CLUSTAL format seed alignment for MF_01517

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MDH_MYCBO       -----MSASPLKVAVTGAAGQIGYSLLFRLASGSLLGPDRPIELRLLEIE--PALQALEG
MDH_MYCBP       -----MSASPLKVAVTGAAGQIGYSLLFRLASGSLLGPDRPIELRLLEIE--PALQALEG
MDH_MYCTU       -----MSASPLKVAVTGAAGQIGYSLLFRLASGSLLGPDRPIELRLLEIE--PALQALEG
MDH_MYCUA       -----MSASPLKVAVTGAAGQIGYSLLFRLASGSLLGPDRPIELRLLEIE--PALKALEG
MDH_MYCPA       -----MSASPLKVAVTGAAGQIGYSLLFRLASGSLLGPDRPIELRLLEIE--PALKALEG
MDH_MYCA1       -----MSASPLKVAVTGAAGQIGYSLLFRLASGSLLGPDRPIELRLLEIE--PALKALEG
MDH_MYCLE       -----MSPRPLKVAVTGAAGQIGYSLLFRLASGSLLGLDRPIELRLLEIE--PALKALEG
MDH_NOCSJ       -----MSSTPLKVAVTGAAGQIGYSLLFRLASGSLLG-DRPIELRLLEIT--PALKALEG
MDH_PAEAT       ------MSSPIKIAVTGAAGQIGYSLLFRIASGALFGGDTPVQLRLLEIT--PALKALEG
MDH_CUTAK       -----MTQTPVKIAVTGAAGQICYSLLFRIASGSLLG-DTPIELRLLEIT--PALKALEG
MDH_MYCVP       --MSSTTASPVTVAVTGAAGHIGYAALFRIAAGAMLGHTTPVTLRLLELP--DAVRAAEG
MDH_RHOJR       ---MAQSPPPAVVTVTGAAGSIGYASLFRIAAGEMLGPDTPIRLRLLEIP--SAVSAAEG
MDH_STRAW       -----MTRTPVNVTVTGAAGQIGYALLFRIASGQLLGADVPVKLRLLEIT--PALKAAEG
MDH_STRCO       -----MTRTPVNVTVTGAAGQIGYALLFRIASGQLLGADVPVKLRLLEIT--PALKAAEG
MDH_THEFY       -----MAKAPVNVTVTGAAGQIGYALLFRIASGQLLGVDTPVRLRLLEIP--QAIKAAEG
MDH_SACEN       -----MTQAPVTVTVTGAAGQIGYALLFRIASGQLIGPDTPVRLRLLEIP--QAVKAAEG
MDH_FRAAA       -----MSSTPVNVTVTGAAGQIGYALLFRIASGQLLGADTPVRLRLLEIP--QAVRAAEG
MDH_FRACC       -----MSSTPVNVTVTGAAGQIGYALLFRIASGQLLGADTPVKLRLLEIP--QAVRAAEG
MDH_NOCFA       -MSTADRTAPVTVTVTGAAGQIAYGLLFRIASGAMLGPHTPIRLRLLEIP--AAVASLEG
MDH_RUBXD       --------MSKTVTVTGAAGAIGYAILFRIASGQMLGPDQKLRLKLLEIE--PALKAAEG
MDH_CORGL       -MNSPQNVSTKKVTVTGAAGQISYSLLWRIANGEVFGTDTPVELKLLEIP--QALGGAEG
MDH_CORGB       -MNSPQNVSTKKVTVTGAAGQISYSLLWRIANGEVFGTETPVELKLLEIP--QALGGAEG
MDH_COREF       -MNSP-----KKITVTGAAGQIAYSLLWRIANGEVYGADTPVELNLLEIP--DALGGAEG
MDH_CORDI       -----MTESVKKIAVTGAAGQIAYSLLWRIANGDVYGKNTPVELQLLEIP--QAIGGAEG
MDH_ACISJ       -----MSKKPVRVAVTGAAGQIGYALLFRIASGEMLGKDQPVILQLLEIPDEKAQNALKG
MDH_ACIAC       -----MSKKPVRVAVTGAAGQIGYALLFRIASGEMLGKDQPVILQLLEIPDEKAQKALKG
MDH_METPP       -----MSKKPVRVAVTGAAGQIGYALLFRIASGEMLGKDQPVILQLLEIPDEKAQKALKG
MDH_POLNA       -----MSKKPVRVAVTGAAGQIGYALLFRIASGEMLGKDQPVILQLLEVPVEGPQKALKG
MDH_POLSJ       -----MSKKPVRVAVTGAAGQIGYALLFRIASGEMLGKDQPVILQLLEVPVEGPQKALKG
MDH1_RHOFT      -----MSKKPVRVAVTGAAGQIGYAILFRIASGEMLGKDQPVILQLLEVPVEKAQQALQG
MDH_VEREI       -----MNKKPVRVAVTGAAGQIGYALLFRIASGEMLGKDQPVILQLLEVPAEGPQKALNG
MDH_CUPPJ       -----MAKAPMRVAVTGAAGQIGYSLLFRIANGDMLGKDQPVILQLLDLP--QAQAAVKG
MDH_CUPNH       -----MAKAPMRVAVTGAAGQIGYSLLFRIANGDMLGKDQPVILQLLDLP--QAQQAVKG
MDH_CUPMC       -----MAKAPMRVAVTGAAGQIGYSLLFRIANGDMLGKDQPVILQLLDLP--QAQAAVKG
MDH_RALSO       -----MAKAPMRVAVTGAAGQIGYALLFRIAAGEMLGKDQPVILQLLEIPDEKAQKALKG
MDH_AQUAR       -----MAKTPMRVAVTGAAGQICYSLLFRIANGDMLGKDQPVILQLLEIPNEKAQKALQG
MDH_ACIAD       ------MKQPVRVAVTGAAGQIGYSLLFRIASGEMLGKDQPVILQLLEIPVEKAQQALKG
MDH_ACIBT       ------MKQPVRVAVTGAAGQIGYSLLFRIASGEMLGKDQPVILQLLEVPVEKAQQALKG
MDH_XANAC       ------MKAPVRVAVTGAAGQIGYALLFRIASGEMLGKDQPVILQLLELPIEKAQAALKG
MDH_XANC5       ------MKAPVRVAVTGAAGQIGYALLFRIASGEMLGKDQPVILQLLELPIEKAQAALKG
MDH_XANCP       ------MKAPVRVAVTGAAGQIGYALLFRIASGEMLGKDQPVILQLLELSNEKAQAALKG
MDH_XANC8       ------MKAPVRVAVTGAAGQIGYALLFRIASGEMLGKDQPVILQLLELSNEKAQAALKG
MDH_XANOR       ------MKAPVRVAVTGAAGQIGYALLFRIASGEMLGKDQPVILQLLELSNEKAQAALKG
MDH_XANOM       ------MKAPVRVAVTGAAGQIGYALLFRIASGEMLGKDQPVILQLLELSNEKAQAALKG
MDH_XYLFA       ------MKSLVRVAVTGAAGQIGYSLLFRIAAGEMFGKDRPVILQMLELPDEKAQAALKG
MDH_XYLFT       ------MKALVRVAVTGAAGQIGYSLLFRIAAGEMFGKDRPVILQMLELPDEKAQAALKG
MDH_BURP0       -----MAKPAKRVAVTGAAGQIAYSLLFRIANGDLLGKDQPVILQLLDLP--QAQAAVKG
MDH_BURP1       -----MAKPAKRVAVTGAAGQIAYSLLFRIANGDLLGKDQPVILQLLDLP--QAQAAVKG
MDH_BURMA       -----MAKPAKRVAVTGAAGQIAYSLLFRIANGDLLGKDQPVILQLLDLP--QAQAAVKG
MDH_BURPS       -----MAKPAKRVAVTGAAGQIAYSLLFRIANGDLLGKDQPVILQLLDLP--QAQAAVKG
MDH_BURCM       -----MAKPAKRVAVTGAAGQIAYSLLFRIANGDLLGKDQPVILQLLDLP--QAQAAVKG
MDH1_BURTA      -----MAKPAKRVAVTGAAGQIAYSLLFRIANGDLLGKDQPVILQLLDLP--QAQAAVKG
MDH_BURCA       -----MAKPAKRVAVTGAAGQIAYSLLFRIANGDLLGKDQPVILQLLDLP--QAQGAVKG
MDH_BURCH       -----MAKPAKRVAVTGAAGQIAYSLLFRIANGDLLGKDQPVILQLLDLP--QAQGAVKG
MDH_BURL3       -----MAKPAKRVAVTGAAGQIAYSLLFRIANGDLLGKDQPVILQLLDLP--QAQGAVKG
MDH_PARXL       -----MAKPAKRVAVTGAAGQIAYSLLFRIANGDLLGKDQPVILQLLDLP--QAQGAVKG
MDH_CHRVO       ------MKAPVRVAVTGAAGQIGYSLLFRIASGEMLGKDQPVILHLLDLP--QAQTALKG
MDH_BORBR       -----MSKPALRVAVTGAAGQIGYALLFRIASGEMLGKDQPVILQLLEIPDEKAQKALKG
MDH_BORPA       -----MSKPALRVAVTGAAGQIGYALLFRIASGEMLGKDQPVILQLLEIPDEKAQKALKG
MDH_BORPE       -----MSKPALRVAVTGAAGQIGYALLFRIASGEMLGKDQPVILQLLEIPDEKAQKALKG
MDH_BORA1       -----MSKPAMRVAVTGAAGQIGYALLFRIASGEMLGKDQPVILQLLEIPDEKAQKALKG
MDH_SYNFM       -----MAKKPVRVTVTGAAGQIGYALLFRVASGQMLGPDQPIILQMLELPIDKVQAALKG
MDH_BDEBA       ------MKAPVRVAVTGAAGQIGYALLFRIASGAMLGADQPVILQLLEIPDEKAQKALKG
MDH_AROAE       -----MSKAPVRVAVTGAAGQIGYSLLFRIASGEMLGKDQPVILQLLDLP--QAQKAVKG
MDH_DECAR       -----MSKAPMRVAITGAAGQIGYSLLFRIASGEMLGKDQPVILQLLDLP--QAQQAVKG
MDH_AZOSB       -----MSKAPVRVAVTGAAGQIGYSLLFRIASGEMLGKDQPVILQLLDLP--QAQKAVKG
MDH2_RHOFT      -----MNQAPVRVTVTGAAGRVAYALLFRIASGDMLGADQPVQLVLFDLP--HAMKAMQG
