CLUSTAL format seed alignment for MF_01507

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y4615_BACAN      ---------MDGFDKTMKFSIQDEKQSVHVNDVLLTVYDALQEKGYNPINQIVGYLLSGD
Y4470_BACC1      ---------MDGFDKTMKFSIQDEKQSVHVNDVLLTVYDALQEKGYNPINQIVGYLLSGD
Y4382_BACCR      ---------MDGFDKTMKFSIQDEKQSVHVNDVLLTVYDALQEKGYNPINQIVGYLLSGD
Y4131_BACCZ      ---------MDGFDKTMKFSIQDEKQSVHVNDVLLTVYDALQEKGYNPINQIVGYLLSGD
Y4120_BACHK      ---------MDGFDKTMKFSIQDEKQSVHVNDVLLTVYDALQEKGYNPINQIVGYLLSGD
Y1593_BACSK      ---------MSSMDNTMQFNFNDDSFDADVQEVLLSVYDALEEKGYNPINQIVGYLLSGD
Y1268_BACHD      ---------MSSMDNTMKFNVNEEPVSVDVQEVLMSVYEALEEKGYNPINQIVGYLLSGD
YRZL_BACSU       ---------MSSFDKTMKFNFSDDSAETNVNEVLITVYDALQEKGYNPINQIVGYLLSGD
Y2450_BACVZ      ---------MSSFDKTMKFNFSDDSAETNVEEVLNTVYDALQEKGYNPINQIVGYLLSGD
Y2379_BACP2      ---------MSSFDKTMKFNFSDDSAETNVNEVLITVYDALQEKGYNPINQIVGYLLSGD
Y2868_BACLD      ---------MSSFDKTMKFNFSDDSMETNVNEVLITVHDALQEKGYNPINQIVGYLLSGD
Y2555_GEOKA      ---------MSSFDQTMQFHFSEEPAETNVREVLLTVYGALQEKGYNPINQIVGYLLSGD
Y2488_GEOTN      ---------MSSFDQTMQFHFPEEPAETNVREVLLTVYDALQEKGYNPINQIVGYLLSGD
Y2008_OCEIH      ---------MSSIDKTMKFNFSEEPFDQDIKEILMTVHESLQEKGYNPINQIVGYLLSGD
Y1538_LISIN      ---------MDSKDQTMFYNFGDDSIEEDVKKLMKQVYVALEEKGYNPVNQIVGYLLSGD
Y1503_LISMO      ---------MDSKDQTMFYNFGDDSIEEDVKKLMKQVYVALEEKGYNPVNQIVGYLLSGD
Y1522_LISMF      ---------MDSKDQTMFYNFGDDSIEEDVKKLMKQVYVALEEKGYNPVNQIVGYLLSGD
Y1516_LISW6      ---------MDSKDQTMFYNFGDDSIEEDVKKLMKQVYVALEEKGYNPVNQIVGYLLSGD
Y1756_STRPG      ---------MGFTDETVRFKLDDGD-KRQISETLTAVYHSLDEKGYNPINQIVGYVLSGD
Y1796_STRP6      ---------MGFTDETVRFKLDDGD-KRQISETLTAVYHSLDEKGYNPINQIVGYVLSGD
Y1889_STRPF      ---------MGFTDETVRFKLDDGD-KRQISETLTAVYHSLDEKGYNPINQIVGYVLSGD
Y1798_STRP3      ---------MGFTDETVRFKLDDGD-KRQISETLTAVYHSLDEKGYNPINQIVGYVLSGD
Y1781_STRPM      ---------MGFTDETVRFKLDDGD-KRQISETLTAVYHSLDEKGYNPINQIVGYVLSGD
Y1865_STRPD      ---------MGFTDETVRFKLDDGD-KRQISETLTAVYHSLDEKGYNPINQIVGYVLSGD
Y2172_STRP8      ---------MGFTDETVRFKLDDGD-KRQISETLTAVYHSLDEKGYNPINQIVGYVLSGD
Y1808_STRPC      ---------MGFTDETVRFKLDDGD-KRQISETLTAVYHSLDEKGYNPINQIVGYVLSGD
