CLUSTAL format seed alignment for MF_01515

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y2434_PELCD      --------------------MTFALPDNAT--LSLFLLPLLVFFARIIDVSIGTLRIIFV
Y1511_METMJ      --------------------MLGVVPDIDPEFFSLVVVPVFIFLARICDVTIGTMRIIFV
Y543_METHJ       --------------------MDVGFLSSDL--FTFGLIPVLIFLARICDVSIGTIRYIMI
Y2213_HUNT2      ---------------------MEGIVNSGL--FNWLILPLLIFFSRIIDVTIGTIRIIFV
Y791_METB6       MQFNPGPPAGFHAPPAKQKACTVTFFLFTPDILNYIVLPVLIFLAQIANVCMETLRIVFL
Y597_LEPBJ       --------------------MELN---PGNPIFDYCVLPCFIFLARVTDVSIGTIRVILL
Y2483_LEPBL      --------------------MELN---PGNPIFDYCVLPCFIFLARVTDVSIGTIRVILL
Y606_LEPIN       --------------------MEFSFPLPGNPIFDYVLLPCFIFLSRVTDVSIGTIRVILL
Y2973_LEPIC      -----------MFFQRYLYCMEFSFPLPGNPIFDYVLLPCFIFLSRVTDVSIGTIRVILL
Y1367_PSYIN      --------------------------------------MPLVFFARVADVSLGTFRTIVI
Y566_SACD2       --------------------------MNEWLNVAPELLALLIFVSRVIDVSLGTFRTIVI
Y2502_DESAG      -----------------------------MITAASLLTALAVFIARLCDVCLGTIRHVMI
Y632_CLOB1       ----------------------------------MLSYYAFIFFAKIMEVALMTIRTVLI
Y591_CLOBH       ----------------------------------MLSYYAFIFFAKIMEVALMTIRTVLI
Y673_CLOBL       ----------------------------------MLSYYAFIFFAKIMEVALMTIRTVLI
Y3420_BACAN      -----------------------------------MLQALLIFVLQIIYVPILTIRTILL
Y3064_BACCZ      -----------------------------------MLQALLIFVLQIIYVPILTIRTILL
Y3038_BACAH      -----------------------------------MLQALLIFVLQIIYVPILTIRTILL
Y3154_BACHK      -----------------------------------MLQALLIFVLQIIYVPILTIRTILL
Y3390_BACC1      -----------------------------------MLQALLIFVLQIIYVPILTIRTILL
Y3353_BACCR      -----------------------------------MLQALLIFVLQIIYVPILTIRTILL
Y1774_BACSK      ----------------------------------MVLQALIIFFAQLIYVPILTLRTIMM
Y803_GEOTN       ----------------------------------MLKDIVLVLALQLVYVPILTLRTIFM
Y682_BACVZ       --------------------------MMQTILSNSIGMVLIILIINIIYVSFFTIRMILT
YEBE_BACSU       --------------------------MMQTILSNGIAMVLIILIINIVYVSFFTIRMILT
Y594_BACP2       --------------------------MLQQLLSNAFTMVLIILVINIVYVSFSTMRLILT
