CLUSTAL format seed alignment for MF_01506

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TLP_BACHD       ---------MANPDNRNNNVERLKQMVRNTKAKMEAANEALAHE--EMNAEERQRTEEKN
TLP_CLOAB       --------MKSKPDDRRDNVDRIQQSIDNTIENIHETNEMIENTN---REKNKDDLKAKN
TLP_CLOB1       --------MKNKPDDRRDNVDKIQYNITKTIQNCELADEMIAKTD---DEKTKKTLIEKN
TLP_CLOBH       --------MKNKPDDRRDNVDKIQYNITKTIQNCELADEMIAKTD---DEKTKKTLIEKN
TLP_CLOBL       --------MKNKPDDRKDNVDKIQYNITKTIQNCELADEMIAKTD---DEKTKKTLIEKN
TLP_CALS4       MGKEERYTKKPKPDDRSDNVEKLQEMIHNTIENYREAEDYLKLHAEELSPEEIERIKEKN
TLP_BACAN       ---------MPNPDNRSDNAEKLQEMVQNTIDNFNEAKETAELS----NEKDRSAIEAKN
TLP_BACC1       ---------MPNPDNRSDNAEKLQEMVQNTIDNFNEAKETAELS----NEKDRSAIEAKN
TLP_BACCZ       ---------MPNPDNRSDNAEKLQEMVQNTIDNFNEAKETAELS----NEKDRSAIEAKN
TLP_BACAH       ---------MPNPDNRSDNAEKLQEMVQNTIDNFNEAKETAELS----NEKDRSAIEAKN
TLP_BACHK       ---------MPNPDNRSDNAEKLQEMVQNTIDNFNEAKETAELS----NEKDRSAIEAKN
TLP_BACCR       ---------MPNPDNRSDNAEKLQEMVQNTVDNFNEAKETAELS----NEKDRAAIEAKN
TLP_BACLD       -----MTHQKHHPDDRSDNVEKLQDMVQNTIENIEESEEQLSFA----SEAEQEQIREKN
TLP_GEOKA       -------MPRPKPDDRSDNVEKLQEMVQNTIENIQKAEETMQFA----SPEEQEKIRAKN
TLP_GEOTN       -------MPRPKPDDRSDNVEKLQDMVQNTIENIEKAEETMQFA----SPEERERIREKN
TLP_BACSU       MTKNQNQYQQPNPDDRSDNVEKLQDMVQNTIENIEEAEASMEFA----SGEDKQRIKEKN
TLP_BACVZ       ---MTNNYQKPNPDDRSDNVEKLQDMVQNTIENIEEAKESMEFA----TDEEKQRIQEKN
TLP_OCEIH       -------MTHPKPDDRSDNVEKIQNTIDHTLENLNESKDYINAHAEELSSKEKDELSSKN
TLP_BACSK       ---------MAKRDDRSNNPERIENIIGNTLQNMDEARDYAKAHSEELSEEEKQEIEQKN
                           : *:* :* :.::  : :*  :   :                     **

TLP_BACHD       NRRKQSLDAFESEILDEQSARINDDEV
TLP_CLOAB       CRREAALDEFKSEIKDEARAKEKGYK-
TLP_CLOB1       ERRREALDGMREEIKDEARDKKNGYM-
TLP_CLOBH       ERRREALDGMREEIKDEARDKKNGYM-
TLP_CLOBL       ERRREALDGMREEIKDEARDKKNGYM-
TLP_CALS4       RNRLISIQNMRQEIIDEVHDRERR---
TLP_BACAN       QRRLESIDSLKSEIKDES---------
TLP_BACC1       QRRLESIDSLKSEIKDES---------
TLP_BACCZ       QRRLESIDSLKSEIKDES---------
TLP_BACAH       QRRLESIDSLKSEIKDES---------
TLP_BACHK       QRRLESIDSLKSEIKDES---------
TLP_BACCR       QRRLESIDSLKSEIKDES---------
TLP_BACLD       ERRNESIEAMRNEIHDEAEARKNGYHQ
TLP_GEOKA       RRREEAIAAMRAEIRDEAAAREHGCQ-
TLP_GEOTN       RRREEAIAAMRAEIKDEAAAREHGYQ-
TLP_BACSU       ARREQSIEAFRNEIQDESAARQNGYRS
TLP_BACVZ       ARRNESIESFRSEIQDESAARENGYQS
TLP_OCEIH       ERRKESVDGLRSEIKDEADSQ------
TLP_BACSK       ERREQSIDGLREELKDEVNDQKNNS--
                 .*  ::  :  *: **