CLUSTAL format seed alignment for MF_01503

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y3870_BACCR      -----------MAMRFLNIGYGNIVSAHRIIAIVSPESAPIKRTVQEAREHNALLDATYG
Y3503_BACAH      -----------MAMRFLNIGYGNIVSAHRIIAIVSPESAPIKRTVQEAREHNALLDATYG
Y3613_BACHK      -----------MAMRFLNIGYGNIVSAHRIIAIVSPESAPIKRTVQEAREHNALLDATYG
Y3695_BACMK      -----------MAMRFLNIGYGNIVSAHRIIAIVSPESAPIKRTVQEAREHNALLDATYG
Y3886_BACC0      -----------MAMRFLNIGYGNIVSAHRIIAIVSPESAPIKRTVQEAREHNALLDATYG
Y3915_BACC1      -----------MAMRFLNIGYGNIVSAHRIIAIVSPESAPIKRTVQEAREHNALLDATYG
Y3971_BACC4      -----------MAMRFLNIGYGNIVSAHRIIAIVSPESAPIKRTVQEAREHNALLDATYG
Y1272_BACC2      -----------MAMRFLNIGYGNIVSAHRIIAIVSPESAPIKRTVQEAREHNALLDATYG
Y3631_BACCZ      -----------MAMRFLNIGYGNIVSAHRIIAIVSPESAPIKRTVQEAREHNALLDATYG
Y2524_BACCN      -----------MAMRFLNIGYGNIVSAHRIIAIVSPESAPIKRTVQEAREHNALLDATYG
Y4010_BACAN      -----------MAMRFLNIGYGNIVSAHRIIAIVSPESAPIKRTVQEAREHNALLDATYG
Y3920_BACC7      -----------MAMRFLNIGYGNIVSAHRIIAIVSPESAPIKRTVQEAREHNALLDATYG
Y656_FINM2       -------------MESLGIGFSNLVNSNRIIAIVSPETNPIKRIVQKAKEDNNLIDVTFG
Y105_NOSS1       -----------MEIQLINIGFGNIVSANRVVAIVSPESAPIKRIITDARDKNQLIDATYG
Y1474_TRIV2      -----------MEIQLINIGFGNIVSANRVVAIVSPESAPIKRIITDARDKNQLIDATYG
Y3866_NOSP7      -----------MEIQLINIGFGNIVSANRVVAIVSPESAPIKRIITDARDRGQLIDATYG
Y3427_GLOC7      -----------MDIQLINIGFGNIVSANRVIAIVSPESAPIKRIISDARERGQLIDATYG
Y1184_MICAN      -----------MDIQLINIGFGNIVSANRVIAIVSPESAPIKRIISDARDKGCLIDATYG
Y4590_CROS5      ----------MENIQLINIGFGNIVSANRVIAIVSPESAPIKRIITDARERGQLIDATYG
Y196_RIPO1       ----------MESIQLINIGFGNIVSANRVIAIVSPESAPIKRIITDARDRGQLVDATYG
Y1845_SYNP2      -----------MEIQLINIGFGNIVSANRVIAIVSPESAPIKRIISDARDRGQLIDATYG
Y2874_SYNY3      -----------MEIQLINIGFGNIVSGNRVVAIVSPESAPIKRIISDAKERSQLIDATYG
Y055_SYNJB       -----------MDTRLINIGFGNIVAAGRVVAIVSPESAPIKRIISDARERGQLIDATYG
Y2696_SYNJA      -----------MDTRLINIGFGNIVAAGRVIAIVSPESAPIKRIISDARERGQLVDATYG
Y2835_TRIEI      -----------MDTQFINIGFGNIVSANRVVTIVSPESAPIKRIINDGRERGQLIDATYG
Y5498_ACAM1      -----------MDIKLINIGFGNIVSGNRVISIVSPESAPIKRIISEARDRAQLIDATYG
