRELALIEPLRT
B1XYU3_LEPCP          --FVDLDDAVTGPAVQDLWMLLGGERH-EMQTQLGALLDGYETLREFDRRELGLIEALRT
S6CGS0_9GAMM          --FVDLDDCCQGPAMQDLWMLLHGDRH-EMTGQLDALLEGYRVFRDFDLRELALIEPLRS
E1VFG6_9GAMM          --LVDFDDCQSAPAVQDLWMMLTSSRL-EQELQLAELLEGYSTFCEFDRREIALIEGLRS
C7RCL2_KANKD          PHFVDFDDSRMAPAVQDLWMLLSGERP-QKLSQIAEIIEGYEEFQKFPVKQLKLIEPLRT
Q2SQN6_HAHCH          AHFVDFDDTRMAPAIQDLWMLLSGDRP-NRTAQLVEIVEGYNEFYDFRPSELRLVEALRT
K4KJN0_SIMAS          PHLVDFDDARMGPAIQDLWMLLSGDRQ-QQHQQLAEIIEGYEMFSEFDPRELSLVEPLRT
Q21FY1_SACD2          LYFVDFDDSRMGPAIQDIWMLLSGDKT-QQQTQFGEILEGYEEFCEFNPTELPLIESFRT
Q0VSQ2_ALCBS          PHFVDLDDSLRAPAMQDIWMLLSGDND-EQQHQLRVLARGYDTFLPFPWNQTRLIEPLRL
M5DNS7_9GAMM          LHMVDFDDCIQGPAMQDIWMLLSGDRA-EQRQQLMVISEGYEMFRPFPNHELRLIESLRT
M1FET6_9ALTE          MLFVDLDDCRSGPAIQDMWLLLNGEDN-ERGAQLGEILEGYEMFRPFDRRERHLIEPLRC
E1VAL0_HALED          FGLVDFDDCLMAPAVQDIWMLLTGQEEGEWQMQLSEVIEGYEQHRDFDRSELALIEPLRA
A0A060B7A1_9GAMM      FTLVDFDDCLMAPAIQDIWMLLPVDDPSGWRAQLSEIVEGYEEEQTFPQQQLSLIEPLRA
Q6MH53_BDEBA          FFLVDFDDFVNGPVIQDFWMLLSGDED-SLDDERMQIIQGYEELREFPDHQWSWIPMLRG
M4VMV6_9PROT          FVVVDFDDMINGPAVQDFWMLMPSTEI-DSP-EFQGLIDSYSELREFPYEQLSLIPLLRG
E1X502_HALMS          FHLIDLDDMVMGPEVQDIWLSIPGVDQ-YALQDRAILLEAYESMRPFPREQLKLIESLRT
                        .:*: *   .   **.*:                .   *     .          :: 

Q8F359_LEPIN          MRFVHYSAWIANRFHSDPSFPTAFPHFSGTDYWEKETLELKEQYNLIRNLS---------
I4B7K1_TURPD          MRIIHYSGWIARRYD-DPSFTSAFPDFASDSYWQEEIGILRDICASMGDS----------
V5WJH4_9SPIO          LRYVAYNGWIAARRE-DPAIRRAFPDFGSGEYWDGFIQDLEDQCRMLSSRIPLTADTETA
B0SUI0_LEPBP          IRFIHYAAWIGKRWE-DPSFPSLFPHFGTEEYWLKETLDLENANRDLDEAN---------
E1RBF1_SEDSS          MRMLHYLAWTAHQQC-DHDFSLRHPQWGSEAFWIRELADFEEQFDYIRKIL---------
H9UJW3_SPIAZ          MRMLYYLAWAARQRN-DLRFRREHPDWGTPAFWIKEIEDLREQLPYCE------------
F8F2C4_TRECH          FRMIHFLHWQSQQRF-DRAFYQHFPDWGNHAFWIKCIEDLQDQLLEMGG-----------
M1NDA4_DESSD          MRFLHYIAWLTHQFI-ADGATPIFPEFGSSEYWHTEIADLEDQLKRIRKSD---------
A0A7U3YL12_DESPD      MRFVHYSAWCARQVL-DDGATSVIPDFGSRGYWQREIADLHDQLARIREGQ---------
A9GAX6_SORC5          LRMIHYAAWIARRWH-DPIFPRTFPHCGTEAYWREEASSLEEVLQLTRDGD---------
F2K2W1_MARM1          ERTVRYAAWLSQRWN-DPAFPKAFPWFGTQDYWLGLRKELIDLKAQWRNDT---------
A6VVA6_MARMS          VRVISYTAWLQSRWH-DPAFTKAFAWFGSEDYWINHLNELKNCELEWGKIS---------
SRKA_ECOLI            MRLVYYLAWLMRRWA-DPAFPKNFPWLTGEDYWLRQTATFIEQAKVLQEPP---------
Q6DB79_PECAS          MRQVYYLAWIARRWE-DPAFPKNFPWMTDADFWLKQTAIFIGQNQLLQEPP---------
J7U728_MORMO          MRMVHFLSWVARRWQ-DPAFPRAFPWMAEGDFWSQQQSLMTEQTAVLAEPP---------
B4EZ69_PROMH          MRMVHYIAWVLKRWK-DPAFPRTFVWFQEQDFWFKQLALFKGQVEQLNEPP---------
F7YQB5_VIBA7          LRMVYYMAWLAKRWQ-DPAFPLAFPWFNDPKYWESQVLAFKEQIAALDEPT---------
A0KQT9_AERHH          MRIVHYMAWLARRWE-DPAFPRHFPWFNTDHYWRQQIATLHDQLEALKAPP---------
