CLUSTAL format seed alignment for MF_01518

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ADEC_METAC       ----------------------------------------------------MKKYLGII
ADEC_METMA       ----------------------------------------------------MKKYMGII
ADEC_BORBU       --------------------------------------------------MDLFKIEANY
ADEC_METTH       ------------------------------------------------------MISGNI
ADEC_LISMF       -------------------------------MENLEQLQERVAVSDGRAKADLVIKNGRI
ADEC_LISMO       ------------------------------MVENLKQLQERVAVSDGRAKADLVIKNGRI
ADEC_LISIN       -------------------------------MENLKQLQERVAVSDGRAKADLVIKNGRI
ADEC_LACPL       ----------------------------------------------MTKTVEMVITGAQV
ADEC_BACSU       --------------------------------MNKEALVNRLNASAKRQKADIVIKNGKI
ADEC_ALKHC       ---------------------------------MTDRLERKLAIAANQDKADLLIKNGQI
ADEC_OCEIH       ------------------------------MNSTIEQLKHRIAVASKRKPAELVIKNAEV
ADEC_CLOAB       ----------------------------------MYCIEEKIEKALGIKEASLVLKNCNI
ADEC_DESVH       -------------------------------MTYRPLLNDLVDMAAGRAPVDLVVRNARI
ADEC_ECOLI       ---------------------MNNSINHKFHHISRAEYQELLAVSRGDAVADYIIDNVSI
ADEC_ECO57       ---------------------MNNSINHKFHHISRAEYQELLAVSRGDAVADYIIDNVSI
ADEC_ECOL6       ---------------------MNNSINHKFHHISRAEYQELLAVSRGDAVADYIIDNVSI
ADEC_SHIFL       ---------------------MNNSINHKFHHISRAEYQELLAVSRGDAVADYIIDNVSI
ADEC_BDEBA       ---------------------MSLS-NKKTQKIASDLLPARLSQARGDGTLDLLITNVQM
ADEC1_AGRFC      ----------------------MAIIPGVEQKPMSSNLESRIDQGTGREPADMVLKGGRF
ADEC1_RHIME      ---------------------------------MSEALERLIDQGVGREPADIVLKGGRF
ADEC_BRUME       ------------------MRHCDSFCELIPMKGCEAILEWMIDQGAGREPADIVLKGGRF
ADEC_BRUSU       ------------------MRHCDSFCELIPMKGCEAMLEWMIDQGAGREPADIVLKGGRF
ADEC2_AGRFC      -------------------MTAQIRLAEPADLNDDTLRARAVAAARGDQRFDVLITGGTL
ADEC2_RHIME      ----------------------MTVLQQPADLDDACLRARAVAAARGDARFDVLVAGGTV
ADEC_DEIRA       -------------MTPSPHDLLHCGMNSQDRDETNGDRQRLVRVALGQEDGDLLVRGAQV
ADEC_RHILO       -------------------MAKKPAAHATKPKPWTEMATHLVDVAMGRKPADLVIRNGRW
ADEC3_RHIME      -----------------------------MLQPWSEIAPRLVDVAMGRKPADLVVRNGRW
ADEC1_BRADU      ----------------------MTRLTRFAVAPLHSMTRRLADVASARVAPDLVVTGARV
ADEC2_BRASO      ----------------------MTNLTRFSVAPLHTMTRRLADVASGRVAPDLVITGARV
ADEC2_BRADU      ---------------MRQVMNAIPDDLLITAPDEVRIRQDLVLTALGHRPADRSLRVGRL