Y691_BACLD       --------------------------MLHSALLNGVIMVGIILVINIIYVTFLTLRMILT
Y738_OCEIH       ------------------------------MLENAFIMLAIIFSVNVIYVSLMTVRMILT
Y621_BACHD       --------------------------MVSFFMEHALTMILIILIINVVYVTLFTVRMIFT
Y1727_STAAN      ---------------------------MSFVTENPWLMVLTIFIINVCYVTFLTMRTILT
Y2131_STAA8      ---------------------------MSFVTENPWLMVLTIFIINVCYVTFLTMRTILT
Y1911_STAAM      ---------------------------MSFVTENPWLMVLTIFIINVCYVTFLTMRTILT
Y1852_STAAW      ---------------------------MSFVTENPWLMVLTIFIINVCYVTFLTMRTILT
Y1835_STAAS      ---------------------------MSFVTENPWLMVLTIFIINVCYVTFLTMRTILT
Y1896_STAA1      ---------------------------MSFVTENPWLMVLTIFIINVCYVTFLTMRTILT
Y1973_STAAC      ---------------------------MSFVTENPWLMVLTIFIINVCYVTFLTMRTILT
Y2004_STAAR      ---------------------------MSFVTENPWLMVLTIFIINVCYVTFLTMRTILT
Y1848_STAAB      ---------------------------MSFVTENPWLMVLTIFIINVCYVTFLTMRTILT
Y1892_STAA3      ---------------------------MSFVTENPWLMVLTIFIINICYVTFLTMRTILT
Y1595_STAES      ---------------------------MSAIAQNPWLMVLAIFIINVCYVTFLTMRTILT
Y1448_STAEQ      ---------------------------MSAIAQNPWLMVLAIFIINVCYVTFLTMRTILT
Y1041_STAHJ      ---------------------------MSVITSNPWSMVLAIFVINVFYVTFLTMRTILT
Y880_STAS1       ---------------------------MSVITSNPWLMVLAIFIINVAYVTCLTMRTILT
Y1776_LISMO      -------------------------------MDNGIFIVVTIFIVNILYVTIYTVRLLLT
Y1801_LISMF      -------------------------------MDNGIFIVATIFIVNILYVTIYTVRLLLT
Y1888_LISIN      -------------------------------MDNGIFIVATIFVVNILYVTIYTVRLLLT
Y1794_LISW6      -------------------------------MDNGLFIVVTIFVVNILYVTIYTVRLLLT
Y1609_ENTFA      -------------------------------MVVDLKMLAMIFIINFAYITLNTIRFMLT
Y1140_LACPL      -------------------------------MHIDMGMLVLIFIINFAYITLNTVRFLLV
Y1893_DESHY      -------------------------------MGSILQFVLIIITINITYVTLTTIRFILM
Y2077_SYMTH      --------------------------MRLAKEVEAALDLLIIFLAQATYVSVNTVRWIIL
Y526_SYNWW       ----------------------------------MLFELIFIFLARVLDVSLGTVRMILV
Y605_METB6       --------------------------MDIGTFWSVAAIPLLILVARIAEASLESVRTIYI