Y1550_BACVZ      -----------MTIKLINIGFGNIISANRMISIVSPESAPIKRMIQDARDRGMLIDATYG
REMA_BACSU       -----------MTIKLINIGFGNIISANRMISIVSPESAPIKRMIQDARDRGMLIDATYG
Y1788_BACLD      -----------MTIKLINIGFGNIISANRLISIVSPESAPIKRMIQDARDRGMLIDATYG
Y1466_BACP2      -----------MTIKLINIGFGNIISANRMISIVSPESAPIKRMIQDARDRGMLIDATYG
Y2323_BACSK      -----------MTIKLINIGFGNIVSANRIISIVSPESAPIKRIMQEARDRNMLIDATYG
Y2513_BACHD      -----------MNIKLINIGFGNIVSANRIISIVSPESAPIKRIIQEARDRNMLIDATYG
Y1489_CARHZ      -----------MEIKFINIGFGNIVSANRIISIVSPESAPIKRIISEARDKGMLIDATYG
Y2730_DESHY      -----------MDIKLINIGFGNIVSANRIISIVSPESAPIKRIIQEARDAGMLIDATYG
Y1699_DESRM      -----------MDIKLINIGFGNIVSANRIIAIVSPESAPIKRIITEARDRGMLIDATYG
Y1796_PELTS      -----------MEIKLINIGFGNIVSANRIIAIVSPESAPIKRIITEARDRGMLIDATYG
Y1598_DESAP      -----------MEIRLINIGFGNIVSANRIVAIVSPESAPIKRMITEARDRGMLIDATYG
Y2058_HELMI      -----------MDIKLINIGFGNIVSASRIVAIVSPESAPIKRIIQEARDRGMLIDATYG
Y891_MOOTA       -----------MDIKLINIGFGNIVSARRIVAIVSPESAPIKRIIQEARDRGMLIDATYG
Y2791_ALKMQ      -----------MNIKLINIGFGNIVSASRIVAIVSPESAPIKRIIQEARERGMLIDATYG
Y1422_ALKOO      -----------MGIKLINIGFGNIVSANRIVAIVSPESAPIKRVIQEARERGVLIDATYG
Y1238_SYNWW      -----------MDIKLVNIGFGNIVAANRIVAIVSPESAPIKRIIQEAREKGILIDATYG
Y1328_NATTJ      -----------MSIKLVNIGFGNIVSANRIVAIVSPESAPIKRIVTEGRDRGMLIDATYG
Y1338_SYMTH      ----------MGEIRLVNIGFGNIVSANRIVAIVSPESAPIKRIISEARERGTLIDATYG
Y1161_CLOBA      -----------MGIKLINIGFGNIVSANRLVAIVSPESAPIKRIIQEARDRGMLIDATYG
Y1210_CLOBB      -----------MGIKLINIGFGNIVSANRLVAIVSPESAPIKRIIQEARDRGMLIDATYG
Y1749_CLOPE      -----------MSIKLINIGFGNIVSANRLVAIVSPESAPIKRIIQEARDRGMLIDATYG
Y2002_CLOP1      -----------MSIKLINIGFGNIVSANRLVAIVSPESAPIKRIIQEARDRGMLIDATYG
Y1720_CLOPS      -----------MSIKLINIGFGNIVSANRLVAIVSPESAPIKRIIQEARDRGMLIDATYG
Y1717_CLOAB      -----------MDIKLINIGFGNIVSANRLVAIVSPESAPIKRIIQEARDRGMLIDATYG
Y1140_CLOB8      -----------MGIKLINIGFGNIVSANRLVAIVSPESAPIKRIIQEARDRGMLIDATYG
Y2250_CLONN      -----------MSIKLINIGFGNIVSANRLVAIVSPESAPIKRIIQEARDRGMLIDATYG
Y1325_THEP3      -----------MSIKLINIGFGNIISANRLVAIVSPESAPIKRIIQEAKNRGMLIDATYG
Y1762_THEPX      -----------MSIKLINIGFGNIISANRLVAIVSPESAPIKRIIQEAKNRGMLIDATYG