ADEC1_BRASO      ----------------MDLAQDIADDLMIDAAQEVRIRQDLVLTALGHRPADRALRVGRL
ADEC2_JANSC      -----------------MTDQPAPTDHLIRAADEVKIRQRLVRVALGHVAGDTRLRVGKL
ADEC_CLOPE       ------------------------------------------------MQVELIIKNLKV
ADEC_ENTFA       ------------------------------------------------MNVDVLLKNVWL
ADEC_METJA       ---------------------------------------------------MIVFKNTKI
ADEC_ARCFU       ---------------------------MSSPTADVEKLRRIIEVARGDRRADFVVKNAQI
ADEC_METKA       MARSNRRGGRGDPEDDPAWAPPGHRCAGERAVGGPTVIPRAYLPAVPAGGNESRAFQGRF
ADEC_CENSY       ------------------------------MRPLSRSISRLAAVAMGDRKADLIIQNCSL
ADEC4_RHIME      ---------------------------------MSDVREFIRAASGGESKATVAVCGGRL
                                                                             

ADEC_METAC       VDAVSRRQFK-GEITVENGKILRVEEKEHD----------------HERYILPGLVDAHV
ADEC_METMA       VDAISRRQFK-GEITVENGKIIRVEEKEHD----------------NEQYILPGLVDAHV
ADEC_BORBU       IDIFNKEIYP-ASIAIANGHIASIEKINAT----------------LDEYVLPGFIDAHI
ADEC_METTH       LNVFTGDIYP-AEIEVAGGRVRCVRSISGN----------------FSDIIIPGFIDAHL
ADEC_LISMF       INVFSGEIMD-GDIAIKNGYIAGIGNFPD----------AEKIIDAAGAFIAPGFIDAHV
ADEC_LISMO       INVFSGEIMD-GDIAIKNGYIAGIGSFPD----------AEKIIDAAGAFIAPGFIDAHV
ADEC_LISIN       VNVFSGEIME-GDIAIKNGYIAGIGHFPD----------ADQIIDAAGEFISPGFIDAHV
ADEC_LACPL       LNVYTREFEA-TSLWIDHGRI--ISNLRDE------PYIAAQHVDATGQWIVPGMIDAHV
ADEC_BACSU       MDVYNQEWIY-EDIAITDGVIVGLGEYEG-----------ENIIDAEGQMIVPGFIDGHV
ADEC_ALKHC       VDVFQLETFE-GDVVIADGEIVAISDPGTY------EA--HEEVDAKGAFIAPAFIDGHV
ADEC_OCEIH       LNVFTGDWKK-TDVAIADGYIAGL---GNY------EG--LQTVDATGKKIVPGLINGHI
ADEC_CLOAB       VNVFSSEIIR-GDLAIDGDTIIGIGKYKG-----------KTEIDLSNKYVAPGFIDSHV
ADEC_DESVH       VDVFSQRIVE-APLAIGGGRFLGFFEAEA-----------HATLDAEGRYLLPGLIDGHV
ADEC_ECOLI       LDLINGGEIS-GPIVIKGRYIAGVGAEYTD------AP-ALQRIDARGATAVPGFIDAHL
ADEC_ECO57       LDLINGGEIS-GPIVIKGRYIAGVGAEYTD------AP-ALQRIDAHGATAVPGFIDAHL
ADEC_ECOL6       LDLINGGEIS-GPIVIKGRYIAGVGAEYAD------AP-ALQRIDARGATAVPGFIDAHL
ADEC_SHIFL       LDLINAGEIS-GPIVIKGRYIAGVGAEYAD------TP-ALQRIDARGATAVPGFIDAHL
ADEC_BDEBA       LDVITGDIYP-TCIAIGGEHIVGVGMEYQT------QS-ARRTWNALGAFVTPGFIDGHL
ADEC1_AGRFC      FDLVTGELVA-SDIAICGDTVVGTCGDYK----------GRHEIDISGKIVVPGFIDTHL
ADEC1_RHIME      FDLVTGELVA-SDIAISGERIVGTCGDYE----------GREEIDVTGRIVVPGFIDTHL
ADEC_BRUME       LDLITGELVE-SDIAICEDRIVGTFGTYR----------GKHEIDVSGRIVVPGFIDTHL
ADEC_BRUSU       LDLITGELVE-SDIAICEDRIVGTFGTYR----------GKHEIDVSGRIVVPGFIDTHL