                                                          ::  .       :.* :  

Y2434_PELCD      ARSLKGWAGVLGFFESLIWVLAISQVMQNL-TNVWTYIAFALGFAT-GNYVGVLIEERIA
Y1511_METMJ      SRGMKVIAPLLGFFEIFIWIVAVGQIFQNL-TNPLNYFAYAAGFAT-GNYIGMLVEERLA
Y543_METHJ       SRGFKFIAPVFGFFEVTIWLLAIGQVMANI-TNPICYIAYGAGFAA-GTYIGMELEERMK
Y2213_HUNT2      SRGKKYLAPVLGFFEVLVWIMAISQIMQNL-NNFVCYFAYAAGFAT-GTFVGIIIEEKLA
Y791_METB6       SKGMKYLAPVIAFFEIIIWLLAIVGVLNNL-SNIAYFLAYAFGFAL-GTYVGLVIEEKLS
Y597_LEPBJ       TREKKVIAASLGFLEVLLWVIVITQVIKNL-NNALCYLAYAGGFAA-GTFIGMILEEKLA
Y2483_LEPBL      TREKKVIAASLGFLEVLLWVIVITQVIKNL-NNALCYLAYAGGFAA-GTFIGMILEEKLA
Y606_LEPIN       TREKKGIAASLGFLEVLLWVVVITQVIKNL-NNVFCYLAYAGGFAT-GTFIGMILEEKLA
Y2973_LEPIC      TREKKGIAASLGFLEVLLWVVVITQVIKNL-NNVFCYLAYAGGFAT-GTFIGMILEEKLA
Y1367_PSYIN      FRGHKFLASFIGFFEIIIWLVASAQVLTNL-DQWYLALAYASGFSV-GNYAGISIENRFA
Y566_SACD2       FRGYKALAAFIGFFEIMIWLVAAGQVFKNL-DQWYLALAYAGGFSM-GNYVGMWIENRFA
Y2502_DESAG      IRGRRLLAFSVAFFEAVIWVYAVSRVIGAV-SDPVTSLAFALGFAS-GTYAGITLEGVFK
Y632_CLOB1       TRGEKLYGSIIGFIEVTIWLYVTSSVLSGIKDDPIRMVVYALGFTC-GNYMGCVIEEKLA
Y591_CLOBH       TRGEKLYGSIIGFIEVTIWLYVTSSVLSGIKDDPIRMVVYALGFTC-GNYMGCVIEEKLA
Y673_CLOBL       TRGEKLYGSIIGFIEVTIWLYVTSSVLSGIKDDPIRMVVYALGFTC-GNYMGCVIEEKLA
Y3420_BACAN      VKNQTRSAAAVGLLEGAIYIVSLGIVFQDL-SNWMNIVAYVIGFSA-GLLLGGYIENKLA
Y3064_BACCZ      VKNQTRSAAAVGLLEGAIYIVSLGIVFQDL-SNWMNIVAYVIGFSA-GLLLGGYIENKLA
Y3038_BACAH      VKNQTRSAAAVGLLEGAIYIVSLGIVFQDL-SNWMNIVAYVIGFSA-GLLLGGYIENKLA
Y3154_BACHK      VKNQTRSAAAVGLLEGAIYIVSLGIVFQDL-SNWMNIVAYVIGFSA-GLLLGGYIENKLA
Y3390_BACC1      VKNQTRSAAGVGLLEGAIYIVSLGIVFQDL-SNWMNIVAYVIGFSA-GLLLGGYIENKLA
Y3353_BACCR      VKNQTRSAAGVGLLEGAIYIVSLGIVFQDL-SNWMNIVAYVIGFSA-GLLLGGYIENKLA
Y1774_BACSK      VKGLKQKAAAMGMLEGVIYVVALGIVFSDL-SNYYNMAAYALGFGI-GLYIGAVIEEKLA
Y803_GEOTN       VKNMSLLAAFMGFLEALIYVFGLSIVFSGK-QSYIVMIVYAAGFGARGFLLEDISSKSWA
Y682_BACVZ       LKGQRYFAAGISTIEILVYVTGLSLVLGNL-NQIQNVIAYALGYGL-GVIVGMKIEEKLA
YEBE_BACSU       LKGQRYLAAGISTIEILVYVTGLSLVLDNL-DQIQNVIAYALGYGL-GVIVGMKIEEKLA
Y594_BACP2       MKGRRYAAAFAGTIEMLIYVIGLSIVLDNL-DQIQNVIAYALGYGM-GIIVGMKIEEKLA
Y691_BACLD       LKGQRYLAAFIGTIEMLVYVVGLGLVLDNL-NQIQNVIAYAVGFGI-GIIVGTKIEEKLA