MDH2_BURTA      -----MNTEAKRIAVSGAAGQIAYSLLFRIAQGDLLGEDQPVILQLLDLP--QAYGAVQG
MDH_NITEU       ------MSSPIRIAVTGAAGQISYSLLFRIAAGDMLGSSQPVILQLLDIP--ESGKVLDG
MDH_NITEC       ------MLSPVRITVTGAAGQISYSLLFRIAAGDMLGSNQPVILQLLDIP--ESRKILDG
MDH_NITMU       ------MKTPIRVAVTGAAGQIAYSLLFRIAAGDMLGEDQPVILQLLDIP--QSLPSLKG
MDH_DEIGD       MTMNQGTKQPVRVAVTGAAGQIGYSLLFRIAAGDMLGKDQPVILQLLEIT--PALKALAG
MDH_DEIRA       ----MTMKQPVRVAVTGAAGQIGYSLLFRIAAGDMLGQDQPVILQLLEIT--PALKALNG
MDH_THETH       ------MKAPVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLEIP--QAMKALEG
MDH_THET2       ------MKAPVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLEIP--QAMKALEG
MDH_THET8       ------MKAPVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLEIP--QAMKALEG
MDH_PSYA2       ----MSMKQPVRVAVTGAAGNISYAMLFRIASGEMLGKDQPVILQLLEIA--PALDALKG
MDH_PSYCK       ----MSMKQPVRVAVTGAAGNISYAMLFRIASGEMLGKDQPVILQLLEIA--PALDALKG
MDH_ALCBS       ----MFMKAPVRVAVTGAAGQISYSLLFRIASGDMLGKDQPVILQLLEIT--PALEALNG
MDH_SACD2       ------MKAPVRVAVTGAAGQISYSLLFRIAAGEMLGKDQPVILQMLEIT--PALEALKG
MDH_ALKEH       ------MKAPVRVAVTGAAGQIGYSLLFRIASGDMLGKDQPVILQLLEIT--PALEALKG
MDH_HALHL       ------MKAPVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVTLQLLEIP--QAQEALQG
MDH_METCA       ------MKTPVHVAVTGAAGQIAYSLLFRIAVGDLFGPHQPVILKLLDVP--SAERVLEG
MDH_LEGPA       -----MTNNRVRVAVTGAAGQIGYALVFRIASGQMFGPNTEVELNLLELE--PALPSLEG
MDH_LEGPH       -----MTNNRVRVAVTGAAGQIGYALVFRIASGQMFGPNTEVELNLLELE--PALPSLEG
MDH_LEGPL       -----MTNNRVRVAVTGAAGQIGYALVFRIASGQMFGPNTEVELNLLELE--PALPSLEG
MDH_COXBU       ------MAKHVKVAVTGAAGQIGYALLFRLASGQAFGLDTTVDLHLLEIE--PALPALKG
MDH_LEPIN       ------MSKTVKVAVTGAAGQIGYSLLFRIASGQMFGADTAVEIQMLELE--AAIPAAKG
MDH_LEPIC       ------MSKTVKVAVTGAAGQIGYSLLFRIASGQMFGADTAVEIQMLELE--AAIPAAKG
MDH_LEPBJ       ------MGKTVKVAVTGAAGQIGYSLLFRIASGQMFGTDTAVEIQMLELE--AAIPAAKG
MDH_LEPBL       ------MGKTVKVAVTGAAGQIGYSLLFRIASGQMFGTDTAVEIQMLELE--AAIPAAKG
MDH_MAGMM       ------MADPIRVAVTGAAGQIAYSLLVRLASGQLFGKDRKVELKLLEIP--QAMGPLEG
MDH_CHLTR       -----MVSQTVSVAVTGGTGQIAYSFLFSLAHGDVFGLDCGIDLRIYDIP--GTERALSG
MDH_CHLTA       -----MVSQTVSVAVTGGTGQIAYSFLFSLAHGDVFGLDCGIDLRIYDIP--GTERALSG
MDH_CHLMU       -----MFSQTVSVAVTGGTGQIAYCFLFALAHGDIFGPDTGIDLRIYDIP--GTERSLSG
MDH_CHLAB       --MVMKLTRTVSVAVTGGTGQIAYSFLFALAHGDVFGSDCGIDLRIYDLP--GLERVLSG
MDH_CHLFF       ----MKLARTVSVAVTGGTGQIAYSFLFALAHGDVFGSDCGIDLRVYDLP--GLERVLSG
MDH_CHLCV       --MIMKLMRTVSVAVTGGTGQIAYSFLFALAHGDVFGSDCSIDLRVYDLP--GLERALSG
MDH_CHLPN       ----MAFKEVVRVAVTGGKGQIAYNFLFALAHGDVFGVDRGVDLRIYDVP--GTERALSG
MDH_PARUW       ------MSQPIKIAISGGAGQIAYSLLFRLASGELFGPNQLIELQVLEVP--NALSALEG
                            ::::*. * : *  :  :* *   *    : : : ::          *

MDH_MYCBO       VVMELDDCAFPLLSGVEIGSDPQKIFDGVSLALLVGARPRGAGMERSDLLEANGAIFTAQ
MDH_MYCBP       VVMELDDCAFPLLSGVEIGSDPQKIFDGVSLALLVGARPRGAGMERSDLLEANGAIFTAQ
MDH_MYCTU       VVMELDDCAFPLLSGVEIGSDPQKIFDGVSLALLVGARPRGAGMERSDLLEANGAIFTAQ
MDH_MYCUA       VVMELDDCAFPLLSGVEIGSDANKIFDGANLALLVGARPRGPGMERSDLLEANGAIFTAQ
MDH_MYCPA       VVMELDDCAFPLLSGVEIGADPNKIFDGANLALLVGARPRGPGMERSDLLEANGAIFTAQ
MDH_MYCA1       VVMELDDCAFPLLSGVEIGADPNKIFDGANLALLVGARPRGPGMERSDLLEANGAIFTAQ
MDH_MYCLE       VVMELDDCAFLLLAGVEIGADPNKVFDGVNLALLVGARPRGPGMERGDLLEANGAIFTAQ
MDH_NOCSJ       VVMELDDCAFPNLAGVQIGDDAEQIFDGVNLALLVGARPRGPGMERGDLLSANGAIFTAQ
MDH_PAEAT       VVMELDDCAFPALDSVEIGDDADHIFDGVTLALLVGARPRSKGMERGDLLSANGAIFTAQ
MDH_CUTAK       VVMELDDCAFGNLVNIEIGDDPKKVFDGVNAAFLVGAMPRKAGMERSDLLTKNGAIFTAQ
MDH_MYCVP       VVMELEDGAFPLLAGTEIYDDPTRAFDGVDVALLIGARPRTKGMERADLLGANAEIFATS
MDH_RHOJR       TAMELDDSAFPLLRDIEVHDDPKRGFDGTDVALLIGSRPRSKGMERGDLLAANGQIFTVQ
MDH_STRAW       TAMELDDCAFPLLQGIDITDDPNVAFDGTNVGLLVGARPRTKGMERGDLLSANGGIFKPQ
MDH_STRCO       TAMELDDCAFPLLQGIEITDDPNVAFDGANVALLVGARPRTKGMERGDLLEANGGIFKPQ
MDH_THEFY       TAMELDDCAFPLLAGVDIYDDPRKAFDGVNVALLVGARPRTKGMERRDLLEANGGIFGPQ
MDH_SACEN       TAMELDDCAFPLLQGIEVTDDARTAFDGTNVALLVGARPRTKGMERGDLLEANGGIFKPQ
MDH_FRAAA       TALELEDSAFPLLAGVDVFDDAKRAFEGTNVALLVGARPRTKGMERGDLLSANGGIFKPQ
MDH_FRACC       TALELEDSAFPLLAGVDVFDDAKRAFEGTNVALLVGARPRTKGMERGDLLSANGGIFKPQ
MDH_NOCFA       VAMELEDGAFPLLDAIDISDDPWTGFAGANVALLVGARPRTAGMERADLLAANGPIFTDQ
MDH_RUBXD       TAMELYDCAFPLLEAVDITADPKEAFDGANVCLLIGARPRQRGMERADLLEANGQIFKPQ
MDH_CORGL       VAMELLDSAFPLLRNITITADANEAFDGANAAFLVGAKPRGKGEERADLLANNGKIFGPQ
MDH_CORGB       VAMELLDSAFPLLRNITITADANEAFDGANAAFLVGAKPRGKGEERADLLANNGKIFGPQ
MDH_COREF       VAMELSDSAFPLLHNINITADLNEAFDGANAAFLVGAKPRGKGEERAALLSNNGKIFGPQ
MDH_CORDI       VAMELLDSAFPLLKNIVVTDKAEVAFDGTNAAFLVGAKPRGKGEERADLLTANGKIFGPQ
MDH_ACISJ       VIMELEDCAFPLLAGIEAHSDPMTAFKDTDYALLVGARPRGPGMERADLLAANAQIFTAQ
MDH_ACIAC       VMMELEDCAFPLLAGMEAHSDPMTAFKDTDYALLVGARPRGPGMERADLLAANAQIFTAQ
MDH_METPP       VMMELEDCAFPLLAGMEAHGDPMTAFKDADYALLVGSRPRGPGMERAELLSINGAIFTAQ
MDH_POLNA       VMMELDDCAFPLLVEMTAHSDPMTAFKDADYALLVGSRPRGPGMERAELLAVNGAIFTAQ
MDH_POLSJ       VMMELDDCAFPLLAGMEAHSDPMTAFKDADYALLVGSRPRGPGMERAELLAVNGAIFTAQ
MDH1_RHOFT      VMMELQDCAFPLLAGMEAHSDPMTAFKDVDYALLIGSRPRGPGMERAELLAVNGAIFTAQ
MDH_VEREI       VMMELDDCAFPLLAGMTAHSDPMAAFKDADYALLVGSRPRGPGMERAELLAVNGAIFIAQ
MDH_CUPPJ       VVMELEDCAFPLLAGVVITDDPKVAFKDADVALLVGARPRSKGMERKDLLEANAQIFTVQ
MDH_CUPNH       VVMELEDCAFPLLAGVVITDDPKVAFKDADVALLVGARPRSKGMERKDLLEANAQIFTVQ
