CLUSTAL format seed alignment for MF_01502

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y1323_BACSK      --MKLKYTNKINKIRTFALSLVFVGILIMYVGIFFKEHPVIMVIAMILGFLAVIASTVVY
Y906_OCEIH       MSQQLTYSSKINKIRTFALILVFAGIITMYGGILTKNIEWLMVIFFILGTLMVILSCAVY
Y883_BACVZ       ---MAKYSSKINKIRTFALSLVFVGFIIMYIGLFFKQSVLLASLFMILGLLSIGLSTAVY
YGZB_BACSU       ---MAKYSSKINKIRTFALSLVFVGFIIMYIGIFFKESVLLSSLFMILGLLSIGLSTVVY
Y828_BACP2       ---MAKYSSKINKIRTFALSLVFVGFLIMYIGVFFKESIWLSTFFMLLGVLSIGLSTVVY
Y901_BACLD       ---MAKYSSKINKIRTFALSLVFIGFIIMYVGVFFRSSVLLMSVFMILGVLSILLSTAVY
Y336_LYSSC       ---MKPYKSKINKIRSFALALIFIGFIVMYGGIFFKNSPILVLIFMTLGVLCIIGSTVVY
Y445_BACCZ       --MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVY
Y449_BACHK       --MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVY
Y538_BACAN       --MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVY
Y593_BACC1       --MGIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVY
Y520_BACCR       --MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVY
Y454_BACMK       --MGIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVY
Y460_BACCN       --MGIKYSNKINKIRTFALSLVFIGLLIAYLGVFFRENIIIMTTFMMLGFLAVLASTFVY
Y479_GEOKA       --MSIKYSSKINKIRTFALSLIFIGVIVMYLGLFFRTSPVIMTLFMLFGMLFLVASGIVY
Y491_GEOTN       --MGIKYSSKINKIRTFALSLIFVGVIVMYLGLFFRTSPIIMTLFMVLGLLFLVASGIVY
Y952_BACHD       --MGIKYSNKINKIRTFALSLVFLGILVMYIGIFFRTHEVIMVLAMILGFLCIIASTAVY
Y660_EXIS2       --MKKQRKNKINRARNLAMFLVFGGMLVMYGGLLLKQFEIIMVILMLVGFVMVLASTALY
                        ..***: *.:*: *:* *.:  * *:: :    :    : .* : :  *  :*

Y1323_BACSK      FFIGLLSTRAVPVICPSCEKQTKVLGRVDACMHCDQPLTMDRSLEGKEFDEAYNSPASKK
Y906_OCEIH       VWIGTLSLRAVPVICPSCEKPTKMLGRVDACMHCKQPLTMDKNLEGIEFDEKYNSRKYKK
Y883_BACVZ       FWIGMLSTKAVRVMCPACEKETKILGRVDMCMHCREPLTLDKGLEGKAFDESYNRKNSVK
YGZB_BACSU       FWIGMLSTKAVRVICPGCDKETKVLGVVDMCMHCREPLTLDKGLEGKEFDESYNKKKMSK
Y828_BACP2       FWIGMLSTKAVRVVCPGCEKETKVLGRVDMCMHCREPLTLDPGLEGKEFDESYNRKKS--
Y901_BACLD       FWIGMLSTKAVQVVCPNCEKPTKILGRVDMCMHCREPLTLDKNLEGKEFNESYNRKSQ--
Y336_LYSSC       AWIGLLSTRAIQVECPNCHKHTKVLGRVDMCMYCNEPLTLDPTLEGKEFDQSYNHKTKKS
Y445_BACCZ       FWIGMLSTKTVQIICPSCDKPTKMLGRVDACMHCNQPLTMDRNLEGKEFDEKYNKKSYKA
Y449_BACHK       FWIGMLSTKTVQIICPSCDKPTKMLGRVDACMHCNQPLTMDRNLEGKEFDEKYNKKSYKS
Y538_BACAN       FWIGMLSTKTVQIICPSCDKPTKMLGRVDACMHCNQPLTMDRDLEGKEFDEKYNKKSYKS
Y593_BACC1       FWIGMLSTKTVQIICPSCDKPTKMLGRVDACMHCNQPLTMDRNLEGKEFDEKYNKKSYKS
Y520_BACCR       FWIGMLSTKTIQIICPSCDKPTKMLGRVDACMHCNQPLTLDRDLEGKEFDEKYNKKSYKS
Y454_BACMK       FWIGMLSTKTIQIICPSCDKPTKMLGRVDACMHCNQPLTLDRNLEGKEFDEKYNKKSYKS
Y460_BACCN       FWIGMLSTKTVQIVCPSCNKPTKMLGRVDVCMHCNQPLTLDSNLEGKEFDEKYNKKTIKH
Y479_GEOKA       FWIGTLSTRAVQVVCPSCGKVTKMLGRVDLCMFCREPLTLDRELEGKEFDEKYNKK-RKS
Y491_GEOTN       FWIGTLSTRAVQVVCPSCGKVTKMLGRVDLCMFCREPLTLDRELEGKEFDEKYNKK-RKN
Y952_BACHD       FWIGMISTRAIPVVCPECGKPTKVLGRVDACMHCDQPLTLDRSLEGKEFDEKYNLKGKKR
Y660_EXIS2       FLIGLTSTKAAVVTCPNCGKETKVLGRVDLCMHCDEPLTMDRNLEGKEFDEKYNKHSKRA
                   **  * ::  : ** * * **:** ** **.* :***:*  ***  *:: **      

Y1323_BACSK      SQT--
Y906_OCEIH       K----
Y883_BACVZ       -----
YGZB_BACSU       -----
Y828_BACP2       -----
Y901_BACLD       -----
Y336_LYSSC       -----
Y445_BACCZ       -----
Y449_BACHK       -----
Y538_BACAN       -----
Y593_BACC1       -----
Y520_BACCR       -----
Y454_BACMK       -----
Y460_BACCN       TNIYK
Y479_GEOKA       -----
Y491_GEOTN       -----
Y952_BACHD       VDG--
Y660_EXIS2       PR---