Y738_OCEIH       LKGRTYIAAFVSMFEIVIYVVGLGLVLDNL-DQIQNLVAYAIGFGT-GLVIGAKIEEKLA
Y621_BACHD       LKNQRYLAATVSMIEIIVYVLGLSLVLDNL-DRIENLIAYAVGYGI-GVITGMKVEEKLA
Y1727_STAAN      LKGYRYIAASVSFLEVLVYIVGLGLVMSNL-DHIQNIIAYAFGFSI-GIIVGMKIEEKLA
Y2131_STAA8      LKGYRYIAASVSFLEVLVYIVGLGLVMSNL-DHIQNIIAYAFGFSI-GIIVGMKIEEKLA
Y1911_STAAM      LKGYRYIAASVSFLEVLVYIVGLGLVMSNL-DHIQNIIAYAFGFSI-GIIVGMKIEEKLA
Y1852_STAAW      LKGYRYIAASVSFLEVLVYIVGLGLVMSNL-DHIQNIIAYAFGFSI-GIIVGMKIEEKLA
Y1835_STAAS      LKGYRYIAASVSFLEVLVYIVGLGLVMSNL-DHIQNIIAYAFGFSI-GIIVGMKIEEKLA
Y1896_STAA1      LKGYRYIAASVSFLEVLVYIVGLGLVMSNL-DHIQNIIAYAFGFSI-GIIVGMKIEEKLA
Y1973_STAAC      LKGYRYIAASVSFLEVLVYIVGLGLVMSNL-DHIQNIIAYAFGFSI-GIIVGMKIEEKLA
Y2004_STAAR      LKGYRYIAASVSFLEVLVYIVGLGLVMSNL-DHIQNIIAYAFGFSI-GIIVGMKIEEKLA
Y1848_STAAB      LKGYRYIAASVSFLEVLVYIVGLGLVMSNL-DHIQNIITYAFGFSI-GIIVGMKIEEKLA
Y1892_STAA3      LKGYRYIAASVSFLEVLVYIVGLGLVMSNL-DHIQNIIAYAFGFSI-GIIVGMKIEEKLA
Y1595_STAES      LKGYRYVAAVVSFMEVLVYVVGLGLVMSSL-DQIQNIFAYALGFSV-GIIVGMKIEEKLA
Y1448_STAEQ      LKGYRYVAAVVSFMEVLVYVVGLGLVMSSL-DQIQNIFAYALGFSV-GIIVGMKIEEKLA
Y1041_STAHJ      LKGYRYMAAAVSFLEVLVYVVGLGMVMSSL-DQIQNIFAYAFGFSI-GILVGMKIEEKLA
Y880_STAS1       LKGYRYVAAIVSFLEVLVYVVGLGMVMSSL-DQIQNVFAYAFGFSI-GIIVGMKIEEKLA
Y1776_LISMO      MKGYRYLAALSSVFEMIIYVVALSLVLDNL-NNIANVLAYAVGFGV-GIIVGMKIEERIA
Y1801_LISMF      MKGYRYLAALSSVFEMIIYVVALSLVLDNL-NNIANVLAYAIGFGV-GIIVGMKIEERIA
Y1888_LISIN      MKGYRYLAALSSVFEMIIYVVALSLVLDNL-NNIANVLAYAVGFGV-GIIVGMKIEERIA
Y1794_LISW6      MKGYRYLAALSSVFEMIIYVVALSLVLDNL-NNIANVLAYAIGFGV-GVIVGMKIEERIA
Y1609_ENTFA      MKGYRVIAPLVSMAEITIYVLGLSMVLNRL-DNPLNLLVYALGYAV-GISVGIKIEDYLA
Y1140_LACPL      MRGYRYFAAFASVIEITIYVLGLSLVLNRL-NNPINLVVYALGYGV-GVYVGMVIEDRLA
Y1893_DESHY      IKGMRVYASLLSVLEVFIYIMGLSIILDNL-DSYWNIAAYCCGYGV-GVYLGSRIEERLA
Y2077_SYMTH      VKGRRLLASAISFFEVILWVYALGLVVSQL-SDPVKVATYALGYAV-GALVGSKIEERLA
Y526_SYNWW       IRGDRIPAAIIGFFEILIYTVALGLVIGSL-NEPLKLLVFCSGFAL-GILLGSILEEKIA
Y605_METB6       SKGHANLAAYVGIVKTGIWLISTGLVLTDL-MQFWNLFAYLAGYGM-GTVLGMEIENLIS
                  :     .   .  :  ::      :.           .:  *:   *       .    