MDH_CUPMC       VVMELEDCAFPLLAGVVITDDPKVAFKDADVALLVGARPRSKGMERKDLLEANAQIFTVQ
MDH_RALSO       VMMEIEDCAFPLLAGMEAHADPMTAFKDVDVALLVGARPRGPGMERKDLLSANAQIFTAQ
MDH_AQUAR       VMMEIDDCAFPLLAGMTAHADPMTAFKDADVALLVGARPRGPGMERKDLLEANAQIFTVQ
MDH_ACIAD       VMMELDDCAFPLLAGMIGTDDPKVAFKDADYALLVGSRPRGPGMERADLLKVNGEIFIGQ
MDH_ACIBT       VMMELDDCAFPLLAGMIGTDDPKVAFKDADYALLVGSRPRGPGMERADLLKVNGEIFIGQ
MDH_XANAC       VMMELEDCAFPLLAGMVGTDDAEVAFKDVDVALLVGSRPRGPGMERKDLLLANAEIFTAQ
MDH_XANC5       VMMELEDCAFPLLAGMVGTDDAEVAFKDVDIALLVGSRPRGPGMERKDLLLANAEIFTAQ
MDH_XANCP       VMMELEDCAFPLLAGMVGTDDAEVAFKDIDVALLVGARPRGPGMERKDLLLENAKIFTAQ
MDH_XANC8       VMMELEDCAFPLLAGMVGTDDAEVAFKDIDVALLVGARPRGPGMERKDLLLENAKIFTAQ
MDH_XANOR       VMMELEDCAFPLLAGMVGTDDAEVAFKDIDVALLVGARPRGPGMERKDLLLENAKIFTAQ
MDH_XANOM       VMMELEDCAFPLLAGMVGTDDAEVAFKDIDVALLVGARPRGPGMERKDLLLENAKIFTAQ
MDH_XYLFA       VMMELEDCAFPLLAGMVGTDNPDIAFKDADVALLVGSRPRGPGMERKDLLMENAKIFTAQ
MDH_XYLFT       VMMELEDCAFPLLAGMVVTDNPDIAFKDADAALLVGSRPRGPGMERKDLLMENAKIFTAQ
MDH_BURP0       VVMELDDCAFPLLAGVVITDDPKVAFKDADVALLVGARPRSKGMERKDLLSANAEIFTVQ
MDH_BURP1       VVMELDDCAFPLLAGVVITDDPKVAFKDADVALLVGARPRSKGMERKDLLSANAEIFTVQ
MDH_BURMA       VVMELDDCAFPLLAGVVITDDPKVAFKDADVALLVGARPRSKGMERKDLLSANAEIFTVQ
MDH_BURPS       VVMELDDCAFPLLAGVVITDDPKVAFKDADVALLVGARPRSKGMERKDLLSANAEIFTVQ
MDH_BURCM       VVMELDDCAFPLLAGVVITDDPKVAFKDADVALLVGARPRSKGMERKDLLSANAEIFTVQ
MDH1_BURTA      VVMELDDCAFPLLAGVVITDDPKVAFKDADVALLVGARPRSKGMERKDLLSANAEIFTVQ
MDH_BURCA       VVMELDDCAFPLLAGVVITDDPKVAFKDADVALLVGARPRSKGMERKDLLSANAEIFTVQ
MDH_BURCH       VVMELDDCAFPLLAGVVITDDPKVAFKDADVALLVGARPRSKGMERKDLLSANAEIFTVQ
MDH_BURL3       VVMELDDCAFPLLSGVVITDDPKVAFKDADVALLVGARPRSKGMERKDLLSANAEIFTVQ
MDH_PARXL       VVMELDDCAFPLLSGVVITDDPKVAFKDADVALLVGARPRSKGMERKDLLSANAEIFTVQ
MDH_CHRVO       VMMELEDCAFPLLAGMVATDDPNVAFKDVKVALLVGARPRSKGMERKDLLEANGAIFTVQ
MDH_BORBR       VIMELEDCAFPLLHEVTAHSDPRTAFKDADVALLVGARPRGPGMERKDLLSVNAQIFTAQ
MDH_BORPA       VIMELEDCAFPLLHEVTAHSDPRTAFKDADVALLVGARPRGPGMERKDLLSVNAQIFTAQ
MDH_BORPE       VIMELEDCAFPLLHEVTAHSDPRTAFKDADVALLVGARPRGPGMERKDLLSVNAQIFTAQ
MDH_BORA1       VIMELEDCAFPLLQEVTAHADPKTAFKDADVALLVGARPRGPGMERKDLLTVNAQIFTAQ
MDH_SYNFM       VMMELEDCAFPLLADMIGTGDPKVAFKDSDYALLVGARPRGPGMERKDLLLENAKIFIEQ
MDH_BDEBA       VMMELEDCAFPLLHSMIATGDPAVAFKDADVALLVGARPRGPGMERKDLLTANGQIFTVQ
MDH_AROAE       VMMELEDCAFPLLAGMVATDDPNVAFKDADYCLLVGARPRGPGMERADLLTANGAIFTVQ
MDH_DECAR       VMMELEDCAFPLLAGMVATDDPNVAFKDADVCLLVGARPRTKGMERADLLTANGAIFTVQ
MDH_AZOSB       VMMELEDCAFPLLAGMIATDDPNVAFKDAKVALLVGARPRGPGMERKDLLTENAKIFTVQ
MDH2_RHOFT      VVMELEDCAFPLLTEIIATDDPVLAFSDTQIALLVSARPRAVGAERLEVLADNAKIFAAQ
MDH2_BURTA      VVMELQDCAFPLLKEIQVATDPHAAFLNADYAFLVGSKPRTKGMERRDLLAENAAIFRTQ
MDH_NITEU       VLMELQDCAFPLLTDIIVTHDPMIAFDQADIAILVGARPRGKGMERKDLLQTNGEIFREQ
MDH_NITEC       VVMELQDCAFPLLAGIIATHDPMMAFDQTDIAILVGARPRRKGMERKDLLQTNGEIFRNQ
MDH_NITMU       VVMELDDCAFPLLRDITITDDPKTAFRDINIAMLVGARPRTKGMERKDLLEANGTIFRAQ
MDH_DEIGD       VVMELRDCAFPLLADIVTSDDPLVAFKDADYALLVGAMPRKAGMERGDLLGANGGIFKPQ
MDH_DEIRA       VVMELRDGAFPLLADVITSDDPMVAFKDADYALLVGAMPRKAGMERGDLLGANGGIFKPQ
MDH_THETH       VVMELEDCAFPLLAGLEATDDPKVAFKDADYALLVGAAPRKAGMERRDLLQVNGKIFTEQ
MDH_THET2       VVMELEDCAFPLLAGLEATDDPKVAFKDADYALLVGAAPRKAGMERRDLLQVNGKIFTEQ
MDH_THET8       VVMELEDCAFPLLAGLEATDDPKVAFKDADYALLVGAAPRKAGMERRDLLQVNGKIFTEQ
MDH_PSYA2       VVMELEDCAFPLLAGIVQTDDATVAFKDVDYALLVGSRPRGPGMERKDLLEANAAIFSAQ
MDH_PSYCK       VVMELEDCAFPLLAGVVQTDDATVAFKDVDYALLVGSRPRGPGMERKDLLEANAAIFSAQ
MDH_ALCBS       VIMELEDCAFPLVAGITGTDDANVAFKDADYALLVGARPRGPGMERKDLLEANAAIFSAQ
MDH_SACD2       VAMELDDCAFPLLAGMVCSDDPNVAFKDADYALLVGARPRGPGMERKDLLEANAAIFSVQ
MDH_ALKEH       VVMELEDCAFPLVSGITTSDKAEEAFKDADIALLVGARPRGPGMERKDLLEANAAIFSAQ
MDH_HALHL       TVMELEDCAFPLVDGIIATDSAEEAFRDADYVLLVGAKPRGPGMERKDLLEANAAIFSAQ
MDH_METCA       VAMELDDCASPLLQEIEVSSDPAEVFDGAEAVFMLGATPRGPGMERRDLLQVNADIFSAQ
MDH_LEGPA       VAMELDDCAFPLLKRIVCTADLNKAMDGVNWALLVGSVPRKQGMERSDLLQINGGIFTKQ
MDH_LEGPH       VAMELDDCAFPLLKRIVCTADLNKAMDGVNWALLVGSVPRKQGMERSDLLQINGGIFTKQ
MDH_LEGPL       VAMELDDCAFPLLKRIVCTADLNKAMDGVNWALLVGSVPRKQGMERSDLLQINGGIFTKQ
MDH_COXBU       VVMELEDCAFPLLRNMVVTSDPRVAFNDVNWALLVGAAPRKAGMERKDLLEKNGSIFAGQ
MDH_LEPIN       VIMELEDCAFPLLQKVTVSSDLDTAFKEINWALLVGSVPRKAGMERGDLLKINGGIFVNQ
MDH_LEPIC       VIMELEDCAFPLLQKVTVSSDLDTAFKEINWALLVGSVPRKAGMERGDLLKINGGIFVNQ
MDH_LEPBJ       VIMELEDCAFPLLQKVTVSSDLDIAFKDINWALLVGSVPRKAGMERGDLLKINGGIFINQ
MDH_LEPBL       VIMELEDCAFPLLQKVTVSSDLDIAFKDINWALLVGSVPRKAGMERGDLLKINGGIFINQ
MDH_MAGMM       VMMELQDCAFPTLAKVEAFDNPEQAFDGINWCLMVGSRPRGPGMERSDLIKINGPIFVNQ
MDH_CHLTR       VRMELDDGAFPLLQRVQVTTSLHDAFDGIDAAFLIGSVPRGPGMERRDLLKKNGEIFATQ
MDH_CHLTA       VRMELDDGAFPLLQRVQVTTSLHDAFDGIDAAFLIGSVPRGPGVERRDLLKKNGEIFATQ
MDH_CHLMU       VRMELDDGAFPLLQRVQVTTSLHDAFDDIDAAFLIGSVPRGPGMERRDLLKKNGEIFATQ
MDH_CHLAB       VRMELDDGAYPLLQSLRVTTSLEDAFDGIDAAFLIGAAPRGPGMERSDLLKRNGEIFSLQ
MDH_CHLFF       IRMELDDCAYPLLQSLRVTTSLEDAFDGIDAAFLIGAAPRGPGMERSDLLKRNGEIFSLQ
MDH_CHLCV       VRMELDDCAYPLLQSLRVTTSLEDACDGIDAAFLIGAAPRGPGMERSDLLKRNGEIFSLQ
MDH_CHLPN       VRMELDDGAYPLLHRLRVTTSLNDAFDGIDAAFLIGAVPRGPGMERGDLLKQNGQIFSLQ
MDH_PARUW       VKMEIEDCAFPLLSSIKICSDPYQAFEDIDYALLIGAKSRGPGMERRDLLQENSKIFVNQ
                  :*: * *   :       .           :::.: .*  * **  ::  *. **  .