Y1830_STRPB      ---------MGFTDETVRFKLDDGD-KRQISETLTAVYHSLDEKGYNPINQIVGYVLSGD
Y2114_STRP1      ---------MGFTDETVRFKLDDGD-KRQISETLTAVYHSLDEKGYNPINQIVGYVLSGD
Y2030_STRA1      ---------MGFTDETVRFRLDDSN-KVEISETLTAVYRSLEEKGYNPINQIVGYVLSGD
Y2045_STRA3      ---------MGFTDETVRFRLDDSN-KVEISETLTAVYRSLEEKGYNPINQIVGYVLSGD
Y2091_STRA5      ---------MGFTDETVRFRLDDSN-KVEISETLTAVYRSLEEKGYNPINQIVGYVLSGD
Y2079_STRMU      ---------MGFTDETVRFNLDDGN-KKEISETLTHVYRSLEEKGYNPINQIVGYVLSGD
Y1959_STRT2      ---------MGFTDETVRFNLNDGD-KDEISNTLTNVYRSLAEKGYNPINQIVGYVLSGD
Y1959_STRT1      ---------MGFTDETVRFNLNDGD-KDEISNTLTNVYRSLAEKGYNPINQIVGYVLSGD
Y1937_STRTD      ---------MGFTDETVRFNLNDGD-KNEISNTLTNVYRSLAEKGYNPINQIVGYVLSGD
Y192_STRPN       ---------MGFTEETVRFKLDDSN-KKEISETLTDVYASLNDKGYNPINQIVGYVLSGD
Y175_STRR6       ---------MGFTEETVRFKLDDSN-KKEISETLTDVYASLNDKGYNPINQIVGYVLSGD
Y180_STRP2       ---------MGFTEETVRFKLDDSN-KKEISETLTDVYASLNDKGYNPINQIVGYVLSGD
Y2241_STRSV      ---------MGFTDETVRFNLDDSN-KKEISETLTDVYKSLNEKGYNPINQIVGYVLSGD
Y066_STRSY       ---------MGFTEETVRFRLDDTD-KQEISKTLTSVYRSLEEKGYNPINQIIGYVLSGD
Y066_STRS2       ---------MGFTEETVRFRLDDTD-KQEISKTLTSVYRSLEEKGYNPINQIIGYVLSGD
Y150_LACLM       ---------MSFTDETVRFEFGDSD-KKEIGETLVDVYNVLEAKGYNPINQIVGYVLSGD
Y137_LACLS       ---------MSFTDETVRFEFGDSD-KKEIGETLVDVYNVLEAKGYNPINQIVGYVLSGD
YBEA_LACLA       ---------MSFTDETVRFEFGDSD-KKEIGETLVDVYNVLEAKGYNPINQIVGYVLSGD
Y1202_ENTFA      ---------MGFTDETVRFDFDDNR-KKAISETLETVYRALEEKGYNPINQIVGYLLSGD
Y422_LACGA       ---------MSSLDKTMHFDFNQNK-GKNVYDTLQDVYNALEEKGYSPINQIVGYLLSGD
Y475_LACJO       ---------MSSLDKTMHFDFNQNK-GKNVYDTLQDVYNALEEKGYSPINQIVGYLLSGD
Y418_LACAC       ---------MSSLDKTMHFDFNQNK-GKNVYDTLQDVYNALEEKGYNPINQIVGYLLSGD
Y1606_LACDA      ---------MSSLDKTMHFDFNQNK-GKNIRDTLEDVYKALEEKGYSPINQIVGYLLSGD
Y1485_LACDB      ---------MSSLDKTMHFDFNQNK-GKNIRDTLEDVYKALEEKGYSPINQIVGYLLSGD
Y1222_LACBA      ---------MSSLDKTMYFDFGANQ-PKDVHDTLVTVYQALEEKGYNPINQIVGYLLSGD
Y2275_LACPL      ---------MSSLDKTMYFDFDNDS-VKDVHDTLTTVYEALQEKGYNPINQIVGYLLSGD
Y1110_LACS1      ---------MSALDKTMYFDFGQNE-KKDVHQTLETVYNSLEEKGYNPINQIVGYLLSGD