Y2434_PELCD      IGSLIVRIITRKDA-T-VLTEHLWKAGYGVTNLQAH-GETGPVRLIFTVCRRRDVKDVLR
Y1511_METMJ      MGLALIRIITQRDA-T-NLIDYLRAAGYGVTVLDAH-GKQGPGKVIFSVVKRKNMRDVED
Y543_METHJ       LGMAIIRLITPLPT-E-DFIARLRQYGYGVTNITAQ-GANGEVTIIFMVVKRAKIPHLAI
Y2213_HUNT2      IGTLVIRVIVDKNE-C-ELKERLSKSGFGVTVVDAK-GKNGDVKIIYTIIKRKELQEVVR
Y791_METB6       IGMVIMRIITTDGSGD-GITEYLQQENYGTTCLDAK-GARGGVKMIISLVNRDDVPRITR
Y597_LEPBJ       IGFSLLRIISPRNG-D-EIANKLSEAGYGVTTMNGQ-GSRGPVKIVFTVLKRKKIGQAMT
Y2483_LEPBL      IGFSLLRIISPRNG-D-EIANKLSEAGYGVTTMNGQ-GSRGPVKIVFTVLKRKKIGQAMT
Y606_LEPIN       IGFSLLRIISPQNG-S-EIADKLSEAGYRVTIMNGH-GSRGPVKIVFTVLKRKKIDQAMK
Y2973_LEPIC      IGFSLLRIISPQNG-S-EIADKLSEAGYRVTIMNGH-GSRGPVKIVFTVLKRKKIDQAMK
Y1367_PSYIN      IGNELIRCISFNRD---VLAGKLREEGFKVVSFDGDMGEAYPVELLLVIEKRRNVPSLIQ
Y566_SACD2       IGNELVRCLSFNRD---VLAEKIREQGFKVISFDGDMGTDKLVELLFIVEKRRNVPALIK
Y2502_DESAG      IGEQVVRVFTREGG---PVACTLRDAGFRVTVFDGQ-GRDGVVNLLFVQVRRRQAGEVAR
Y632_CLOB1       IGLLTINVITSESDGK-RLAEILRDENVGVTMVDAE-GKIEQKKMLIIHAKRKRREEIIR
Y591_CLOBH       IGLLTINVITSESDGK-RLAEILRDENVGVTMVDAE-GKIEQKKMLIIHAKRKRREEIIR
Y673_CLOBL       IGLLTINVITSESDGK-RLAEILRDENVGVTMVDAE-GKIEQKKMLIIHAKRKRREEIIR
Y3420_BACAN      IGYITYQVSLLDRCNE--LVDELRHSGFGVTVFEGE-GINSIRYRLDIVAKRSREKELLE
Y3064_BACCZ      IGYITYQVSLLDRCNE--LVDELRHSGFGVTVFEGE-GINSIRYRLDIVAKRSREKELLE
Y3038_BACAH      IGYITYQVSLLDRCNE--LVDELRHSGFGVTVFEGE-GINSIRYRLDIVAKRSREKELLE
Y3154_BACHK      IGYITYQVSLLDRCNE--LVDELRHSGFGVTVFEGE-GINSIRYRLDIVAKRSREKELLE
Y3390_BACC1      IGYITYQVSLLDRCNE--LVDELRHSGFGVTVFEGE-GINSIRYRLDIVAKRSREKELLE
Y3353_BACCR      IGYITYQVSLLDRCNE--LVDELRHSGFGVTVFEGE-GINSIRYRLDIVAKRSREKELLE
Y1774_BACSK      IGYVSIEVNIPQKNQP--LINRLREMGFSVSSSSVE-GMASTRCRLDCTARRDREKEFIK
Y803_GEOTN       IGYTTVTVNLQQKNQE--LIHLLRESGYGVTVYTGE-GRDSQRYRLDILTKRNREEELLE
Y682_BACVZ       LGYITVNVITKELDLD--LPKQLREKGYGVTSWVAG-GLEGDRTAMQILTPRKYELQLYD
YEBE_BACSU       LGYIMVNVITKELDLD--LPKQLREKGYGVTNWVAG-GLEGDRTALQILTPRRYELQLYD
Y594_BACP2       LGYTTVNVITKELDVD--LPRQLREKGYGVTSWVAG-GLEGDRTALQILTPRKYELQLYE
Y691_BACLD       LGYITVNAITKELDLD--LPKQLREKGYGVTHWVVG-GLEGDRTAMQILTPRKYELQLYE