MDH_MYCBO       GKALNAVAADDVRVGVTGNPANTNALIAMTNAPDIP---RERFSALTRLDHNRAISQLAA
MDH_MYCBP       GKALNAVAADDVRVGVTGNPANTNALIAMTNAPDIP---RERFSALTRLDHNRAISQLAA
MDH_MYCTU       GKALNAVAADDVRVGVTGNPANTNALIAMTNAPDIP---RERFSALTRLDHNRAISQLAA
MDH_MYCUA       GKALNEVAADDIRVGVTGNPANTNALIAMTNAPDIP---RERFSALTRLDHNRAISQLAA
MDH_MYCPA       GKALNEVAADDIRVGVTGNPANTNALIAMSNAPDIP---RERFSALTRLDHNRAISQLAK
MDH_MYCA1       GKALNEVAADDIRVGVTGNPANTNALIAMSNAPDIP---RERFSALTRLDHNRAISQLAK
MDH_MYCLE       GKALNAVAAADIRVGVTGNPANTNALIAMTNAPDIP---RERFSALTRLDHNRAIAQLAT
MDH_NOCSJ       GKALNKVAADDVRIGVTGNPANTNALIAMTNAPDIP---QARFSALTRLDHNRAISQLAA
MDH_PAEAT       GKALNRVAADDVRIGVTGNPANTNALIAMSNAPDIP---ASRFSALTRLDHNRAIGQLAA
MDH_CUTAK       GKALNDVAADDVRVLVTGNPANTNALIAATNAVDIP---NNHFAALTRLDHNRAKTQLAR
MDH_MYCVP       GKALNAGASPDVRVLVVGNPANTNALVASAHAPDIP---ADRFTALTRLDHNRAVAATAR
MDH_RHOJR       GRALNQVAADGVRVLVVGNPANTNALVAANNAPDIP---AERFTALTRLDHNRAIAQLAR
MDH_STRAW       GKAINDNAADDVKILVVGNPANTNALIAQAAAPDVP---AERFTAMTRLDHNRALTQLAK
MDH_STRCO       GKAINDHAADDIKVLVVGNPANTNALIAQAAAPDVP---AERFTAMTRLDHNRALTQLAK
MDH_THEFY       GAAINDGAADDVRVLVVGNPANTNALIAQAHAPDIP---ADRFTAMTRLDHNRALSQLAA
MDH_SACEN       GEAINAGAADDVRVLVVGNPANTNALIAQAHAPDVP---AERFTAMTRLDHNRALTQLAQ
MDH_FRAAA       GEAINSGAAEDIRVLVVGNPANTNALIAQTHAPDVP---AERFTAMTRLDHNRAIAQLAK
MDH_FRACC       GEAINSGAAEDIRVLVVGNPANTNALIAQTHAPDVP---AERFTAMTRLDHNRAIAQLAK
MDH_NOCFA       GQAINAVAADDVKVLVVGNPANTNAFIAMSNAPDVP---AERFTAMTRLDHNRAIAQLAK
MDH_RUBXD       GRAINDHAADDVRVLVVGNPANTNCLIAMNNAPDVP---RERFSAMTRLDENRAVSMLAQ
MDH_CORGL       GKAINDNAADDIRVLVVGNPANTNALIASAAAPDVP---ASRFNAMMRLDHNRAISQLAT
MDH_CORGB       GKAINDNAADDIRVLVVGNPANTNALIASAAAPDVP---ASRFNAMMRLDHNRAISQLAT
MDH_COREF       GKAINDHAAQDIRVLVVGNPANTNALIAMSNAPDVP---QSRFNAMMRLDHNRAISQLAT
MDH_CORDI       GKALNDNAADDIRVLVVGNPANTNALIAQHAAKDIP---ADRFNAMMRLDHNRGIAQLSE
MDH_ACISJ       GKALNAVASRNVKVLVVGNPANTNAYIAMKSAPDLP---AKNFTAMLRLDHNRAASQLAA
MDH_ACIAC       GKALNAVASRNVKVLVVGNPANTNAYIAMKSAPDLP---AKNFTAMLRLDHNRAASQIAA
MDH_METPP       GKALNAVASRNVKVLVVGNPANTNAYIAMKAAPDLP---RKNFTAMLRLDHNRAASQIAA
MDH_POLNA       GKALNAVASRDVRVLVVGNPANTNAYIAMKSAPDLP---AKNFTAMLRLDHNRAASQIAA
MDH_POLSJ       GKALNAVASRNVKVLVVGNPANTNAYIAMKSAPDLP---RKNFTAMLRLDHNRAASQIAA
MDH1_RHOFT      GKALNAVASRNVKVLVVGNPANTNAYIAMKSAPDLP---AKNFTAMLRLDHNRALSQLAS
MDH_VEREI       GKALNAVASRQVKVLVVGNPANTNAFIAMQSAPDLP---RKNFTAMLRLDHNRAVSQIAA
MDH_CUPPJ       GKALDEVASRNVKVLVVGNPANTNAYIAMKSAPSLP---RENFTAMLRLDHNRALSQIAA
MDH_CUPNH       GKALDEVASRNVKVLVVGNPANTNAYIAMKSAPNLP---RENFTAMLRLDHNRALSQIAA
MDH_CUPMC       GKALDEVASRDVKVLVVGNPANTNAYIAMKSAPNLK---RENFTAMLRLDHNRALSQIAA
MDH_RALSO       GKALNAVASRNVKVLVVGNPANTNAYIAMKSAPDLP---RENFTAMLRLDHNRALSQIAA
MDH_AQUAR       GKAIDAVASRNIKVLVVGNPANTNAYIAMKSAPSLP---AKNFTAMLRLDHNRALSQIAA
MDH_ACIAD       GQALNEVASRDVKVLVVGNPANTNAYIAMKSAPDLP---AKNFTAMLRLDHNRALTQIAQ
MDH_ACIBT       GQALNEVASRDVKVLVVGNPANTNAYIAMKSAPDLP---AKNFTAMLRLDHNRALTQVAQ
MDH_XANAC       GAALNKVAKRDVKVLVVGNPANTNAYIAMKSAPDLD---PKNFTAMLRLDHNRALSQLSA
MDH_XANC5       GAALNKVAKRDVKVLVVGNPANTNAYIAMKSAPDLD---PKNFTAMLRLDHNRALSQLSA
MDH_XANCP       GAALNKVAKRDVKVLVVGNPANTNAYIAMKSAPDLN---PKNFTAMLRLDHNRALSQLSL
MDH_XANC8       GAALNKVAKRDVKVLVVGNPANTNAYIAMKSAPDLN---PKNFTAMLRLDHNRALSQLSL
MDH_XANOR       GAALNKVAKRDVKVLVVGNPANTNAYIAMKSAPDLN---PKNFTAMLRLDHNRALSQLAL
MDH_XANOM       GAALNKVAKRDVKVLVVGNPANTNAYIAMKSAPDLN---PKNFTAMLRLDHNRALSQLAL
MDH_XYLFA       GAALNKVARRDVKVLVVGNPANTNAYIAMKSAPDLN---PKHFTAMLRLDHNRALSQLST
MDH_XYLFT       GAALNKVARRDVKVLVVGNPANTNAYIAMKSAPDLN---PKHFTAMLRLDHNRALSQLST
MDH_BURP0       GAALNEVASRDVKVLVVGNPANTNAYIAMKSAPDLP---KKNFTAMLRLDHNRALSQLAA
MDH_BURP1       GAALNEVASRDVKVLVVGNPANTNAYIAMKSAPDLP---KKNFTAMLRLDHNRALSQLAA
MDH_BURMA       GAALNEVASRDVKVLVVGNPANTNAYIAMKSAPDLP---KKNFTAMLRLDHNRALSQLAA
MDH_BURPS       GAALNEVASRDVKVLVVGNPANTNAYIAMKSAPDLP---KKNFTAMLRLDHNRALSQLAA
MDH_BURCM       GAALNEVASRDVKVLVVGNPANTNAYIAMKSAPDLP---KKNFTAMLRLDHNRALSQLAA
MDH1_BURTA      GAALNEVASRDVKVLVVGNPANTNAYIAMKSAPDLP---KKNFTAMLRLDHNRALSQLAA
MDH_BURCA       GAALNEVASRDVKVLVVGNPANTNAYIAMKSAPDLP---KKNFTAMLRLDHNRALSQLAA
MDH_BURCH       GAALNEVASRDVKVLVVGNPANTNAYIAMKSAPDLP---KKNFTAMLRLDHNRALSQLAA
MDH_BURL3       GAALNEVASRDVKVLVVGNPANTNAYIAMKSAPDLP---KKNFTAMLRLDHNRALSQLAA
MDH_PARXL       GKALNEVASRDVKVLVVGNPANTNAYIAMKSAPDLP---KKNFTAMLRLDHNRALSQLAA
MDH_CHRVO       GKALNDHAARDVKVLVVGNPANTNAWIAMKSAPDLD---PKNFTAMLRLDHNRALSQIAA
MDH_BORBR       GRALNDVASRNVKVLVVGNPANTNAYIAMKSAPDLP---AKNFTAMLRLDHNRALSQLSA
MDH_BORPA       GRALNDVASRNVKVLVVGNPANTNAYIAMKSAPDLP---AKNFTAMLRLDHNRALSQLSA
MDH_BORPE       GRALNDVASRNVKVLVVGNPANTNAYIAMKSAPDLP---AKNFTAMLRLDHNRALSQLSA
MDH_BORA1       GRALNEVASRNVKVLVVGNPANTNAYIAMKSAPDLP---AKNFTAMLRLDHNRALSQLAG
MDH_SYNFM       GKAMNAVASRDIRVIVVGNPANTNAWIAMKSAPDLP---KGNFTAMLRLDHNRAKSQLAT
MDH_BDEBA       GEAIGKYANPNVKVLVVGNPANTNAYIAMKSAMKHGRVKAKNFTAMLRLDHNRALSQLAT
MDH_AROAE       GKAIAENANENVKVLVVGNPCNTNAYIAGAAARKVGRTNPNNYHGMLRLDHNRALSQLAA
MDH_DECAR       GKAIAENAKEDVKVLVVGNPCNTNAFIAAAAAKKVGRTNPNNYHGMLRLDHNRALSQLAG
MDH_AZOSB       GAAIGQYADPDCKVLVVGNPCNTNAYIAKEVAQKYGRVPAKNFTGMLRLDHNRALSQLAG
MDH2_RHOFT      GAVIGRHANPDCKVLVVGNPCNTNACVAMKAAQKFSRIPARNFAALLRLDHNRALAQLAL