Y786_LACP3       ---------MSTLDQTVHFDFRDNN-PKNVHETLETVYKALEEKGYNPINQIVGYLISGD
Y388_LACSS       ----------MNLDKTVHFDFGKNS-PKNVHETLVTVYQTLEDKGYNPINQIVGYLLSGD
Y557_LEUMM       ---------MTVGDETAIFDFGNQM-PKDIHETLEIVYSSLEEKGYNPINQIVGYLMSGD
Y1166_OENOB      ---------MAEFEDTTVFNFGSQK-PENVRSMLKLVYEALEEKGYNPINQIVGYLISGD
Y1262_PEDPA      ---------MGKLDETMFFDFGDNK-QNDVRETLKTVYDALEEKGYNPIDQIVGYLISGD
Y1488_STAAB      ---------MENFDKTMKFDYEELP-TQDVRDVLNNVYRTLDERGYNAVNQIVGYLLSGD
Y1672_STAAC      ---------MENFDKTMKFDYEELP-TQDVRDVLNNVYRTLDERGYNAVNQIVGYLLSGD
Y1696_STAAR      ---------MENFDKTMKFDYEELP-TQDVRDVLNNVYRTLDERGYNAVNQIVGYLLSGD
Y1553_STAAS      ---------MENFDKTMKFDYEELP-TQDVRDVLNNVYRTLDERGYNAVNQIVGYLLSGD
Y1604_STAA1      ---------MENFDKTMKFDYEELP-TQDVRDVLNNVYRTLDERGYNAVNQIVGYLLSGD
Y1617_STAAM      ---------MENFDKTMKFDYEELP-TQDVRDVLNNVYRTLDERGYNAVNQIVGYLLSGD
Y1567_STAAW      ---------MENFDKTMKFDYEELP-TQDVRDVLNNVYRTLDERGYNAVNQIVGYLLSGD
Y1445_STAAN      ---------MENFDKTMKFDYEELP-TQDVRDVLNNVYRTLDERGYNAVNQIVGYLLSGD
Y1721_STAA8      ---------MENFDKTMKFDYEELP-TQDVRDVLNNVYRTLDERGYNAVNQIVGYLLSGD
Y1574_STAA3      ---------MENFDKTMKFDYEELP-TQDVRDVLNNVYRTLDERGYNAVNQIVGYLLSGD
Y1300_STAES      ---------MENFDKTMKFSYEEIP-KEDVKSVLQNVHRTLEERGYNAVNQIVGYLLSGD
Y1181_STAEQ      ---------MENFDKTMKFSYEEIP-KEDVKSVLQNVHRTLEERGYNAVNQIVGYLLSGD
Y1302_STAHJ      ---------MDNIDKTMKFDYEEIP-KDNVETVLNNVHRTLEERGYNAVNQIVGYLLSGD
Y1144_STAS1      ---------MENFDKTMKFNYDEIP-KEDVKTVLQNVYHTLEERGYNPVNQIVGYLLSGD
Y540_CARHZ       --------MGEDMEKTMRFGFDKEK-NTKHKALLLTIYEALQEKGYNPINQLVGYLLSGD
Y1249_CALS4      MIESEVIALVEKNEQTIKYTVSKDK--KSVKEILEAVYEALSEKGYDPVNQIVGYILSGD
Y1643_MOOTA      --------MPGDMQETMMFKVEKEE-KVRVRDVLTEVQAALTEKGYDPINQLIGYLLSGD
Y469_SYNWW       --------MPQLPGETVSFKLERDD-ENKVRAILHTVYQALQEKGYNPINQLVGYMISGE
Y2420_DESHY      ---------MDRLEHTMMFKSQGGD-VS-PQEILQQVYVALEEKGYDPINQLVGYLMSGD
Y1998_SYMTH      --------MPGTSDKTVYWRNKPED-RN-PGEVLQKVYAALKEKGYSPIDQIVGYLLSGD
Y151_HUNT2       ----------MSNNETMMFNVEKEK-VNEARELLVSVYKALKEKGYNPINQIVGYILSGD