H2G0Y6_OCESG          TRMVNYMAWLAARWD-DPAFPAAFPWFNSEDYWQQQIRALTEQAQSLSAPP---------
C4LD30_TOLAT          LRMLNYLVWLHRRWQ-DPAFPQAFPWFNHSDYWHNQFRALTEQAKLLDRPV---------
M4UBG7_9GAMM          MRIIHYVSWINKRWK-DPSFVVNFPWFKTDQYWKDLLQSLQQQLINMQAPA---------
Q47W24_COLP3          MRVVNYMAWLCKRWH-DPAFPQNFPWFNTEKYWEQQILMLKEQMSALQQPP---------
Q8EJX4_SHEON          LRMVHYNAWIGRRWQ-DPAFPMHFPWFGDEKYWEQQILAFKEQLAALDEPP---------
Q5QZD6_IDILO          FRIIQYMAWLSRRWQ-DSAFQRAFPWFAESRYWEQQILALKEQLAGLDEAP---------
D3SG44_THISK          LRILRHAAWLARRAD-DPAFIDGFPVFYTPRYWEEHILTLREQAAALDEPA---------
M4NI80_9GAMM          MRQLHYAGWIAARWH-DPAFPAAFPFAAEPRWWEQHVADLHELADALE------------
A0LAM7_MAGMM          LRMIHYAAWIARRWA-DPAFPRAFPWFDGPRYWDEHILALREQSALMDEQP---------
A1WYJ5_HALHL          LRLVRHAAWLAERWE-DPAFPRAFPWFAEPRYWEEHLLALREQLGALAEPP---------
U5T4G0_9GAMM          LRIMHYAAWLARRWD-DPAFPATFTWFGTERYWDDHVLTLREQVAAMQAPV---------
H0PV35_9RHOO          LRLIHYSGWIARRWE-DPAFPAAFPWFNTQRYWQDRILEMREQIALMDEPP---------
E5AN68_MYCRK          LRLIHYAAWLARRWD-DPAFPAAFPWFNTHRYWEDRILELREQVGALQEPP---------
D3HN92_LEGLN          LRMLHFSGWLAKRWT-DPAFPLSFPWFNTPVYWQNQIVNLNEQIELLDQIE---------
Q12FW2_POLSJ          LRLVHYSAWLAQRWH-DPIFPINFPWFGSSDYWKGQVDMLEEQTEAMQETP---------
B1XYU3_LEPCP          LRIINHSAWIARRWR-DPAFPIAFPSFESPSYWAQQTTVLHEQIGAMQGPA---------
S6CGS0_9GAMM          LRLIHYTGWLCRRWD-DPAFPRAFPWLAEANWWEGHLNDLEQQGLRMAEPP---------
E1VFG6_9GAMM          LRMVHYAGWLASRWH-DPAFPRHFPWFNTQQYWQQHLAELELQCLQLDEEP---------
C7RCL2_KANKD          LRMFYHSAWLAKRWS-DPAFQQAFPWFDSIRYWEEQILDLRSQFAELQEPA---------
Q2SQN6_HAHCH          LRMLNYCAWLASRWS-DPAFPRNFPWFNSARYWGDHILELREQLAALNEEP---------
K4KJN0_SIMAS          LRMMHYAAWLARRWQ-DPAFPKAFSWFNTERYWAEHILELREQMSALDEPP---------
Q21FY1_SACD2          LRLMHYAAWLARRWE-DPAFPQAFPWFNSERYWAEHIQELREQLFGLDEPA---------
Q0VSQ2_ALCBS          RRIINYDAWLAKRWD-DPAFPPAFPWFESMNYWGNQVTLLQQQLQDLP------------
M5DNS7_9GAMM          VRIVRYAAWLSQRWD-DPAFPIAFPWFEGHRFWSEHLLSLREQLAALQEEP---------
M1FET6_9ALTE          YRQVSHCAWLAKRWD-DPAFPRFFPWFGQPRFWSDQILSLREQLSALQAPS---------
E1VAL0_HALED          FRLIRHSAWLVARWE-DPAFPVAFPWLADAGYWDDHIRQLEQQRRVLDAAV---------
A0A060B7A1_9GAMM      YRLIRYTAWLVSRWD-DPAFPRAFPWLAESGYWDQHIRQLEQQLLQLEKPI---------
Q6MH53_BDEBA          LRIIMYAGWIAKRWT-DPSFPRLFPEYNKYTYWAEEVEALEKIAWKIG------------
M4VMV6_9PROT          YRIITYAMWIMNRWS-DPSFPRLFPEYGSYLYWAEETESLEKLK----------------
E1X502_HALMS          LRFIHFSAWISKRWE-DPAFKLHFPQFAEHHYWEIQIQDLRSQLELINNSLNNQYLY---
                       * . .  *   :                  :*      :                    

Q8F359_LEPIN          --GKKSFFSVTESVSEDKELTNRDFFWDLED--------
I4B7K1_TURPD          -------YPIADTG---EALSNKDFFFDYED--------
V5WJH4_9SPIO          GHSQRLARQMREEQETIDQLEDGDYFFDLDEGRWSPGDD