MDH2_BURTA      GRALNEAASRDVKVLVVGNPANTNASILRRFAPDLP---DDAISAMIRLDHNRAVSMLAQ
MDH_NITEU       GRALNQVVKRDAKILVVGNPANTNTLITMKNAPDLS---PENFSGMLRLDHNRALSQVAM
MDH_NITEC       GKILNQVAKRDAKILVVGNPANTNTLITMKNAPDLP---AENFSGMLRLDHNRALSQVAM
MDH_NITMU       GKALDEVAGRDVKVLVVGNPANTNAYITMKNAPSLK---PTSFSSMMRLDHNRAVFQLAV
MDH_DEIGD       GEALNKVASRDVKVLVVGNPANTNALIAQQNAPDLD---PKQFTAMVRLDHNRAISQLAE
MDH_DEIRA       GEALGAVASRNVKVLVVGNPANTNALIAQQNAPDLD---PKCFTAMVRLDHNRALSQLAE
MDH_THETH       GRALAEVAKKDVKVLVVGNPANTNALIAYKNAPGLN---PRNFTAMTRLDHNRAKAQLAK
MDH_THET2       GRALAEVAKKDVKVLVVGNPANTNALIAYKNAPGLN---PRNFTAMTRLDHNRAKAQLAK
MDH_THET8       GRALAEVAKKDVKVLVVGNPANTNALIAYKNAPGLN---PRNFTAMTRLDHNRAKAQLAK
MDH_PSYA2       GKALNDVASRDVKVLVVGNPANTNALIAQRNAPDLD---PRNFTAMTRLDHNRAMAQLAG
MDH_PSYCK       GKALNDVASRDVKVLVVGNPANTNAVIAQRNAPDLD---PRNFTAMTRLDHNRAMAQLAG
MDH_ALCBS       GKAINDNASKGIKVLVVGNPANTNALIAQRNAPDID---PRQFTAMTRLDHNRAMAQLAN
MDH_SACD2       GKAINDHASRDIKVLVVGNPANTNALIAQRNAPDIN---PRQFTAMMRLDHNRGLSQLAA
MDH_ALKEH       GKALNDAASRDVKVLVVGNPANTNSLIAQRNAPDLD---PRNFTAMTRLDHNRAVAQLAN
MDH_HALHL       GQALNAVAKRDVKVLAVGNPANTNALITQRNAPDLD---PRNFTAMTRLDHNRALAQLSN
MDH_METCA       GRALNESASRRVKILVVGNPANTNALIAQRNAPDLA---PGCFSAMTRLDHNRATSLLAR
MDH_LEGPA       GQAINDYASDDVRVFVVGNPCNTNCLIAMNHAKDVPSD---RFYAMTTLDELRARTQLAK
MDH_LEGPH       GQAINDYASDDVRVFVVGNPCNTNCLIAMNHAKDVPSD---RFYAMTTLDELRARTQLAK
MDH_LEGPL       GQAINDYASDDVRVFVVGNPCNTNCLIAMNHAKDVPSD---RFYAMTTLDELRARTQLAK
MDH_COXBU       GKAINENAASDVRIFVVGNPCNTNCLIAMNNAPDIPKD---RFYAMTRLDQNRAIGQLAL
MDH_LEPIN       GKAIEKNAASDVRILVVGNPCNTNCLIAMNNAKGISQD---RWFAMTKLDENRAKSQLAS
MDH_LEPIC       GKAIEKNAASDVRILVVGNPCNTNCLIAMNNAKGISQD---RWFAMTKLDENRAKSQLAS
MDH_LEPBJ       GKAIEKNAASDVRVLVVGNPCNTNCLIAMNNAKGIPSD---RWFAMTKLDENRAKSQLAS
MDH_LEPBL       GKAIEKNAASDVRVLVVGNPCNTNCLIAMNNAKGIPSD---RWFAMTKLDENRAKSQLAS
MDH_MAGMM       GKALNR-AAQDVRAVVVGNPCNTNCMIAAHNS-DVPHE---RFSAMMRLDQNRAKYLLAS
MDH_CHLTR       GKALNTTAKRDAKIFVVGNPVNTNCWIAMNHAPRLL---RKNFHAMLRLDQNRMHSMLSH
MDH_CHLTA       GKALNTTAKRDAKIFVVGNPVNTNCWIAMNHAPRLL---RKNFHAMLRLDQNRMHSMLSH
MDH_CHLMU       GKVLNTAAKREAKIFVVGNPVNTNCWIAMNHAPRLL---RKNFHAMLRLDQNRMHSMLAH
MDH_CHLAB       GSVLNTSAKRDAKIFVVGNPVNTNCWIAMSQAPRLN---RRNFHSMLRLDQNRMHTMLAH
MDH_CHLFF       GSVLNTSAKRDAKIFVVGNPVNTNCWIAMSRAPKLN---RRNFHSMLRLDQNRMQAMLAH
MDH_CHLCV       GSVLNVCAKRDAKIFVVGNPVNTNCWIAMNKAPKLN---RRNFHSMLRLDQNRMHTMLAH
MDH_CHLPN       GAALNTAAKRDAKIFVVGNPVNTNCWIAMKHAPRLH---RKNFHAMLRLDQNRMHSMLAH
MDH_PARUW       GQALNAVAKSSAKIFVVGNPCNTNCLIALNNAPSLK---RENFYAMTRLDQNRATFFLSQ
                *  :   .    :  ..*** ***  :    :            .:  **. *     : 

MDH_MYCBO       KTGAAVTDIKKMTIWGNHSATQYPDLFHAEVAGKNAAEVVN-----DQAWIEDEFIPTVA
MDH_MYCBP       KTGAAVTDIKKMTIWGNHSATQYPDLFHAEVAGKNAAEVVN-----DQAWIEDEFIPTVA
MDH_MYCTU       KTGAAVTDIKKMTIWGNHSATQYPDLFHAEVAGKNAAEVVN-----DQAWIEDEFIPTVA
MDH_MYCUA       KTGVAVTDIKKMTIWGNHSATQYPDLFHAEVKGKNAAEVVN-----DQAWIEEYFIPTVA
MDH_MYCPA       KTGAKVTDIKKMTIWGNHSATQYPDIFHAEVKGKNAAEVVG-----DQNWIENDFIPTVA
MDH_MYCA1       KTGAKVTDITKMTIWGNHSATQYPDIFHAEVKGKNAAEVVG-----DQNWIENDFIPTVA
MDH_MYCLE       KTGSAVTDIRKMTIWGNHSATQYPDVFHAEIGGKNAAEVVG-----DQAWIEDYFIPTVA
MDH_NOCSJ       KTGAAVTDIKKMTIWGNHSATQYPDVFHAEIGGRNAAEVVG-----DQDWIESTFIPTVA
MDH_PAEAT       KTHARVGDIRKMTVWGNHSATQYPDIFHAEVAGRNAAEVVN-----DQDWIENEFIPTVA
MDH_CUTAK       KTGKTVNDVRHMTIWGNHSSTQYPDVFHAEVAGQKATNLVN-----E-AWIENEFIPTVA
MDH_MYCVP       HSGVPVTEISRMTIWGNHSPTQYPDIFHAVVGGRSGADYAA-----DTRWLTDDFIPTVA
MDH_RHOJR       HSGAAVKDIRRVAIWGNHSSTQYPDIFHARVGDRSGAEFAA-----DREWLTGDFIPTVA
MDH_STRAW       KTGSTVADIKRLTIWGNHSATQYPDIFHASVAGKNAAEVVN-----DEKWLAEDFIPTVA
MDH_STRCO       KTGSTVADIKRLTIWGNHSATQYPDIFHATVAGKNAAETVN-----DEKWLADEFIPTVA
MDH_THEFY       KLNVSVSDIKKLTIWGNHSATQYPDIFHAEVNGRSAVEAVN-----DEEWLRDTFIPTVA
MDH_SACEN       KLGVSVNDIKKLTIWGNHSATQYPDLFHAEVNGKVAAEQV------DQAWLADTFIPTVA
MDH_FRAAA       KLGVPSAEIRKITIWGNHSATQYPDIFHAQVGGRSGAEAVG-----DQKWIAEEFIPRVA
MDH_FRACC       KLGVPSAEIKKITIWGNHSATQYPDIFHAEVGGRSGAEAVG-----DQAWIADEFIPRVA
MDH_NOCFA       KTGAPATEIHRIAVWGNHSATQYPDLTHATVAGRPARELV------DEQWLREDFIPTVQ
MDH_RUBXD       KLGVGVEDVRDLVVWGNHSPTMFPDLFNARVKGQRAVDLV------EMEWYENEYIPRVG
MDH_CORGL       KLGRGSAEFNNIVVWGNHSATQFPDITYATVGGEK-VTDLV-----DHDWYVEEFIPRVA
MDH_CORGB       KLGRGSAEFNNIVVWGNHSATQFPDITYATVGGEK-VTDLV-----DHDWYVEEFIPRVA
MDH_COREF       KTGRLSSEFQDVVVWGNHSAAQFPDITYATVGGEK-VSDLV-----DHDWYVNEFIPRVA
MDH_CORDI       KLGRDKNDIEKFVVWGNHSAGQFPDITYATIGGEA-ISGLV-----DHDWYTGEFIPRVA
MDH_ACISJ       KGGFKVGDIKKLTVWGNHSPTMYADYRFATVDGKSVKDAIN-----DPAWYKDVFLPTVG
MDH_ACIAC       KTGGKVGEIEKLTVWGNHSPTMYADYRFATIGGKSVKDAIN-----DQVWNADVFLPTVG
MDH_METPP       KTGKPVSSIKQLAVWGNHSPTMYADYRFATIDGASVKDMIN-----DQVWNKDVFLPTVG
MDH_POLNA       KTGKAVADIEKLTVWGNHSPTMYADYRFATIGGESVAQMIN-----DQEWNANVFLPTVG
MDH_POLSJ       KTGKAVADIEKLTVWGNHSPTMYADYRFATINGESVAKMIN-----DQEWNANVFLPTVG
MDH1_RHOFT      KTGKAVADIEKMAVWGNHSPTMYADYRFATINGESVKDMIN-----DQDWNANTFLPTVG
MDH_VEREI       KTGQAVADIEKLTVWGNHSPTMYADYRFATAGGQSVAAMIN-----DQAWNANVFLPTVG
MDH_CUPPJ       KTGKPVASIEKMFVWGNHSPTMYADYRYATVDGKSVKDMIN-----DPVWNNDVFLPTVG
MDH_CUPNH       KTGKPVSSIEKLFVWGNHSPTMYADYRYATVDGKSVKDLIN-----DPVWNNDVFLPTVG
MDH_CUPMC       KTGKPVSSIEKMFVWGNHSPTMYADYRYATVDGKSVKDMIN-----DPVWNNDVFLPTVG