Y1283_CLOD6      --------MEKDLDYTMKFEGIPED-RMSVGDTIDFVYKALVEKGYNPINQIIGYLLSGD
Y1679_CLOAB      -------MGSEINDNTIEFDVLKNK-EDLTKEILNEVYNSLKEKGYNPINQLVGYLISGD
Y2279_CLONN      ---------MSINENTMEFDIQKNK-DDLTRSILSEVNNSLKEKGYNPINQLVGYLISGD
Y1779_CLOPE      --------MSNNFDHTMQFDFSKNK-EDLTKSILTDVYNSLKEKGYNPVNQLVGYLISGD
Y2032_CLOP1      --------MSNNFDHTMQFDFSKNK-EDLTKSILTDVYNSLKEKGYNPVNQLVGYLISGD
Y1749_CLOPS      --------MSNNFDHTMQFDFSKNK-EDLTKSILTDVYNSLKEKGYNPVNQLVGYLISGD
Y2504_CLOB1      ----------MSGDKTIQFDPVENK-KTLTKEILTKVYNSLLEKGYNPVNQLVGYLISGD
Y2563_CLOBH      ----------MSGDKTIQFDPVENK-KTLTKEILTKVYNSLLEKGYNPVNQLVGYLISGD
Y2626_CLOBL      ----------MSGDKTIQFDPVENK-KTLTKEILTKVYNSLLEKGYNPVNQLVGYLISGD
Y1773_CALS8      -----------MNDKTQHFSFDDAM-EKKVKEILSEVYSALKEKGYNPIAQLVGYLISGD
                                *  :              :  :   *  :**..: *::**::**:

Y4615_BACAN      PAYIPRHKDARSIIRKLERDELIEELVKSYLKHHREE------
Y4470_BACC1      PAYIPRHKDARSIIRKLERDELIEELVKSYLKHHREE------
Y4382_BACCR      PAYIPRHKDARSIIRKLERDELIEELVKSYLKHHREE------
Y4131_BACCZ      PAYIPRHKDARSIIRKLERDELIEELVKSYLKHHREE------
Y4120_BACHK      PAYIPRHKDARSIIRKLERDELIEELVKSYLKHHREE------
Y1593_BACSK      PAYIPRHKDARTLIRKLERDELIETLVKSYLRSHGKENK----
Y1268_BACHD      PAYIPRHKDARTLIRKLERDELIEELVKSYLSQHRKSLE----
YRZL_BACSU       PAYIPRHRDARNLIRKLERDELIEELVKSYLEQHKEA------
Y2450_BACVZ      PAYIPRHRDARNLIRKLERDELIEELVKSYLEQHKEA------
Y2379_BACP2      PAYIPRHQDARNLIRKLERDELIEELVKSYLETHKEA------
Y2868_BACLD      PAYIPRHRDARNLIRKIERDEIIEELVKSYLEQHKEA------
Y2555_GEOKA      PAYIPRHKDARALIRKIERDELIEELVKFYLQGQRKD------
Y2488_GEOTN      PAYIPRHKDARTLIRKIERDELIEELVKFYLQGQRKG------
Y2008_OCEIH      PAYIPRYNDARNLIRKVERDEVIEELVKFYLEQNRETK-----
Y1538_LISIN      PAYIPRHKDARSMIRRLERDEIIEELVKAYLKNNEIGEK----
Y1503_LISMO      PAYIPRHKDARSMIRRLERDEIIEELVKAYLKNNEIGEK----
Y1522_LISMF      PAYIPRHKDARSMIRRLERDEIIEELVKAYLKNNEIGEK----
Y1516_LISW6      PAYIPRHKDARSLIRRLERDEIIEELVKAYLKNNEIGEK----
Y1756_STRPG      PAYVPRYNDARNQIRKYERDEIVEELVRYYLQGNGIDVK----
Y1796_STRP6      PAYVPRYNDARNQIRKYERDEIVEELVRYYLQGNGIDVK----
Y1889_STRPF      PAYVPRYNDARNQIRKYERDEIVEELVRYYLQGNGIDVK----