B0SUI0_LEPBP          ------PSPSASKENIEPEMTNKDFFWDWEN--------
E1RBF1_SEDSS          -------DSSYTG--------------------------
H9UJW3_SPIAZ          ---------------------------------------
F8F2C4_TRECH          ---------------------------------------
M1NDA4_DESSD          -------GETGNMT-------------------------
A0A7U3YL12_DESPD      -------HPSGNAP-------------------------
A9GAX6_SORC5          -------TGGPGGGADEPPPSGGKYFWDLN---------
F2K2W1_MARM1          -------E-------------------------------
A6VVA6_MARMS          -------R-------------------------------
SRKA_ECOLI            -------LQLTPMY-------------------------
Q6DB79_PECAS          -------LQLMPMY-------------------------
J7U728_MORMO          -------LTRFLPY-------------------------
B4EZ69_PROMH          -------LQLSPMY-------------------------
F7YQB5_VIBA7          -------LSLMPQW-------------------------
A0KQT9_AERHH          -------LTLTPGW-------------------------
H2G0Y6_OCESG          -------LSLTSWS-------------------------
C4LD30_TOLAT          -------PVTSYNC-------------------------
M4UBG7_9GAMM          -------LSLQPDYQQPY---------------------
Q47W24_COLP3          -------LSLNNF--------------------------
Q8EJX4_SHEON          -------LSLIPY--------------------------
Q5QZD6_IDILO          -------LNLGFNG-------------------------
D3SG44_THISK          -------LELDSPGAVARGYWDL----------------
M4NI80_9GAMM          ---------------------------------------
A0LAM7_MAGMM          -------LSLLVS--------------------------
A1WYJ5_HALHL          -------LSAQ----------------------------
U5T4G0_9GAMM          -------LSV-----------------------------
H0PV35_9RHOO          -------LWSI----------------------------
E5AN68_MYCRK          -------LWPV----------------------------
D3HN92_LEGLN          -------C-------------------------------
Q12FW2_POLSJ          -------LMI-----------------------------
B1XYU3_LEPCP          -------LVA-----------------------------
S6CGS0_9GAMM          -------LQLY----------------------------
E1VFG6_9GAMM          -------LRCLG---------------------------
C7RCL2_KANKD          -------LELLNV--------------------------
Q2SQN6_HAHCH          -------LRLPSYQVR-----------------------
K4KJN0_SIMAS          -------LRLQ----------------------------
Q21FY1_SACD2          -------LKLPSAI-------------------------
Q0VSQ2_ALCBS          ---------------------------------------
M5DNS7_9GAMM          -------LSISVY--------------------------
M1FET6_9ALTE          -------ISLPGQY-------------------------
E1VAL0_HALED          -------SGQA----------------------------
A0A060B7A1_9GAMM      -------WLA-----------------------------
Q6MH53_BDEBA          ---------------------------------------
M4VMV6_9PROT          ---------------------------------------
E1X502_HALMS          ---------------------------------------