MDH_RALSO       KTGKPVSSIEKLFVWGNHSPTMYADYRYATIDGQSVKDMIN-----DPVWNNDVFLPTVG
MDH_AQUAR       KTGKPVSSIEKLFVWGNHSPTMYADYRYAQIDGASVKDMIN-----DDAWNRDTFLPTVG
MDH_ACIAD       KAGVAVADIEKLTVWGNHSPTMYADYRFATANGENLKDKIN-----DAEWNKDVFLPTVG
MDH_ACIBT       KAGVAVADIEKLTVWGNHSPTMYADYRFATANGESLKDKIN-----DPAWNKDVFLPTVG
MDH_XANAC       KLGKPVAGIEKLAVWGNHSPTMYPDYRFATADGASIGDAIN-----DQEWNASTFIPTVG
MDH_XANC5       KLGKPVAGIEKLAVWGNHSPTMYPDYRFATADGASVGDAIN-----DQEWNASTFIPTVG
MDH_XANCP       KLGKPVGGIEKLVVWGNHSPTMYPDYRFATSDGASIGDAIN-----DQEWNAGTFIPTVG
MDH_XANC8       KLGKPVGGIEKLVVWGNHSPTMYPDYRFATSDGASIGDAIN-----DQEWNAGTFIPTVG
MDH_XANOR       KLGKPVGGIEKLVVWGNHSPTMYPDYRFATSDGASIGDAIN-----DQEWNASTFIPTVG
MDH_XANOM       KLGKPVGGIEKLVVWGNHSPTMYPDYRFATSDGASIGDAIN-----DQEWNASTFIPTVG
MDH_XYLFA       KLSKPVANIEKLIVWGNHSPTMYPDYRFATADGTPIIEAIN-----DQAWNANSFIPTVS
MDH_XYLFT       KLGKPVANIEKLIVWGNHSPTMYPDYRFATADGTPIIEAIN-----DQAWNANSFIPTVS
MDH_BURP0       KSGKPVASIEKLAVWGNHSPTMYPDFRFATAEGESLLKLIN-----DDVWNRDTFIPTVG
MDH_BURP1       KSGKPVASIEKLAVWGNHSPTMYPDFRFATAEGESLLKLIN-----DDVWNRDTFIPTVG
MDH_BURMA       KSGKPVASIEKLAVWGNHSPTMYPDFRFATAEGESLLKLIN-----DDVWNRDTFIPTVG
MDH_BURPS       KSGKPVASIEKLAVWGNHSPTMYPDFRFATAEGESLLKLIN-----DDVWNRDTFIPTVG
MDH_BURCM       KSGKPVASIEKLAVWGNHSPTMYPDFRFATAEGESLLKLIN-----DDVWNRDTFIPTVG
MDH1_BURTA      KSGKPVASIEKLAVWGNHSPTMYPDFRFATAEGESLLKLIN-----DDAWNRDTFIPTVG
MDH_BURCA       KSGKPVASIEKLAVWGNHSPTMYPDFRFATAEGESLLKLIN-----DDVWNRDTFIPTVG
MDH_BURCH       KSGKPVASIEKLAVWGNHSPTMYPDFRFATAEGESLLKLIN-----DDVWNRDTFIPTVG
MDH_BURL3       KSGKPVASIEKLAVWGNHSPTMYPDFRFATAEGESLLKLIN-----DDVWNRDTFIPTVG
MDH_PARXL       KSGKPVASIEKLAVWGNHSPTMYPDFRVATAEGQDLTKLIN-----DEEWNRNTFIPTVG
MDH_CHRVO       KTGKPVASIEKLAVWGNHSPTMYADYRFATIDGQSVKAMIN-----DDVWNRDVFLPTVG
MDH_BORBR       KSGKRVADIEKLIVWGNHSPTMYPDFRFATVGGQGLTQLIN-----DDAWNRDTFIPTVG
MDH_BORPA       KSGKRVADIEKLIVWGNHSPTMYPDFRFATVGGQGLTQLIN-----DDAWNRDTFIPTVG
MDH_BORPE       KSGKRVADIEKLIVWGNHSPTMYPDFRFATVGGQGLTQLIN-----DDAWNRDTFIPTVG
MDH_BORA1       KSGKAVAGIEKLIVWGNHSPTMYPDYRFATVDGQPLAKLIN-----DEAWNRDTFIPTVG
MDH_SYNFM       RTGKPVASVEKMIVWGNHSPTMYPDIRFCTVDGQPAVKLVN-----DEAWYRNEYIPKVG
MDH_BDEBA       KTGKPVASFKKVAVWGNHSPTMYPDVRFATADGAKVPELLKLGTAEGDAWNKDTFIPTVG
MDH_AROAE       KTGRPVSSLKKMVVWGNHSPTMYADYRFCTSNGDSVKALVN-----DHAWNNDVFLPTVG
MDH_DECAR       KTGRAVSSLKKLVVWGNHSPTMYADYRFCTSNGDSVKALVN-----DHAWNNDVFLPTVG
MDH_AZOSB       KSGREVSSLKNLVVWGNHSPTMYADYRFVKSNGDSVKDLIN-----DAAWNKDVFLPTVG
MDH2_RHOFT      KTGRPVGGVKRLAVWGNHSPTVYADDRFTTIDGDSVPAIID-----NIAWHHDTLVRTVD
MDH2_BURTA      RCNVDVDSIADMVVWGNHSPTMFPDYRHARIGRRLVKDLIN-----DENWYRESFIPKVA
MDH_NITEU       KLNQPVSHIRKMIVWGNHSSTQFPDLSHAEIDHQKVIDLIK-----DQTWVENSFIPTVQ
MDH_NITEC       KLNQPVSNIKKMIVWGNHSSTQFPDLYHAEIGDTKVINLIK-----DPIWIENYFIPTVQ
MDH_NITMU       KVGQPVSSVRKMIVWGNHSSAQYPDLSHAEVDGHNAADLVN-----DMAWIETGFIPVIQ
MDH_DEIGD       KTGQPVSAIKNITIWGNHSSTQYPDLSQATVNGQPALDLVD------REWYEKEYIPTVA
MDH_DEIRA       KTGAAVSDIKNVTIWGNHSSTQYPDLSQATVNGKPALEQVD------RTWYENDYIPTVA
MDH_THETH       KTGTGVDRIRRMTVWGNHSSTMFPDLFHAEVDGRPALELVD------MEWYEKVFIPTVA
MDH_THET2       KTGTGVDRIRRMTVWGNHSSTMFPDLFHAEVDGRPALELVD------MEWYEKVFIPTVA
MDH_THET8       KTGTGVDRIRRMTVWGNHSSTMFPDLFHAEVDGRPALELVD------MEWYEKVFIPTVA
MDH_PSYA2       KTDSTVNDVKKMIIWGNHSSTQYPDLTASTVNGKLALDLVD------RTWYEGTYIPEVQ
MDH_PSYCK       KTDSTVNDVKKMIIWGNHSSTQYPDLTASTVNGKPALDLVD------RAWYEGTYIPEVQ
MDH_ALCBS       KLGKTVNDVKKMLIWGNHSSTQYPDLHHCEVDGKVAIDQVE------QDWYENDYIPTVQ
MDH_SACD2       KLDVTLEDITKMTIWGNHSATQYPDLFHTLVKGDVAVEQVE------KDWYENDFIPTVQ
MDH_ALKEH       KTGAHNTEIKNMIIWGNHSATQYPDISKTKVKGEAAPGLVE------RDWYENDFIPTVQ
MDH_HALHL       KVGCHSTEIRGLAVWGNHSATQYPDISHCTIQGRPAADQVE------HAWVKDTFIPTVQ
MDH_METCA       HCGCNVAEISRVVIWGNHSPTQYPDLHHARVKGKPALSLVD------PAWYVETFIPTVQ
MDH_LEGPA       KAGVDITAVTQMTIWGNHSATQYPDFYNAKINGTSAAQVIN-----DETWLKETFVSTVQ
MDH_LEGPH       KAGVDITAVTQMTIWGNHSATQYPDFYNAKINGTSAAQVIN-----DETWLKETFVSTVQ
MDH_LEGPL       KAGVDITAVTQMTIWGNHSATQYPDFYNAKINGTSAARVIN-----DQTWLKETFVSTVQ
MDH_COXBU       KAGVDVPSVKNMIIWGNHSSTQYPDFYHATIDGKPATEVIR-----DKNWLLNDFISVIQ
MDH_LEPIN       KAGVPVKEVTHLGIWGNHSATQYPDFYNTKISGKPVTDVIS-----DHEWLKGDFIKNVQ
MDH_LEPIC       KAGVPVKEVTHLGIWGNHSATQYPDFYNTKISGKPVTDVIS-----DHEWLKGDFIKNVQ
MDH_LEPBJ       KAGVPVKEVTHLGIWGNHSSTQYPDFYNAKISGKPVTDVIS-----DHEWLKGDFIKNVQ
MDH_LEPBL       KAGVPVKEVTHLGIWGNHSSTQYPDFYNAKISGKPVTDVIS-----DHEWLKGDFIKNVQ
MDH_MAGMM       KAGAQVIDVTNVVIWGNHSNNQVPDFEFAKIGGKPVPEVIA-----DAAWLENAFMPTVQ
MDH_CHLTR       RAEVPLSAVSQVVVWGNHSAKQVPDFTQALINDRPIAETIA-----DRDWLENIMVPSVQ
MDH_CHLTA       RAEVPLSAVSQVVVWGNHSAKQVPDFTQALINDRPIAETIA-----DRDWLENIMVPSVQ
MDH_CHLMU       RAEVPLSAVSQVVVWGNHSAKQVPDFTQALIHGRPIVETIA-----DRDWLENIMVPSVQ
MDH_CHLAB       RAEVPLDEVSHVVIWGNHSAKQVPDFTQALISGKPAVEVIG-----DRDWLENIMLPSIQ
MDH_CHLFF       RAQVPLDEVTNVVIWGNHSAKQVPDFTQSLISGKPAVEVIS-----DRDWLENIMLPSIQ
MDH_CHLCV       RAEVPLDEVTNVVVWGNHSAKQVPDFTQALISGKPAVEVIS-----DRDWLENIMFPSIQ
MDH_CHLPN       RAEVPLEEVSRVVIWGNHSAKQVPDFTQARISGKPAAEVIG-----DRDWLENILVHSVQ
MDH_PARUW       KSQVSTKDVSCVTIWGNHSATQVPDFVNAKISQKPVETIIP-----DRQWLEKDFIESVQ
                :       .  . :*****    .*                        *     .  : 