Y1798_STRP3      PAYVPRYNDARNQIRKYERDEIVEELVRYYLQGNGIDVK----
Y1781_STRPM      PAYVPRYNDARNQIRKYERDEIVEELVRYYLQGNGIDVK----
Y1865_STRPD      PAYVPRYNDARNQIRKYERDEIVEELVRYYLQGNGIDVK----
Y2172_STRP8      PAYVPRYNDARNQIRKYERDEIVEELVRYYLQGNGIDVK----
Y1808_STRPC      PAYVPRYNDARNQIRKYERDEIVEELVRYYLQGNGIDVK----
Y1830_STRPB      PAYVPRYNDARNQIRKYERDEIVEELVRYYLQGNGIDVK----
Y2114_STRP1      PAYVPRYNDARNQIRKYERDEIVEELVRYYLQGNGIDVK----
Y2030_STRA1      PAYVPRYNDARNQIRKYERDEIVEELVRYYLQGNGIDL-----
Y2045_STRA3      PAYVPRYNDARNQIRKYERDEIVEELVRYYLQGNGIDL-----
Y2091_STRA5      PAYVPRYNDARNQIRKYERDEIVEELVRYYLQGNGIDL-----
Y2079_STRMU      PAYVPRYNDARNQIRKYERDEIVEELVRYYLQGNGIDLK----
Y1959_STRT2      PAYVPRYNDARNQIRKYERDEIVEELVRYYLKGNGTDL-----
Y1959_STRT1      PAYVPRYNDARNQIRKYERDEIVEELVRYYLKGNGTDL-----
Y1937_STRTD      PAYVPRYNDARNQIRKYERDEIVEELVRYYLKGNGTDL-----
Y192_STRPN       PAYVPRYNNARNQIRKYERDEIVEELVRYYLKGQGVDL-----
Y175_STRR6       PAYVPRYNNARNQIRKYERDEIVEELVRYYLKGQGVDL-----
Y180_STRP2       PAYVPRYNNARNQIRKYERDEIVEELVRYYLKGQGVDL-----
Y2241_STRSV      PAYVPRYNNARNQIRKYERDEIVEELVRYYLKGQGVDL-----
Y066_STRSY       PAYIPRYNDARNQIRKHERDEIIEELVRYYLKGNGIDL-----
Y066_STRS2       PAYIPRYNDARNQIRKHERDEIIEELVRYYLKGNGIDL-----
Y150_LACLM       PAYIPRHDDARNKIRRFDRDDIVEELIKNYLKDNGVNL-----
Y137_LACLS       PAYIPRHDDARNKIRRFDRDDIVEELIKNYLKDNGVNL-----
YBEA_LACLA       PAYIPRHDDARNKIRRFDRDDIVEELIKNYLKDNGVNL-----
Y1202_ENTFA      PAYIPRYQDARNLIRRHERDEIMEELTKYYLANHGIDIK----
Y422_LACGA       PAYIPRHNDARNLILKHERDEIIEELVKSYLGKNK--------
Y475_LACJO       PAYIPRHNDARNLILKHERDEIIEELVKSYLGKNK--------
Y418_LACAC       PAYIPRHNDARNLILKHERDEIIEELVKSYLGKNK--------
Y1606_LACDA      PAYIPRHNDARNLILKHERDEIIEELVKSYLGKDK--------
Y1485_LACDB      PAYIPRHNDARNLILKHERDEIIEELVKSYLGKDK--------
Y1222_LACBA      PAYIPRIDDARNLIRKHERDEIIEELVRVYLNQNGSVKKS---
Y2275_LACPL      PAYIPRLKDARNLIRKHQRDEIIEELVKSYLKADKDVDA----
Y1110_LACS1      PAYIPRLNDARNLIRKHERDEIIEELVRAYLDKGEK-------
Y786_LACP3       PAYIPRYNDARNLIRKHERDEIIEELVRNYLGKEQA-------
Y388_LACSS       PAYIPRYNDARNLIRKHERDEIIEELVKNYLDKGNTK------