Y738_OCEIH       LGYITVNVVSANPDLK--FTQRLREKGYGVTSWSSY-GREGDRLSVQILTPRKYELRLYE
Y621_BACHD       LGYITVNVITKEYEPD--IPNTLRDKGYGVTNWVAY-GREGERLMMEILTSRKSEADLYA
Y1727_STAAN      LGYTVVNVTSAEYELD--LPNELRNLGYGVTHYAAF-GRDGSRMVMQILTPRKYERKLMD
Y2131_STAA8      LGYTVVNVTSAEYELD--LPNELRNLGYGVTHYAAF-GRDGSRMVMQILTPRKYERKLMD
Y1911_STAAM      LGYTVVNVTSAEYELD--LPNELRNLGYGVTHYAAF-GRDGSRMVMQILTPRKYERKLMD
Y1852_STAAW      LGYTVVNVTSAEYELD--LPNELRNLGYGVTHYAAF-GRDGSRMVMQILTPRKYERKLMD
Y1835_STAAS      LGYTVVNVTSAEYELD--LPNELRNLGYGVTHYAAF-GRDGSRMVMQILTPRKYERKLMD
Y1896_STAA1      LGYTVVNVTSAEYELD--LPNELRNLGYGVTHYAAF-GRDGSRMVMQILTPRKYERKLMD
Y1973_STAAC      LGYTVVNVTSAEYELD--LPNELRNLGYGVTHYAAF-GRDGSRMVMQILTPRKYERKLMD
Y2004_STAAR      LGYTVVNVTSAEYELD--LPNELRNLGYGVTHYAAF-GRDGSRMVMQILTPRKYERKLMD
Y1848_STAAB      LGYTVVNVTSAEYELD--LPNELRNLGYGVTHYAAF-GKDGSRMVMQILTPRKYERKLMD
Y1892_STAA3      LGYTVVNVTSAEYELD--LPNELRNLGYGVTHYAAF-GRDGSRMVMQILTPRKYERKLMD
Y1595_STAES      LGYTVVNVTSSEYELD--LPNELRNLGYGVTHYEAF-GRDGSRMVMQILTPRKYELKLMD
Y1448_STAEQ      LGYTVVNVTSSEYELD--LPNELRNLGYGVTHYEAF-GRDGSRMVMQILTPRKYELKLMD
Y1041_STAHJ      LGYTVVNVTSSEYEID--LPNELRNLGYGVTHYAAH-GRDGSRMVMQILTPRRYERKLME
Y880_STAS1       LGYTVVNVTSSEYELD--LPRQLRDLGYGVTHNTAY-GRDGKRLILQILTPRRFEFKLID
Y1776_LISMO      LGYITVNVITKEYNLD--LPNQIRDLGYGVTSWLAS-GRDGERMMLEILTQRKNERKLYK
Y1801_LISMF      LGYITVNVITKEYNLD--LPNQIRDLGYGVTSWLAS-GRDGERMMLEILTQRKNERKLYK
Y1888_LISIN      LGYITVNVITKEYNLD--LPNQIRDLGYGVTSWLAS-GRDGERMMLEILTQRKNERKLYK
Y1794_LISW6      LGYITVNVITKEYNLD--LPNQIRDLGYGVTSWIAS-GRDGERMMLEILTQRKNERKLYK
Y1609_ENTFA      LGYIMVSVILPSTTEQFHLPETLREHGYGVTQSVAY-GREGERMVLEILSPRKNERTLYK
Y1140_LACPL      LGYTMISVILPDPKSS--LPGVLRENGFGVTQHAAY-GLEGERLELEILAPRKNERRLYG
Y1893_DESHY      LGYIMAQVIVECEYQG--LAGELRDAGFGVTSWLGE-GKTGPRMVMMVLAKRNRQKELLN
Y2077_SYMTH      LGYVLFQV-ITTRIGE--LAPALREHGLGVTDWRAE-GRMGQREVLMVVARRKNGPQVVR
Y526_SYNWW       LGYRGVQVTIDSEHGH--IVEELREEGFPVTCWEAS-GKAGSKLVLNIFLKRNMAVAVAD
Y605_METB6       IGYVIVRLITPSDPQA--LMSRLSTLGYGMTRIEGTGSFSGSVSIIFMIVPRKELSRLLS
                 :*                .   :   .          .       :     *        