Y1316_HUNT2      -------------MKLINIGFGNIVSANRLVAIVSPESAPIKRIIQEARERGMLVDATYG
Y2514_CLOBH      -----------MAIKLINIGFGNIVSANRLVAIVSPESAPIKRIIQEARDRGMLIDATYG
Y2576_CLOBL      -----------MAIKLINIGFGNIVSANRLVAIVSPESAPIKRIIQEARDRGMLIDATYG
Y2388_CLOB1      -----------MAIKLINIGFGNIVSANRLVAIVSPESAPIKRIIQEARDRGMLIDATYG
Y1897_CLOBM      -----------MAIKLINIGFGNIVSANRLVAIVSPESAPIKRIIQEARDRGMLIDATYG
Y2122_CLOBK      -----------MAIKLINIGFGNIVSANRLVAIVSPESAPIKRIIQEARDRGMLIDATYG
Y1364_CLOK5      -----------MGIKLINIGFGNIVSANRLIAIVSPESAPIKRIIQEARDRGMLIDATYG
Y2087_CALS8      -------MSNSGNIKLINIGFGNIVSANRLIAIVSPDSAPIKRIIQEARERGMLIDATYG
Y1501_OCEIH      -----------MNLSLINIGFGNVVSANRIISIVSPESAPIKRIITVARDNNKLVDATYG
Y1166_GEOKA      -----------MMMKFINIGYGNMVSAARIITIVSPDSAPIKRIIQDARESGKLVDATHG
Y1019_GEOTN      -----------MMMKFINIGYGNMVSAARIITIVSPDSAPIKRIIQDAREKGKLVDATHG
Y899_DESVH       ------MTMQGN--KLVNLGFGNFVVASRVVSIVDPDSSPMRRLREDARDQGRLIDVTQG
Y2085_DESVV      ------MTMQGN--KLVNLGFGNFVVASRVVSIVDPDSSPMRRLREDARDQGRLIDVTQG
Y1139_DESVM      ------MQQKSSSQKLINVGFGNFVVASRVVAIVNPSSSPMRRLREDARQEGRLVDATQG
Y2720_DESAG      --------MQKQ--RLLNVGFGNFVVAERVVSIVNPASAPMRRLREEARDQGRLVDATQG
Y2861_DESPS      MVTEWKNFFKGCCMQLLNVGFGNTVMVGRVVAVVNTGSSPARKIREIAKKNGKLIDVTEG
Y1931_DESAL      ---------------MLNIGFGNRVAAHRVVAIVTPNTSPMKRLKDEAKKAGRLVDATCG
Y1911_DESOH      ----------MHRKNLLNIGFGNRIVAEDIIAVVSPASAPVKRMKDEAKKAGRLVDATQG
Y405_THEYD       --------------MLVNIGFGNIVSLSRIIAVVNPGSSPMKRMKDEARKRGKLIDATEG
Y332_THEAB       ------------MFGLINIGFGNVIAGDRIVAIVNPESAPLKRLKEDAKEEGKLIDATYG
Y100_THEM4       ------------MFGLINIGFGNVIAGDRIVAIVNPESAPLKRLKEDAKEEGKLIDATYG
Y1678_FERNB      ------------MFGLINIGFGNVIAGDRVIAIVNPESAPLKRLKEDAKEEGKLIDATYG
Y1629_PSELT      ------------MYGLINIGFGNVISGDRVIAIVNPESAPLKRLKDEAKDEGKLIDATYG
Y1690_THEMA      ------------MYGLINIGFGNVVAGDRVIAIVNPESSPLKRMKDEAKLEGKLIDATYG
Y986_THEP1       ------------MYGLINIGFGNVVAGDRVIAIVNPESSPLKRMKDEAKLEGKLIDATYG
Y1144_THESQ      ------------MYGLINIGFGNVVAGDRVIAIVNPESSPLKRMKDEAKLEGKLIDATYG
Y099_PETMO       ------------MYGLINIGFGNIVVGDRVIAIVSPTSQPLKRLKEIAEQQGKLLEVNHG
Y3631_SYNFM      -----------MEVKLLNIGFGNTVIANRVIAIVSPASAPMKRLKEDARQANKLIDATMG
Y036_DEHM1       -----------MFIELVHIGFGNILAMNRVIAISPPSSAPIKRIIQESRTKGFLIDMTNG
Y033_DEHMB       -----------MFIELVHIGFGNILAMNRVIAISPPSSAPIKRIIQESRTKGFLIDMTNG
Y043_DEHMC       -----------MFIELVHIGFGNILAMNRVIAISPPSSAPIKRIIQESRTKGFLIDMTNG
Y1027_SYNE7      -----------MAQALLNAGFGNFVAADRLIAIVSPDSAPIRRTVSEARERGQLVDVTCG
Y519_SYNP6       -----------MAQALLNAGFGNFVAADRLIAIVSPDSAPIRRTVSEARERGQLVDVTCG
Y2331_THEEB      ---------------MLNIGFGNYISPQRLLAIVSPDSAPIKRLILEAREHHHLIDATHG
Y1186_COPPD      -----------MESGFLNIGFSSYISVSKIIGIVSPDSAPIRRMIRLAKEQGRLVDATFG
Y2880_LACP7      ------------MNKLINIGFGNVVNAGKIISVIRPEAAPVKRMVQNAKDSGSCVDATCG
Y916_LEPBA       ----------MSSFPVLNVGFSNVVFVSKILTILLADSAGAKRLRTEAKSENRLIDATCG
Y950_LEPBP       ----------MSSFPVLNVGFSNVVFVSKILTILLADSAGAKRLRTEAKSENRLIDATCG
Y1616_LEPBJ      ----------MSQFSVLNVGFGNIVLVSKIVSIIHSDSASAKRIRNEAKSNNSLIDATQG
Y1834_LEPBL      ----------MSQFSVLNVGFGNIVLVSKIVSIIHSDSASAKRIRNEAKSNNSLIDATQG
Y2599_LEPIN      ----------MSQFSVLNVGFGNIVLVSKIVSIIHSDSASAKRIRNEAKSNNSLIDATQG
Y1384_LEPIC      ----------MSQFSVLNVGFGNIVLVSKIVSIIHSDSASAKRIRNEAKSNNSLIDATQG
Y1339_DICT6      -------------MKLVNIGFGNMVVSSRIVAIISPDSAPIKRFLSDAKTRNELIDATYG
Y1444_DICTD      -------------MKLINIGFGNMVVSSRIVAIISPDSAPIKRFLSDAKTRNELIDATYG
                                 :  *:.. :    :: :  . :   ::    ..     :: . *

Y3870_BACCR      RKTRAVIVMDDGHVVLSPIQPETIAHRLNNKEDL-----SEEGWVLHIYEK-----
Y3503_BACAH      RKTRAVIVMDDGHVVLSPIQPETIAHRLNNKEDL-----SEEG-------------
Y3613_BACHK      RKTRAVIVMDDGHVVLSPIQPETIAHRLNNKEDL-----SEEG-------------
Y3695_BACMK      RKTRAVIVMDDGHVVLSPIQPETIAHRLNNKEDL-----SEEG-------------
Y3886_BACC0      RKTRAVIVMDDGHVVLSPIQPETIAHRLNNKEDL-----SEEG-------------
Y3915_BACC1      RKTRAVIVMDDGHVVLSPIQPETIAHRLNNKEDL-----SEEG-------------
Y3971_BACC4      RKTRAVIVMDDGHVVLSPIQPETIAHRLNNKEDL-----SEEG-------------
Y1272_BACC2      RKTRAVIVMDDGHVVLSPIQPETIAHRLNNKEDL-----SEEG-------------
Y3631_BACCZ      RKTRAVIVMDDGHVVLSPIQPETIAHRLNNKEDL-----SEEG-------------
Y2524_BACCN      RKTRAVIVMDDGHVVLSPIQPETIAHRLNNKEDL-----SEEG-------------
Y4010_BACAN      RKTRAVIVMDDGHVVLSPIQPETIAHRLNNKEDL-----SEEG-------------