Y557_LEUMM       PAYIPRLNDARNLIKRHERDEIIEELVHAYLKK----------
Y1166_OENOB      PAYIPRLNDARNLIRRFERDEIVEELVKDYLSDHKTDQKK---
Y1262_PEDPA      PAYIPRLNDARNLIRKHQRDEIIEELVRYYLSEQIADSKKEEN
Y1488_STAAB      PAYIPRQNEARNQIRHIDRDVIMEELVSYYLKEQNK-------
Y1672_STAAC      PAYIPRQNEARNQIRHIDRDVIMEELVSYYLKEQNK-------
Y1696_STAAR      PAYIPRQNEARNQIRHIDRDVIMEELVSYYLKEQNK-------
Y1553_STAAS      PAYIPRQNEARNQIRHIDRDVIMEELVSYYLKEQNK-------
Y1604_STAA1      PAYIPRQNEARNQIRHIDRDVIMEELVSYYLKEQNK-------
Y1617_STAAM      PAYIPRQNEARNQIRHIDRDVIMEELVSYYLKEQNK-------
Y1567_STAAW      PAYIPRQNEARNQIRHIDRDVIMEELVSYYLKEQNK-------
Y1445_STAAN      PAYIPRQNEARNQIRHIDRDVIMEELVSYYLKEQNK-------
Y1721_STAA8      PAYIPRQNEARNQIRHIDRDVIMEELVSYYLKEQNK-------
Y1574_STAA3      PAYIPRQNEARNQIRHIDRDVIMEELVSYYLKEQNK-------
Y1300_STAES      PAYIPRQNEARNQIRHIDRDVIMEELVSNYLKESKN-------
Y1181_STAEQ      PAYIPRQNEARNQIRHIDRDVIMEELVSNYLKESKN-------
Y1302_STAHJ      PAYIPRQNDARNQIRHIDRDVIMEELVSNYLKENKK-------
Y1144_STAS1      PAYIPRNNEARNQIRRIDRDDIMEELVSNYLQEKSN-------
Y540_CARHZ       PAYITSHKNARNLIRKIERDELLEELLKVYLERE---------
Y1249_CALS4      PTYITSHKNARNLIRKIERDELVEELLKSYLSKE---------
Y1643_MOOTA      PAYITSHKGARNLIRRVERDEILAELLKSYLA-----------
Y469_SYNWW       PAYITSHSEARNLICKVDRDEIMEVLLKSYLQNSMGKGE----
Y2420_DESHY      PVYITSHNQARSLIRKLERYELLEELVRSYLQEK---------
Y1998_SYMTH      PTYITSHMGARNLIRRIERDELLEELVRSYLEKLEE-------
Y151_HUNT2       PTYITNHLDARSSIRKVERDELLEEILRCYLEECIGKEGSV--
Y1283_CLOD6      SSYITSHKNARAIIKKFERDEILEEVITHYLNRK---------
Y1679_CLOAB      PTYITNYNGARALVRKLERDEILEEVLKSYLGIK---------
Y2279_CLONN      PTYITNYNGARALIRKLERDEILEEVLKAYLSIK---------
Y1779_CLOPE      PTYITNYNGARALVRKLERDEILEEVIKSYLEIK---------
Y2032_CLOP1      PTYITNYNGARALVRKLERDEILEEVIKSYLEIK---------
Y1749_CLOPS      PTYITNYNGARALVRKLERDEILEEVIKSYLEIK---------
Y2504_CLOB1      PTYITNYNGARSLVIKLERDEILEEVIKSYLGIN---------
Y2563_CLOBH      PTYITNYNGARSLVIKLERDEILEEVIKSYLGIN---------
Y2626_CLOBL      PTYITNYNGARSLVIKLERDEILEEVIKSYLGIN---------
Y1773_CALS8      PTYITNHKNARSIIRRIERDEILEEIVKFYIDHNIE-------
                 . *:.    **  : : :*  ::  :   *: