CLUSTAL format seed alignment for MF_01504

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SSPK_BACAN            -MGKQAEFWSESKNNSKIDGQPKAKSRFASKRPNGTINTHPQERMRAANQQEE-------
SSPK_BACC1            -MGKQAEFWSESKNNSKIDGQPKAKSRFASKRPNGTINTHPQERMRAANQQEE-------
SSPK_BACCR            -MGKQAEFWSESKNNSKIDGQPKAKSRFASKRPNGTINTHPQERMRAANQQEE-------
A0A2S9HQS7_9BACI      -MGRQAEFWSESKNNSKIDGQLKAKSRFASKRPNGTINTHPQERMRAANQQEE-------
SSPK_BACVZ            MVRNKAKGFPNQNNNKFE-GEPRAKDDYASKRADGSINSHPQERMRASGRR---------
SSPK_BACSU            MVRNKEKGFPYENENKFQ-GEPRAKDDYASKRADGSINQHPQERMRASGKR---------
SSPK_BACLD            -MRNKSRGFPNMNNNKFE-GEPRAKDDFASKRPDGSTNTHPQERMRASGKR---------
SSPK_GEOKA            -MRNKAHNFPNQNNNKLE-GEPRAKAEYASKRADGTTNTHPQERMRASGERSDFF-----
I3E2N3_BACMM          -MRNKARNYPTPKTIKLE-GEPRAKAEYASTRADGTINTHPQERMKASSDRSKDTTELS-
I3E6E8_BACMT          -MRNKARNYPTPKTIKLE-GEPRAKAEYASTRADGSINTHPQERMNASSHRNKDKAELS-
K6C0M6_SCHAZ          MVRNKENNFPSHMNIK---GEPRAKAKYSSLRANGQINTHPQERMRKSNENRPEE-----
E6U1Z3_EVAC2          -MRNKEKGFPPR--ISLD-GEPRAKAAYASKRADGSINDHPAERMQASTQSRKHDPGE--
SSPK_ALKHC            -MRNKAHGFPHRISFDG---EP-DRAKHASKRANGTINTKPQERMHQANPDQ--------
A0A094WLF9_ALKAL      -MRNKAKDFPNHIKFSG---ASLEDEKHASKRANGTIKDRPQERMLSANEADDS------
SSPK_ALKCK            -MRNKAKGFPNPISFNGN--KANNADEHASKRPDGTTRDRPQERMRSSNHFNSL------
D3FUP6_ALKPO          -MRNKAKDFPESRKFTE---KEND--AFLSKRPDGSINDHPQERMARANKNQ--------
A0A024P550_9BACI      -MRNKAKNFP-NLKMTH---APDDQSEYLAKRPDGTINSKPQERAARSRHRDVNDIGRNY
A0A074M9M5_9BACL      -MRNK-DNHPGNFGGPKGLDNPKAKDDFAPLRPDGSIAPRPQARMREGASHHAHPNPPSN
                       : .:    .                 . . *.:*    :*  *   .            

SSPK_BACAN            --
SSPK_BACC1            --
SSPK_BACCR            --
A0A2S9HQS7_9BACI      --
SSPK_BACVZ            --
SSPK_BACSU            --
SSPK_BACLD            --
SSPK_GEOKA            --
I3E2N3_BACMM          --
I3E6E8_BACMT          --
K6C0M6_SCHAZ          --
E6U1Z3_EVAC2          --
SSPK_ALKHC            --
A0A094WLF9_ALKAL      --
SSPK_ALKCK            --
D3FUP6_ALKPO          --
A0A024P550_9BACI      HG
A0A074M9M5_9BACL      E-