Y3920_BACC7      RKTRAVIVMDDGHVVLSPIQPETIAHRLNNKEEL-----SEEG-------------
Y656_FINM2       RKTRSVIIMDSSHVVLSCLQPETLQMRLD-KSNN-----KED--------------
Y105_NOSS1       RRTRAVIITDSSHVILSAIQPETVANRFVISREH---QSVEN--------------
Y1474_TRIV2      RRTRAVIITDSSHVILSAIQPETVANRFVISREH---QSVEN--------------
Y3866_NOSP7      RRTRAVIITDSSHVILSAIQPETVANRFVISRDH---QTVDN--------------
Y3427_GLOC7      RRTRAVIITDSSHVVLSAIQPETVAHRFVVNKE----VQANSN-------------
Y1184_MICAN      RRTRAVIITDSSHVVLSAIQPETVAHRFVVNKE----APVNSSN------------
Y4590_CROS5      RRTRAVIITDSSHVVLSAIQPETVAHRFVVNKET---ATINSN-------------
Y196_RIPO1       RRTRAVIITDSSHVVLSAIQPETVAHRFVVSKE----AHANSN-------------
Y1845_SYNP2      RRTRAVIITDSSHVVLSAIQPETVAHRFVVQKDP---AMAMTKV------------
Y2874_SYNY3      RRTRAVIIMDSNQVILSAIQPETVANRFVVDKDF---KENAKK-------------
Y055_SYNJB       RRTRAVIITDSGHVILSAIQPETVANRFLTAKPG---LSEETE-------------
Y2696_SYNJA      RRTRAVIITDSGHVILSAIQPETVANRFLTAKVG---APEEPE-------------
Y2835_TRIEI      RRTRAVIITDSNHVILSSIQPETVANRFLFNKDD----------------------
Y5498_ACAM1      RRTRAVIVTDSGHVVLSAIQPETVAHRFMSNKDT---KDSDK--------------
Y1550_BACVZ      RRTRAVVVMDSDHIILSAVQPETVAHRLSVKE-----EIMDEGQG-----------
REMA_BACSU       RRTRAVVVMDSDHIILSAVQPETVAHRLSVKE-----EIMDEGQG-----------
Y1788_BACLD      RRTRAVVIMDSDHIILSAVQPETVAQRLSVKE-----EIMDEGQG-----------
Y1466_BACP2      RRTRAVVIMDSDHVILSAVQPETVAQRLSVKE-----EIIDEGQG-----------
Y2323_BACSK      RRTRAVIVTDSDHVILSAVQPETVAQRLHTKE-----DGVEDA-------------
Y2513_BACHD      RRTRAVIIADSDHVILSAVQPETVAQRLTSKD-----DLEGEA-------------
Y1489_CARHZ      RRTRAVIIMDSDHVILSAVQPETVAHRLNTKE-----NQEENF-------------
Y2730_DESHY      RRTRAVIICDSHHVILSAVQPETVAHRLSAKEA---SNTAEDPAD-----------
Y1699_DESRM      RRTRAVIITDSDHVILSAVQPETVANRLVSKEA----AQVDEPTD-----------
Y1796_PELTS      RRTRAVIITDSDHVILSAVQPETVAHRLVSKEA---PAQAEESAD-----------
Y1598_DESAP      RRTRAVIITDSDHVILSAVQPETVAHRLVSKME---QAHHHHHGDNGKD-------
Y2058_HELMI      RRTRAVIITDSDHVILSAVQPETVAHRLSAKES---VHHGDEATE-----------
Y891_MOOTA       RRTRAVIITDSDHIILSAVQPETVAHRLSSREP---LASAEEPVD-----------
Y2791_ALKMQ      RRTRAVIVTDSDHIILSAVQPETVAHRLNSKDA---NKEVEASAEIE---------