ADEC2_AGRFC      VDVVTGELRP-ADIGIVGALIASVHEPASR-------RDAAQVIDAGGAYVSPGLIDTHM
ADEC2_RHIME      VDVVTGECRA-ADVGIVGALIASVHAPGSR-------SDADTVIDAAGAYISPGLIDTHM
ADEC_DEIRA       VQPVTREVYA-ADVLVAGGRVAAVGPDLPA-------R-ARRTVQARGAYLAPGFIDGHI
ADEC_RHILO       VNVHSGEIIAGTDIAIAGGRFAYCGPNASH-----AIGQGTKVVDAGGRYLVPGLCDAHM
ADEC3_RHIME      VNVYSGEIVPGADIAIVGGRFAYVGPDAGH-----TIGEGTKIVDAAGRYLVPGLCDGHM
ADEC1_BRADU      LSTYSERIHANREVWITGGRVAAVKPAGTAR----KAWSGVALYDAAGAIIAPGLVDPHI
ADEC2_BRASO      LSTYSERILRDRELWITGGRVAAVKPAGAHK----ALPSGFTIYDAAGGIIAPGLVDPHI
ADEC2_BRADU      LDVHSRTWSEDQEIVIKGRRIAWVGPAGSY------PGEVRERVHRPDVAAVPGFGEVHK
ADEC1_BRASO      LDVHSRTWSEDQEIVFKGRRIAWVGPAGSY------RGEVRERVQRPDLAAVPGFGEVHK
ADEC2_JANSC      LDVHSRMWLSDQEIILSGRRIAYVGPAGSY------PGGVAHEVHEPDLMAVPGFGEVHK
ADEC_CLOPE       YNSYFKKFIK-SDVLINEGKFLHIGKGYED------RLWSENIIDGEDKYIIPGLIDIHM
ADEC_ENTFA       YQTVTQTFVQ-RNVAIKNDKFYYIYEEENV------NLQPQKTINAENQWMIPGLIDAHM
ADEC_METJA       IDVYTGEVVK-GNVAVERDKISFVDLNDEIDKIIEKIKEDVKVIDLKGKYLSPTFIDGHI
ADEC_ARCFU       VDLVNEEIFE-GDIAVAEGFIAGIGSYSGV-----------EECEASNLVAVPGLIDAHT
ADEC_METKA       VDPWFSGIRT-GYVIWDGGRLLGVTRNEPE----------HADVIDVDGIICPGFVDAHV
ADEC_CENSY       VSVYTGEVIEGTEIAVSGDRIAYVGPDASHA-----RGAGTVIHNAQGRYAAPGFADPHI
ADEC4_RHIME      VNVVSEEIYQ-ADVAIYRDRIIAVGDISEY------IGPQTEIIDAADRYLTPGMIDGHL
                  .           :      .                               * : : * 

ADEC_METAC       HIESSMTVPSVFARMAVAKGTVAVVSDPHEIANVMGEEGIDFMLGDSKR-SPLKVFFGVP
ADEC_METMA       HIESSMTVPSVFARMAVAKGTVAVVSDPHEIANVMGEEGIEFMLEDSKK-SPLKVYFGVP
ADEC_BORBU       HIESSFLVPSNFAHLVVAHGTVATISDPHEIANVNGIDGINFMINNSKK-TEFKFFFGAP
ADEC_METTH       HIESSMLIPSSFAAAAIPHGTVSAISDPHEIANVMGVDGVRFMIDDAAA-TPMKFYFTAP
ADEC_LISMF       HVESAMVTPAEFARVLLPNGVTTIVTDPHEIANVAGEKGIEFMLEDAKG-VPIDMFVMLP
ADEC_LISMO       HVESAMVTPAEFARVLLPNGVTTIVTDPHEIANVAGEKGIEFMLEDAKG-APLDMFVMLP
ADEC_LISIN       HVESAMVTPSEFARVLLPNGVTTIITDPHEIANVAGEKGIEFMLEDAKG-APLDMFVMLP
ADEC_LACPL       HMESSMVAPSELGKVLLQHGVTTIATDPHELANVAGIAGIQYLIDDARQ-TPLDVCFMLP
ADEC_BACSU       HIESSMVTPIEFAKAVLPHGVTTVVTDPHEIANVSGEKGIEFMLEQARH-TPLNIHFMLP
ADEC_ALKHC       HIESSMVAPEQFAKVVVPHGVTTVIADPHEIANVAGVQGVEYMLDASEG-IPLDVKMMVP
ADEC_OCEIH       HIESTMLTPREFSKVMLKHGVTTAITDPHEIANVAGTDGLEYMLNASDA-LPMNIFVNMP
ADEC_CLOAB       HIESSMVSPKEFARAVISRGTTTIIVDPHEIANVCGMDGIKYMMEETKN-MPLDVFFMLS
ADEC_DESVH       HIESSLVSPAQFARLVLARGTTAVIADPHEIANVCGLAGLRYMLDATRD-LPLDVRLALP
ADEC_ECOLI       HIESSMMTPVTFETATLPRGLTTVICDPHEIVNVMGEAGFAWFARCAEQ-ARQNQYLQVS