Y2434_PELCD      MVKQFNPRAFYTIEDVR-FVQDNLPV--VPRRHGIMSRLALRNRK---------------
Y1511_METMJ      AIHEFNPKAFYSVEDIRRAAEGTFPVT-VPGPTPFSFGRVIRRGK---------------
Y543_METHJ       LIRDFNPHAFYTIEDVRSASEGIYPIEDKNNPFSIFKRPFLFIGKRK-------------
Y2213_HUNT2      IIEECNSKAFYSIEDARKVNQGIFRTGTSNHDGTRFFNLFRIHRMSGLDKKTR-------
Y791_METB6       HIEETNPGAFFSIEDVRYVNQGVFRPK-KQNPFTGFIHTLARPRKRV-------------
Y597_LEPBJ       IVKSVEPDVFYSIENARSTNTAVSEDS-PGLLRIGILEKILKVRK---------------
Y2483_LEPBL      IVKSVEPDVFYSIENARSTNTAVSEDS-PGLLRIGILEKILKVRK---------------
Y606_LEPIN       IVQNVEPDVFYSIENARRTNTTTFEDS-PGLLRRGILEKILKIRK---------------
Y2973_LEPIC      IVQNVEPDVFYSIENARRTNTTTFEDS-PGLLRRGILEKILKIRK---------------
Y1367_PSYIN      LIKDLDPTAVYSVSDVKSVYEGPDIFPRRSLLHSTLMLLGKR------------------
Y566_SACD2       LIKELDASAVYSVSDVKSVYEGPEPLPRRLFFR---------------------------
Y2502_DESAG      IARNVDPECYMVVDDIRKTYTVGG------------------------------------
Y632_CLOB1       TIEGSDINAMISVNDIKTVYGGYGIRK---------------------------------
Y591_CLOBH       TIEGSDINAMISVNDIKTVYGGYGIRK---------------------------------
Y673_CLOBL       TIEGSDINAMISVNDIKTVYGGYGIRK---------------------------------
Y3420_BACAN      IINEIAPKAFMSSYEIRSFKGGYLTKAMKKRA---LMKKKDHHVS---------------
Y3064_BACCZ      IINEIAPKAFMSSYEIRSFKGGYLTKAMKKRA---LMKKKDHHVS---------------
Y3038_BACAH      IINEIAPKAFMSSYEIRSFKGGYLTKAMKKRA---LMKKKDHHVS---------------
Y3154_BACHK      IINEIAPKAFMSSYEIRSFKGGYLTKAMKKRA---LMKKKDHHVS---------------
Y3390_BACC1      IINEIAPKAFMSSYEIRSFKGGYLTKAMKKRA---LMKKKDEHAS---------------
Y3353_BACCR      IINEIAPKAFMSSYEIRSFKGGYLTKAMKKRA---LMKKKDEHAS---------------
Y1774_BACSK      IVSEYEPQAFIVSFEPRNFKGGYITKAMKKRREKYLKRKAKEDAH---------------
Y803_GEOTN       LIERYEPKAFIISYEPRRFKGGFLVASMKKRV----KRKKECHES---------------
Y682_BACVZ       TIKTLDEKAFMIAFEPKTIHGGFWVKAVKKRRIKE-------------------------
YEBE_BACSU       TIKTLDSKAFIIAYEPKTIHGGFWVKAVKKRRIKE-------------------------
Y594_BACP2       TIKTLDSKAFIISYEPKSIHGGFWVKAVKKRRIKE-------------------------
Y691_BACLD       TIKSIDSKAFIISYEPKTIHGGFWVKAVKKRRIKE-------------------------
Y738_OCEIH       TIQEIDPKAFIISYEPKRIHGGFWVKQVRKGKLMNPKKKKNTNTVESENEQK--------
Y621_BACHD       TIKKLDPKAFIISHEPKTFFGGFWVKGIRR------------------------------
Y1727_STAAN      TIKNLDPKAFIIAYEPRNIHGGFWTKGIRRRKLKDYEPEELESVVEHEIQSK--------
Y2131_STAA8      TIKNLDPKAFIIAYEPRNIHGGFWTKGIRRRKLKDYEPEELESVVEHEIQSK--------
Y1911_STAAM      TIKNLDPKAFIIAYEPRNIHGGFWTKGIRRRKLKDYEPEELESVVEHEIQSK--------
Y1852_STAAW      TIKNLDPKAFIIAYEPRNIHGGFWTKGIRRRKLKDYEPEELESVVEHEIQSK--------
Y1835_STAAS      TIKNLDPKAFIIAYEPRNIHGGFWTKGIRRRKLKDYEPEELESVVEHEIQSK--------
Y1896_STAA1      TIKNLDPKAFIIAYEPRNIHGGFWTKGIRRRKLKDYEPEELESVVEHEIQSK--------
Y1973_STAAC      TIKNLDPKAFIIAYEPRNIHGGFWTKGIRRRKLKDYEPEELESVVEHEIQSK--------
Y2004_STAAR      TIKNLDPKAFIIAYEPRNIHGGFWTKGIRRRKLKDYEPEELESVVEHEIQSK--------
Y1848_STAAB      TIKNLDPKAFIIAYEPRNIHGGFWTKGIRRRKLKDYEPEELESVVEHEIQSK--------
Y1892_STAA3      TIKNLDPKAFIIAYEPRNIHGGFWTKGIRRRKLKDYEPEELESVVEHEIQSK--------
Y1595_STAES      TVKNLDPKAFIIAYEPRNIHGGFWVKGVRKRKLKAYEPEQLEVVVDHEEIVGGSSNEQKV
Y1448_STAEQ      TVKNLDPKAFIIAYEPRNIHGGFWVKGVRKRKLKAYEPEQLEVVVDHEEIVGGSSNEQKV
Y1041_STAHJ      TVRNLDEKAFIIAYEPRAIHGGFWTKGVRTRKVKAYEVEEIESVVEHDDEVQSK------
Y880_STAS1       TIKQIDEKAFIVAYEPRQIHGGFWAKGVRSKKLKQYDTDEVESI----------------
Y1776_LISMO      HIIEIDNGAFIVSSEPKQIHGGFWVKQVRK------------------------------
Y1801_LISMF      HIIEIDNGAFIVSSEPKQIHGGFWVKQVRK------------------------------
Y1888_LISIN      QIIEIDNGAFIVSSEPKQIHGGFWIKQVRK------------------------------
Y1794_LISW6      QIIEIDNGAFIVSSEPKQIHGGFWIKQVRK------------------------------
Y1609_ENTFA      LINQLEPRAFIISYEPKFISGGFWTKKVRKRNDAISH-----------------------
Y1140_LACPL      LIKDAAPNAFVIAYEPRYISGGFWLKRVKRRNARRKKQ----------------------
Y1893_DESHY      RIDSLCSNAFVIFEEPKNFRGGFWAKKVLH------------------------------
Y2077_SYMTH      LLEELDPQAFVVQLDASWYRGGFIQKMLQ-------------------------------
Y526_SYNWW       KIYEKDPDAFVVFMEPKHFQGGYIKKK---------------------------------
Y605_METB6       IISREYPDLLYTIEDVRNIKDGARIFYQDPKRRILSFFGM--------------------
                               :