Y1422_ALKOO      RRTRAVIVTDSDHIILSAVQPETVAHRLNSKDN---SKEIESVVDGE---------
Y1238_SYNWW      RRTRAVIIADSAHVILSAVQPETVANRLSSKDV---NEES----------------
Y1328_NATTJ      RRTRAVVITDSDHVILSAVQPETVKQRLHTD-----SSEDDEEIN-----------
Y1338_SYMTH      RRTRAVVITDSDHVVLSAVQPETVAHRLTARDASLAAAEEEEGEE-----------
Y1161_CLOBA      RRTRAVIITDSDHVILSAVQPETVAHRLSTKEE-----VVDEVDE-----------
Y1210_CLOBB      RRTRAVIITDSDHVILSAVQPETVAHRLSTKDE-----VVDEVDE-----------
Y1749_CLOPE      RRTRAVIITDSDHVILSAVQPETVAHRLSTKEE-----VVVEDDE-----------
Y2002_CLOP1      RRTRAVIITDSDHVILSAVQPETVAHRLSTKEE-----VVVEDDE-----------
Y1720_CLOPS      RRTRAVIITDSDHVILSAVQPETVAHRLSTKEE-----VVVEDDE-----------
Y1717_CLOAB      RRTRAVIITDSDHVILSAVQPETVAHRLSTKDDG--TNTVDEVEE-----------
Y1140_CLOB8      RRTRAVIITDSDHVILSAVQPETVAHRLSTKDD----MAVDEDDE-----------
Y2250_CLONN      RRTRAVIITDSDHVILSAVQPETVAHRLSSKDE----VNIDEVDE-----------
Y1325_THEP3      RRTRAVIITDSDHIILSAVQPETVANRLNSNKEI--LEDTLEEDEEEEEE------
Y1762_THEPX      RRTRAVIITDSDHIILSAVQPETVANRLNSNKEI--LEDTLEEDEEEEE-------
Y1316_HUNT2      RRTRAVIITDSDHIILSAVQPETVAHRLNTKE----AEDVEVDDEEEIDE------
Y2514_CLOBH      RRTRAVIITDSDHVILSAVQPETVAHRLASKAE---EEDINEGEE-----------
Y2576_CLOBL      RRTRAVIITDSDHVILSAVQPETVAHRLASKAE---EEDINEGEE-----------
Y2388_CLOB1      RRTRAVIITDSDHVILSAVQPETVAHRLASKAE---EEDINEGEE-----------
Y1897_CLOBM      RRTRAVIITDSDHVILSAVQPETVAHRLASKAE---EEDINEGEE-----------
Y2122_CLOBK      RRTRAVIITDSDHVILSAVQPETVAHRLASKAE---EEDINEGEE-----------
Y1364_CLOK5      RRTRAVIITDSDHVILSAVQPETVAHRLSTKGE---EDEISEVEAQ----------
Y2087_CALS8      RRTRAVIITDSDHVILSAVQPETVAHRVIEPEED-FEEDIDVEDEVDKR-------
Y1501_OCEIH      RRTRAVIITDSDHVVLSAVQPETVGQRVISNDE-----ISDE--------------
Y1166_GEOKA      RRTRAVIIMDSDHVILSSVQPETVANRLYGSDD-----FSEEG-------------
Y1019_GEOTN      RRTRAVIITDSDHVILSSVQPETVANRLYGSDD-----FSEEG-------------
Y899_DESVH       RKTRSIIITDSNHVILSAIQTETMGQRFTQEDED----------------------
Y2085_DESVV      RKTRSIIITDSNHVILSAIQTETMGQRFTQEDED----------------------
Y1139_DESVM      RKTRSIIITDSNHVILSAIQAETVGQRYTQEDAD----------------------
Y2720_DESAG      RKTRSIIVTDSNHVILSAIQAETIGQRFIQEENS----------------------
Y2861_DESPS      RRTRSMLVMDSNHVVLSSVQSDTISQRLQAMRIDLQLGECREQGKKVYNENE----
Y1931_DESAL      RKTRAILVMDSNHVILSAIQADTLAQRYAAVKEKKEEGTHNEPE------------
Y1911_DESOH      RKTRSVIVMASNHVILSAIHTETISQRFAAINGNR-LGPDDDPDLMPE--------
Y405_THEYD       RKTRSIIITDSDHIILSALQVETILQRINEINRVEDGDL-----------------
Y332_THEAB       RKTRAILISDSNHIILSAIQPETIAQRFMQSFFEIEEQLDKIRRKG----------
Y100_THEM4       RKTRAILISDSNHIILSAIQPETIAQRFMQSFFEIEEQLERIRRKG----------
Y1678_FERNB      RKTRSILITDSNHIILSAIQPETIAQRFIESMVEIEKQLEKIR-KG----------
Y1629_PSELT      RKTRAILITDSNHIILSAIQPETIAQRFKQSMIEIEENLNKVR-------------
Y1690_THEMA      RKTRSIIITDSNHIILSAIQPETIAQRFMENFYEIERVLRETKK------------
Y986_THEP1       RKTRSIIITDSNHIILSAIQPETIAQRFMENFYEIERVLRETKK------------
Y1144_THESQ      RKTRSIIITDSNHIILSAIQPETIAQRFMENFYEIERVLRETKK------------
Y099_PETMO       RKTRAFIITDSGHVIASAIQPETITNRFLQNYYDIEKVLDKIRKEVL---------
Y3631_SYNFM      RRTRAIIVTDSDHIILSGVQAETIAQRLLTEGGVRDVNLLKQAKD-----------
Y036_DEHM1       RKTKAVIFTDSGHIVLAALAPETITGRLSISRGGAVKPELVDDKLEL---------
Y033_DEHMB       RKTKAVIFTDSGHIVLAALAPETITGRLSISRGGAVKPELVDDKLEL---------
Y043_DEHMC       RKTKAVIFTDSGHIVLAALAPETITGRLSISRGGAVKPELVDDKLEL---------
Y1027_SYNE7      RRTKAVLIADSGHVILSALQPETIAGRILNSRG-----DLSGA-------------
Y519_SYNP6       RRTKAVLIADSGHVILSALQPETIAGRILNSRG-----DLSGA-------------
Y2331_THEEB      RRTRAVLVLDGEIIVLSALHPETLVARLS--------PPP----------------
Y1186_COPPD      RRTRAAILTEGGFIVLSAVLPDTLVSRLEEEEEEEERTEPITEQEAELEEESGEDV
Y2880_LACP7      RKCKAVVVMETGQIVLSALLPETIANRVNQRES----IESNEVFQAL---------
Y916_LEPBA       RKTRSVLVLESGHILLSAIRPESLSKRLETGDNHIGEGEEESED------------
Y950_LEPBP       RKTRSVLVLESGHILLSAIRPESLSKRLETGDNHIGEGEEESED------------
Y1616_LEPBJ      KKTRSIIVTDSNHLILSNLRVESLAKRIESSDNSIAS-EEEDLD------------
Y1834_LEPBL      KKTRSIIVTDSNHLILSNLRVESLAKRIESSDNSIAS-EEEDLD------------
Y2599_LEPIN      KKTRSIIVTDSNHLILSNLRVESLTKRIESRDNSIAS-EEEDLD------------
Y1384_LEPIC      KKTRSIIVTDSNHLILSNLRVESLTKRIESRDNSIAS-EEEDLD------------
Y1339_DICT6      RKTRAVLVLDSGHIVLSALHPETIAARIEGGDK-----EEESY-------------
Y1444_DICTD      RKTRAVLVLDSGHIVLSALHPETIAARIEGGDK-----EEESS-------------
                 :: :: :.     :: : :  :::  *