MDH_MYCBO       KRGAAIIDARGASSAASAASATIDAARDWLLGTPADDWVSMAVVSD-GSYGVPEGLISSF
MDH_MYCBP       KRGAAIIDARGASSAASAASATIDAARDWLLGTPADDWVSMAVVSD-GSYGVPEGLISSF
MDH_MYCTU       KRGAAIIDARGASSAASAASATIDAARDWLLGTPADDWVSMAVVSD-GSYGVPEGLISSF
MDH_MYCUA       KRGATIIDARGASSAASAASASVDAARSWLLGTPADDWVSMAVLSD-GSYGVPEGLISSF
MDH_MYCPA       KRGAAIIDARGASSAASAASATTDAARDWLLGTPAGDWVSMAVISD-GSYGVPEGLISSF
MDH_MYCA1       KRGAAIIDARGASSAASAASATTDAARDWLLGTPAGDWVSMAVISD-GSYGVPEGLISSF
MDH_MYCLE       KRGAAIIDARGASSAASAASATIDAARDWLLGTPEGNWVSMAVVSD-GSYGVPEGLISSF
MDH_NOCSJ       KRGAAIIEARGSSSAASAASATIDAARDWLFGSADADWVSMAVVSD-GSYGVPEGLISSF
MDH_PAEAT       GRGAAIIEARGASSAASAASATIDAARDWLLGTPEGDWVSMAVASD-GSYGVPEGLMYSY
MDH_CUTAK       KRGAAIIDARGASSAASAANATVECMRDWMGSTPEGDWVSMAIPSD-GSYGVPEGLISSF
MDH_MYCVP       RRGTAIIEARGASSAASAANGAIDHIDDWVHGTPDGDWTSVALPSP-GAYGVDEGLVCSF
MDH_RHOJR       NRGSAIIEARGASSAASAANAAIDHVHDWVLGTPDDDWTSVALPST-GAYGVPEGLVSSF
MDH_STRAW       KRGAAIIEARGASSAASAANAAIDHVYTWVNGTADGDWTSMGIPSD-GSYGVPEGLISSF
MDH_STRCO       KRGAAIIEARGASSAASAANAAIDHVYTWVNGTAEGDWTSMGIPSD-GSYGVPEGIISSF
MDH_THEFY       KRGAAIIEARGASSAASAANAAIDHVYDWVNGTPEGDWTSVALPSD-GSYGVPEGLVSSF
MDH_SACEN       KRGAAIIEARGASSAASAANAAIDHIHTWVNGTPEGDWTSAAVVSD-GSYGVPEGLISSF
MDH_FRAAA       KRGAEIIEVRGASSAASAASAAIDHVYTWVNGTPEGDWTSAAIPSD-GSYGVPEGLISSF
MDH_FRACC       KRGAEIIEVRGASSAASAASAAIDHIFTWVNGTPAGDWTSAAIPSD-GSYGVPEGLISSF
MDH_NOCFA       QRGTAIIQARGASSAASAASAAIDHIHDWVLGTPAGEWTSMAVPSD-GSYGVPDGLISSF
MDH_RUBXD       KRGAEIIEARGASSAASAANAAIDHVRDWMLGA--DSLHSMAVASS-GQYGVEEGLVSSF
MDH_CORGL       NRGAEIIEVRGKSSAASAASSAIDHMRDWVQGTE--AWSSAAIPST-GAYGIPEGIFVGL
MDH_CORGB       NRGAEIIEVRGKSSAASAASSAIDHMRDWVQGTE--AWSSAAIPST-GAYGIPEGIFVGL
MDH_COREF       KRGAEIIEVRGKSSAASAASSAVDHMRDWIQGTE--TWASAAIPST-GAYGIPEGIILGL
MDH_CORDI       KRGAEIIEVRGKSSAASAASSAIDHMHDWINGTDG-QWRTAAIPSD-GSYGVPEGLIFGF
MDH_ACISJ       KRGAAIIAARGLSSAASAANAAIDHMRDWALGSKG-EWVTMGVPSN-GEYGIPAGIVFGF
MDH_ACIAC       KRGAAIIEARGLSSAASAANAAIDHMRDWALGSNG-KWVTMGVPSK-GEYGIPEGIVFGF
MDH_METPP       KRGAAIIEARGLSSAASAANAAIDHMRDWALGTNG-AWVTMGVPSN-GEYGIPKDVMFGF
MDH_POLNA       KRGAAIIEARGSSSAASAANAAIDHMRDWALGTNG-KWVTMGIPSG-GEYGIPAETMFGF
MDH_POLSJ       KRGAAIIEARGLSSAASAANAAIDHMRDWALGTNG-KWVTMGIPSD-GQYGIPKDTMFGF
MDH1_RHOFT      KRGAAIIAARGVSSAASAANAAIDHMRDWALGTNG-KWVTMGIPSD-GQYGIPKETMFGF
MDH_VEREI       KRGAAIIEARGLSSAASAANAAIDHMRDWALGSNG-RWVTMGIASD-GQYGIPKDIVFGF
MDH_CUPPJ       KRGAAIIEARGLSSAASAANAAIDHVHDWVLGTNG-KVVTMGIPSN-GEYGIPADTMFGY
MDH_CUPNH       KRGAAIIEARGLSSAASAANAAIDHVRDWVLGTNG-KVVTMGIPSN-GEYGIPADTMFGY
MDH_CUPMC       KRGAAIIEARGLSSAASAANAAIDHVHDWVLGSNG-KVVTMGIPSN-GEYGIPNDVMFGY
MDH_RALSO       KRGAAIIEARGLSSAASAANAAIDHVRDWVLGSNG-KIVTMGIPSN-GDYEIPQDVMFGF
MDH_AQUAR       KRGAAIIDARGVSSAASAANAAIDHIHDWVLGTAG-KWTTMGIPSD-GSYGIPEGVIFGF
MDH_ACIAD       KRGAAIIEARGLSSAASAANAAIDHMRDWALGTNG-KWVTMGIPSD-GSYGIPEGVIYGV
MDH_ACIBT       KRGAAIIEARGLSSAASAANAAIDHMRDWALGTNG-KWVTMGVPSD-GSYGIPEGVMFGF
MDH_XANAC       KRGAAIIEARGLSSAASAANAAIDHIRDWVLGTSG-KWVTMGVPSD-GSYGIPEGVMFGF
MDH_XANC5       KRGAAIIEARGLSSAASAANAAIDHIRDWVLGTNG-KWVTMGVPSD-GSYGIPEGVMFGF
MDH_XANCP       KRGAAIIEARGLSSAASAANAAIDHVRDWVLGSNG-KWVTMGVPSD-GSYGIPEGVIFGF
MDH_XANC8       KRGAAIIEARGLSSAASAANAAIDHVRDWVLGSNG-KWVTMGVPSD-GSYGIPEGVIFGF
MDH_XANOR       KRGAAIIEARGLSSAASAANAAIDHVRDWVLGSNG-KWVTMGVPSD-GSYGISEGVIFGF
MDH_XANOM       KRGAAIIEARGLSSAASAANAAIDHVRDWVLGSNG-KWVTMGVPSD-GSYGISEGVIFGF
MDH_XYLFA       KRGAAIIEVRGLSSAASAANAAIDHMRDWLLGSNG-KWITMGVPSD-GSYGIPEGMIFGF
MDH_XYLFT       KRGAAIIEARGLSSAASAANAAIDHMRDWLLGSNG-KWITMGVPSD-GSYGIPEGMIFGF
MDH_BURP0       KRGAAIIEARGLSSAASAANAAIDHVRDWVLGTNG-KWVTMGIPSD-GSYGIPEDIIYGV
MDH_BURP1       KRGAAIIEARGLSSAASAANAAIDHVRDWVLGTNG-KWVTMGIPSD-GSYGIPEDIIYGV
MDH_BURMA       KRGAAIIEARGLSSAASAANAAIDHVRDWVLGTNG-KWVTMGIPSD-GSYGIPEDIIYGV
MDH_BURPS       KRGAAIIEARGLSSAASAANAAIDHVRDWVLGTNG-KWVTMGIPSD-GSYGIPEDIIYGV
MDH_BURCM       KRGAAIIEARGLSSAASAANAAIDHVRDWVLGTNG-KWVTMGIPSD-GSYGIPEDIIYGV
MDH1_BURTA      KRGAAIIEARGLSSAASAANAAIDHVRDWVLGTNG-KWVTMGIPSD-GSYGIPEDIIYGV
MDH_BURCA       KRGAAIIEARGLSSAASAANAAIDHVRDWVLGTNG-KWVTMGIPSD-GSYGIPEDIIYGV
MDH_BURCH       KRGAAIIEARGLSSAASAANAAIDHVRDWVLGTNG-KWVTMGIPSD-GSYGIPEDIIYGV
MDH_BURL3       KRGAAIIEARGLSSAASAANAAIDHVRDWVLGTNG-KWVTMGIPSD-GSYGIPEDIIYGV
MDH_PARXL       KRGAAIIEARGLSSAASAANAAIDHVRDWVLGTNG-KWVTMGIPSD-GSYGIPEDIIYGV
MDH_CHRVO       KRGAAIIEARGLSSAASAANAAIDHIRDWVLGTNG-KWVTMGVPSD-GSYGIPEGVMYGV
MDH_BORBR       KRGAAIIEARGLSSAASAANAAIDHVRDWVLGSNG-KWVTMGIPSD-GSYGIPEGIIYGF
MDH_BORPA       KRGAAIIEARGLSSAASAANAAIDHVRDWVLGSNG-KWVTMGIPSD-GSYGIPEGIIYGF
MDH_BORPE       KRGAAIIEARGLSSAASAANAAIDHVRDWVLGSNG-KWVTMGIPSD-GSYGIPEGIIYGF
MDH_BORA1       KRGAAIIEARGLSSAASAANAAIDHVRDWVLGSNG-KWVTMGIPSD-GSYGIPEGIIYGF
MDH_SYNFM       KRGAAIIEARGLSSAASAANAAIDHMHDWALGTNG-KWVTMGLPSD-GSYGIPEGTMYGV
MDH_BDEBA       KRGAAIIEARGLSSAASAASAAVDHIRDWWLGTNG-EWVTMGIPSD-GSYDIPEGIMYGF
MDH_AROAE       KRGAAIIDARGLSSAASAANAAIDHMHDWALGSD--DWVTMGVPSD-GSYGIPAGVVFGV
MDH_DECAR       KRGAAIIEARGLSSAASAANAAIDHVRDWVLGSD--EWVTMGVPSD-GSYGIPAGIVFGF
MDH_AZOSB       KRGAAIIEARGLSSAASAANAAIDHIRDWVLGSNG-EWVTMGIPSD-GSYGIPEGVIYGF
MDH2_RHOFT      KRGEAILAARGLYAEASAASAAIDQMRDWWLGTRG-EWTTMGVVSD-GAYGVPAGLVFGF
MDH2_BURTA      QRGTAIIEARGASSAASAANAAIDQMRDWIFGSDG-RWVSMSVPSD-GSYGIAPGLMFGV
MDH_NITEU       NRGAVVIEARGLSSAASAANAIIDHMRDWIFGTRDDDWITMGILSD-GSYKIPKGVIYGF
MDH_NITEC       KRGAVVIEARGLSSAASAANAIIDHLRNWFFGTADGDWTTMGILSD-GSYEIPEGVIYGF
MDH_NITMU       KRGMEVIEARGSSSAASAANAAICHMRDWVSGTPEGDWVSMGIPSD-GSYGIPEGVIYGY
MDH_DEIGD       KRGAAIIEARGASSAASAASAAIDHMRDWALGTPEGEWVSMAVPSD-GSYGIPEGLIYGF
MDH_DEIRA       KRGAAIIEARGASSAASAASAAIDHMHDWALGTKDGEWVSMGIPSD-GSYGIPEGLIYGF
MDH_THETH       QRGAAIIQARGASSAASAANAAIEHIRDWALGTPEGDWVSMAVPSQ-GEYGIPEGIVYSF
MDH_THET2       QRGAAIIQARGASSAASAANAAIEHIRDWALGTPEGDWVSMAVPSQ-GEYGIPEGIVYSF
MDH_THET8       QRGAAIIQARGASSAASAANAAIEHIRDWALGTPEGDWVSMAVPSQ-GEYGIPEGIVYSF
MDH_PSYA2       QRGAAIIKARGASSAASAANAAIAHMRTWVLGTDENDWVSMGVYSN-GEYGIAKGLIYSF
MDH_PSYCK       QRGAAIIKARGASSAASAANAAIAHVRTWVMGTDENDWVSMGVYSN-GEYGIAKGLIYSF
MDH_ALCBS       QRGAAIIKARGASSAASAANAAVDHMRSWALGTDEGDWVSMGIYSD-GSYGIQEGLIYSF
MDH_SACD2       QRGAAIIKARGASSAASAANAAIFHMRDWALGTPENDWVSMGVYSD-GSYGIEEGLIYSF
MDH_ALKEH       QRGAAIIKARGASSAASAASSAIDHIRDWVLGTPEGEWTSMAVPSD-GSYGIEKGIIYSY
MDH_HALHL       QRGAAIIKARGASSAASAASAAIDHMRDWALGTPEGEWTSMAVPSD-GSYGIEAGLIYSF
MDH_METCA       QRGASVIAIRGKSSAASAANAALDHMRSWFLGTPKDDWVSMTVSSD-GSYGIAEGLMFSF
MDH_LEGPA       QRGAAVIKARGSSSAASAANAIITGVNHLVTDTPAGESFSMCRRSK-GEYGVDEGLIFSF
MDH_LEGPH       QRGAAVIKARGSSSAASAANAIITGVNHLVTDTPAGESFSMCRRSK-GEYGVDEGLIFSF
MDH_LEGPL       QRGAAVIKARGSSSAASAANAIITGVNHLVTDTPAGESFSMCRRSK-GEYGVDEGLIFSF
MDH_COXBU       QRGAAVIKARGASSAASAANAALDSVWSLINTTPADDNYSVALCAQ-GQYGVDEGLIFSF
MDH_LEPIN       QRGAEIIKARGASSAASAANGVVDTVRGIITPTAPGDCFSAAVVSD-GSYGAEKGLIFGF
MDH_LEPIC       QRGAEIIKARGASSAASAANGVVDTVRGIITPTAPGDCFSAAVVSD-GSYGAEKGLIFGF
MDH_LEPBJ       QRGAEIIKARGASSAASAANGVVDTVRAIITPTASGDAFSAAIASD-GSYGTEKGLIFGF
MDH_LEPBL       QRGAEIIKARGASSAASAANGVVDTVRAIITPTASGDAFSAAIASD-GSYGTEKGLIFGF
MDH_MAGMM       NRGAAVIKARGASSAASAANAALDHVRSLITPTPAGDTFCAAVMAN-GAYGVDAGLIAGM
MDH_CHLTR       SRGSAVIEARGKSSAASAARALAEAARSIYQPK-EGEWFSSGVCSDHNPYGLPEDLIFGF
MDH_CHLTA       SRGSAVIEARGKSSAASAARALAEAARSIYQPK-EGEWFSSGVCSDHNPYGLPEDLIFGF
MDH_CHLMU       SRGSAVIEARGKSSAASAARALAEAARSIYQPK-EGEWFSSGVCSDNNPYGLPEDIIFGF
MDH_CHLAB       NRGSAVIEARGKSSAASAARALAEAARSIFLPK-DGEWFSTGVCSDYNPYGIPEDLIFGF
MDH_CHLFF       NRGSAVIEARGKSSAGSAARALAEAARSIFVPK-EGEWFSTGVCSDYNPYGIPEDLIFGF
MDH_CHLCV       NRGSAVIEARGKSSAGSAARALAEAARSIFLPK-DGEWFSSGVCSDYNPYGIPDDLIFGF
MDH_CHLPN       NRGSAVIEARGKSSAASASRALAEAARSIFCPK-SDEWFSSGVCSDHNPYGIPEDLIFGF
MDH_PARUW       KRGAAIIQARGKSSAASAASALLDAMRDRILPTPTGQWFSTALLSDGNPYGIEEGLIFSF
                 **  ::  **  : .**: .                       :  . *      . . 

MDH_MYCBO       PVTTKGG-NWTIVSGLEID-EFSRGRIDKSTAELADERSAVTELGLI---
MDH_MYCBP       PVTTKGG-NWTIVSGLEID-EFSRGRIDKSTAELADERSAVTELGLI---
MDH_MYCTU       PVTTKGG-NWTIVSGLEID-EFSRGRIDKSTAELADERSAVTELGLI---
MDH_MYCUA       PVTTKDG-NWSIVKGLEID-EFSRGRIDKTAAELADERKAVTELGLI---
MDH_MYCPA       PVTTKDG-DWTIVQGLEID-EFSRSRIDKTTAELADERNAVTQLGLI---
MDH_MYCA1       PVTTKDG-DWTIVQGLEID-EFSRSRIDKTTAELADERNAVTQLGLI---
MDH_MYCLE       PVTTTDG-DWTIVRGLGID-DFSRGRIDKSTAELADERMAVKQLGLI---
MDH_NOCSJ       PVTTKDG-DWEIVQGLEID-DFSRAKIDASTAELADEREAVKELGLI---
MDH_PAEAT       PVTTSGG-NWEIVEGLEVN-DFSRRKMDATAAELFDERAAVANLGLI---
MDH_CUTAK       PVTITNG-KVEIVQGLDID-DFSRAKIDASAKELADERDAVKELGLI---
MDH_MYCVP       PCRSVGG-RWEIVEGLDIN-PFSRARIDASVAELRTERDAVAALGLL---
MDH_RHOJR       PVRSVDG-SWQIVDGLEID-DFSRKLIDASVGELESERDAVRGMGFI---
MDH_STRAW       PVTTKDG-RYEIVQGLEIN-EFSRARIDASVKELEEEREAVRALGLI---
MDH_STRCO       PVTTKDG-SYEIVQGLDIN-EFSRARIDASVKELSEEREAVRGLGLI---
MDH_THEFY       PVVSRNG-SWEIVQGLEIN-EFSRERIDASVRELEEEREAVRALGLIK--
MDH_SACEN       PVVARDG-RYEIVQGLEID-EFSRQRIDASVNELSEERDAVRKLGLL---
MDH_FRAAA       PVTAAGG-KFEIVQGLELD-AFSREKIDASVRELAEEREAVRALGLI---
MDH_FRACC       PVTASGG-RFEIVQGLELD-AFSREKIDASVRELAEEREAVRALGLI---
MDH_NOCFA       PVTCADG-AYRIVEGLEVD-AFSRERIDASVAELTAEREAVVELGFAKG-
MDH_RUBXD       PVRLPGGGEYEIPEGLEVG-DFARSKLEITIGELKEERDAVRKLGLIG--
MDH_CORGL       PTVSRNG-EWEIVEGLEIS-DFQRARIDANAQELQAEREAVRDLL-----
MDH_CORGB       PTVSRNG-EWEIVEGLEIS-DFQRARIDANAQELQAEREAVRDLL-----
MDH_COREF       PTVSRNG-EWEVVEGLEIN-DFQRARIDANVEELQGEREAVKDLL-----
MDH_CORDI       PTISEDG-QWKIVQDLELS-DFQKDGIARNVTELEEEREAVKDLLG----
MDH_ACISJ       PVTTENG-EYKIVEGLPID-AFSQECIDKTLAELQGEQDGVKHLL-----
MDH_ACIAC       PVITENG-EYKIVEGLEID-AFSQERINKTLAELQGEQDGVKHLL-----
MDH_METPP       PVTCANG-EYKIVDGLAID-AFSQECINKTLAELQGEQDGVKHLI-----
MDH_POLNA       PVTCENG-EYKIVEGLEID-AFSQERINITLAELEGEKAGVAHLL-----
MDH_POLSJ       PVTCENG-EYKLVEGLEID-AFSQERINKTLEELQGEQAGVAHLL-----
MDH1_RHOFT      PVTCEGG-EYKVVQNLPID-AFSQECINKTLKELQDEQAGVAHLL-----
MDH_VEREI       PVTCANG-EYQLVQGLALD-AFSQQRIQATLAELQAEQDGVRHLL-----
MDH_CUPPJ       PVTCANG-KYEIVKGLEID-AYSQEKINITLNELEEEKAGVQHLLG----
MDH_CUPNH       PVTTANG-KYEIVKGLEID-AYSQEKINITLNELEEEKAGVQHLLG----
MDH_CUPMC       PVTTANG-KYEIVKGLEID-AYSQEKINITLKELEEERAGVQHLLG----
MDH_RALSO       PVTTANG-KYEVVKGFEVD-AYSREKINITLKELEEERAGVQHLLG----
MDH_AQUAR       PVTTENG-EYKIVQGLSID-AFSQERINVTLNELLEEQNGVQHLLG----
MDH_ACIAD       PVTCENG-EYKRVEGLEID-EFSRERMDKTLQELEEERAAIADMLK----
MDH_ACIBT       PVTTENG-EYKIVQGLEID-EFSRERINFTLNELEEERAAIADMVK----
MDH_XANAC       PVTTENG-KYTIVKDLPID-DFSQKYIDKTLAELEEERSGVAHLLG----
MDH_XANC5       PVTTENG-KYTIVKDLPID-DFSQKYIDKTLAELEEERSGVAHLLG----
MDH_XANCP       PVTTENG-QYTLVKDLPID-DFSQKYIDKTLAELEEERSGVSHLLG----
MDH_XANC8       PVTTENG-QYTLVKDLPID-DFSQKYIDKTLAELEEERSGVSHLLG----
MDH_XANOR       PVTTENG-QYSLVKDLPID-DFSQKYIDKTLAELEEERSGVSHLLG----
MDH_XANOM       PVTTENG-QYSLVKDLPID-DFSQKYIDKTLAELEEERSGVSHLLG----
MDH_XYLFA       PVTTTNG-EYSIVKDLPID-TFSKTYIDKTLAELEEERASIAHLLR----
MDH_XYLFT       PVTTTNG-EYSIVKDLPID-TFSKTYIDKTLAELEEERASITHLLR----
MDH_BURP0       PVICENG-EYKRVEGLEID-AFSREKMDGTLAELLEERDGVAHLLK----
MDH_BURP1       PVICENG-EYKRVEGLEID-AFSREKMDGTLAELLEERDGVAHLLK----
MDH_BURMA       PVICENG-EYKRVEGLEID-AFSREKMDGTLAELLEERDGVAHLLK----
MDH_BURPS       PVICENG-EYKRVEGLEID-AFSREKMDGTLAELLEERDGVAHLLK----
MDH_BURCM       PVVCENG-EYKRVEGLEID-AFSREKMDGTLAELLEERDGVAHLLKN---
MDH1_BURTA      PVTCENG-EYKRVEGLEID-AFSREKMDGTLAELLEERDGVAHLLK----
MDH_BURCA       PVTCENG-EYKRVEGLEID-AFSREKMDGTLAELLEERDGVAHLLKN---
MDH_BURCH       PVTCENG-EYKRVEGLEID-AFSREKMDGTLAELLEERDGVAHLLKN---
MDH_BURL3       PVVCENG-EYKRIEGLEID-AFSREKMDGTLAELLEERDGVAHLLKN---
MDH_PARXL       PVTCENG-EYKRVEGLEID-AFSREKMDGTLQELLEERDGVQHLLG----
MDH_CHRVO       PVVCENG-EYKRVEGLEID-AFSRERMDLTLAELEEERAAIAHLFG----
MDH_BORBR       PVVTENG-EYKMIKDLEID-AFSRERLDFTLKELLEERDGVKDLLK----
MDH_BORPA       PVVTENG-EYKMIKDLEID-AFSRERLDFTLKELLEERDGVKDLLK----
MDH_BORPE       PVVTENG-EYKMIKDLEID-AFSRERLDFTLKELLEERDGVKDLLK----
MDH_BORA1       PVTTANG-EYTMVKDLEVD-AFSRERMDFTLKELLEERDGIKDLLK----
MDH_SYNFM       PVTCTPG-KYERVKGLEID-AFSREKMDFTLKELTEEQAGVKEMVK----
MDH_BDEBA       PVTCKNG-EYEIVKGLEID-AFSREKMNNTLKELNEEKDAVASML-----
MDH_AROAE       PCECKNG-DFKIIQGLEID-EYSREKINKTLGELEDERAAVADMLK----
MDH_DECAR       PCECKGG-KFSIIQGLEID-EYSREKINFTLKELTDEAEAVKDML-----
MDH_AZOSB       PVTTENG-EYKIVQGLEID-EFSRERMTVTLNELLEEREGVKDLLA----
MDH2_RHOFT      PVITDCR-DYRIVPGLAVD-AFARGMIDVNVRELTAELEIVKPLLPELFG
MDH2_BURTA      PVICDGG-RYERVKDIGID-AFARQRIDLSVRELQEEADVVNRLFADR--
MDH_NITEU       PVVCKNG-GRKIVQGLEIS-PFSRTRLDIAYDELTQELDSIKHLLL----
MDH_NITEC       PVICKNG-MREIVQGLEIN-PFSRTRLDAAYNELTQELDSIRHLLP----
MDH_NITMU       PVTCQGG-EYKIVPDLEIS-EFSRMKMQASYRELMGERESIKHLLG----
MDH_DEIGD       PVRCRNG-QYEIVQGLEIS-DFSRQKMDATAKELEEEREEVRRLGLVK--
MDH_DEIRA       PVRVKDG-KYEIVQGLDVS-DFSRGKMDATAQELEEERDEVRKLGLVK--
MDH_THETH       PVTAKDG-AYRVVEGLEIN-EFARKRMEITAQELLDEMEQVKALGLI---
MDH_THET2       PVTAKDG-AYRVVEGLEIN-EFARKRMEITAQELLDEMEQVKALGLI---
MDH_THET8       PVTAKDG-AYRVVEGLEIN-EFARKRMEITAQELLDEMEQVKALGLI---
MDH_PSYA2       PCTCTNG-DWSIVDGVDVSSAFSKEKMAATEQELSEERDAVAHLLP----
MDH_PSYCK       PVTCANG-DWSIVDGVDVSSDFSKEKMAATEQELSEERDAVAHLLP----
MDH_ALCBS       PCTCKNG-DWTIVQGLEVN-DFSRGKMQATEQELAEERDAVSHLLP----
MDH_SACD2       PCVCKNG-DWEIVQGLTID-EFSRAKMTATENELKEERDAVKSLLPA---
MDH_ALKEH       PCVCRNG-DYEIVQDLEID-EFSREKMQATEKELVEERDAVEHLLP----
MDH_HALHL       PVTCRGG-DYKIVSGLSVD-DFSRARMDQTAAELAEERDAVAHLLP----
MDH_METCA       PVTIENG-RFRIVQDLPLD-TFSRERLRLTEVELLEERAMVSHLL-----
MDH_LEGPA       PCRRE-HGELKVVENLEFN-DFGRERFNTTLNELRSERDTVKSLGLLD--
MDH_LEGPH       PCRRE-HGELKVVENLEFN-DFGRERFNTTLNELRSERDTVKSLGLLD--
MDH_LEGPL       PCRRE-HGELKVVENMEFN-DFGRERFNITLNELRSERDTVKSLGLLD--
MDH_COXBU       PCRTE-NGVVSVIEEIEHN-EFGQQKLKETLDELREERDAVEALGLI---
MDH_LEPIN       PLKSD-GKKVEIIQGISLN-DFAKEKFKITHEELVSERNEVKEML-----
MDH_LEPIC       PLKSD-GKKVEIIQGISLN-DFAKEKFKITHEELVSERNEVKEML-----
MDH_LEPBJ       PLKSD-GKKVGIVQGLPFN-DFAKEKFKTTHDELISERNEVKDML-----
MDH_LEPBL       PLKSD-GKKVGIVQGLPFN-DFAKEKFKTTHDELISERNEVKDML-----
MDH_MAGMM       PLTSTGHGDWSIVEGVPMS-PFIKGKFDAVLDELRREREMVKDLLPG---
MDH_CHLTR       PCRMLATGEYEVIPRLPWD-AFIRGKMQISLDEILQEKASVSL-------
MDH_CHLTA       PCRMLATGEYEVIPRLPWD-AFIRGKMQISLDEILQEKASVSL-------
MDH_CHLMU       PCRMLGTGEYEIVPGLPWD-AFIRGKMQISLDEILQEKASVSL-------
MDH_CHLAB       PCRMLPSGDYEIVPGLLWD-TFIKNKIQISLDEISQEKANVSLL------
MDH_CHLFF       PCRMLPSGDYEIIPGLSWD-VFIKNKIQISLDEISQEKANVSLL------
MDH_CHLCV       PCRMLPSGDYEIVPGLPWD-AFIKNKIQISLDEISQEKASVSLL------
MDH_CHLPN       PCRMLPSGDYEIIPGLPWE-PFIRNKIQISLDEIAQEKASVSSL------
MDH_PARUW       PCRVKKNGELSIVSGLKWD-AFLEEKIKLTEQELKEEREMVSSILKI---
                *              .     :    :     *:  *   :