ADEC_ECO57       HIESSMMTPVTFETATLPRGLTTVICDPHEIVNVMGEAGFAWFARCAEQ-ARQNQYLQVS
ADEC_ECOL6       HIESSMMTPVTFETATLPRGLTTVICDPHEIVNVMGEAGFAWFARCAEQ-ARQNQYLQVS
ADEC_SHIFL       HIESSMMTPVTFETATLPRGLTTVICDPHEIVNVMGEAGFAWFARCAEQ-ARQNQYLQVS
ADEC_BDEBA       HIESSMMSPFEFEKATLPLGTTTAICDPHEITNVLGGRGFSWFLRSSEL-MHQNLFVQMS
ADEC1_AGRFC      HIESSLVTPHEFDRCVLPYGVTTAICDPHEIANVLGAEGLQFFLDSAME-TIMDIRVQLS
ADEC1_RHIME      HIESSLVTPHEFDRCVLPLGITTVVCDPHEIANVLGTEGIQYFLDSAME-TVMDIRVQLS
ADEC_BRUME       HIASSQVTPHEFDRCVLPQGVTTAICDPHEIANVLGAEGIRFFLDSALE-TVMDIRVQLS
ADEC_BRUSU       HIESSQVTPHEFDRCVLPQGVTTAICDPHEIANVLGAEGIRFFLDSALE-TVMDIRVQLS
ADEC2_AGRFC      HIESSMITPAAYAAAVVARGVTTIVWDPHEFGNVHGVDGVRWAAKAIEN-LPLRAILLAP
ADEC2_RHIME      HVESSMVTPAVYAAAVVPRGVTTVVWDPHEFGNVSGLAGVRWAVDAMGG-LPLRAVVLAP
ADEC_DEIRA       HIESSLLTPASFAAAVLPHGTTAVVAEPHEIVNVLGPAGLNWMLGAGRT-SGLRVYASAP
ADEC_RHILO       HVESGMVTVTEFCRAVIPHGTTSMFIDPHEIANVLGLPGVRLMHDEAVA-MPINVHVQMP
ADEC3_RHIME      HVESGLVTVTEFARAVIPHGTTTMFVDPHEIANVLGIAGVKLMNDEAQT-LPVNIFVQVP
ADEC1_BRADU      HIESSMVTACAYAEAALLNGTTTIFCDSHEIGNVMDVAGVEAMLEDARQ-APLSIFLTVP
ADEC2_BRASO      HIESSMVTACAYAEAALLNGTTTIFCDSHEIGNVMDTAGVEAMLEDARQ-APLSIFLTVP
ADEC2_BRADU      HIESSHLTPEWEAALVLPHGNTWTCEASHEFSNVNGARNLEFWFEARRRGSPLKIFPQPG
ADEC1_BRASO      HIESSHLTPEWEAALVLPRGNTWTCEASHEFSNVNGARNLEFWFEARRRGSPLKIFPQPG
ADEC2_JANSC      HIESSHVTPEWEAALVLPHGNTWTCEASHEFSNVNGPHNLEFWLTARLAGSPQKIFPLPG
ADEC_CLOPE       HIESSMTIPREFSKAAIKHGVTTVVADPHEIANVFGVRGIEEFIKFKGN---LDIFYGIP
ADEC_ENTFA       HIESSMTTPTIFSKAVVRYGVTTVIADAHEMANVFGLEGLKAFMAAETE---LDIFHAIP
ADEC_METJA       HIESSHLIPSEFEKFVLKSGVSKVVIDPHEIANIAGKEGILFMLNDAKI---LDVYVMLP
ADEC_ARCFU       HIEMSMLTVSEFARLVVPRGTTGVVADPHEIANVLGKDGVMLMLEEARS-TPLRFYCMVP
ADEC_METKA       HVESSGLRPARYAEIVVREGTTAVVWDPHEVVNVSGELGLEWAVKTAEEALPFKFYIALP
ADEC_CENSY       HVDQ-FVTPAELAAQSVLHGTTSLFSDPIDMVGVAGYRGFRTLMNMSKD-LPARFFHVVP
ADEC4_RHIME      HVECSKLSLTSFAKAVLPLGTTSIVSGLDQIIVVGGPDAAREFLDEVRQ-TPLKVFWGAP
                 *:              :  *         :.  : .                        

ADEC_METAC       SCVPA---TPFESAGSVLDAEAVDRLLA-REDLYYLSEMMNFPGVVLGFP------DVMA
ADEC_METMA       SCVPA---TPFESSGAVLDINAVDRLLA-KDDLHYLSEMMNFPGVILEFP------DVMA
ADEC_BORBU       SCVPALS-QEFETSGYVLNDKDIDELMK-LDDIYYLAEVMDFKGVINKDI------EIIN
ADEC_METTH       SCVPA---TPFETAGAEITARGIEELLR-MDSVVALGEMMNFPAVIAGDD------GVMA
ADEC_LISMF       SSVPA---TEGEHNGETLHAEKLHPLYR-HEKVIGLAEVMDFPSVAKGSS------DILT
ADEC_LISMO       SSVPA---TEGEHNGETLHAEKLHPLYR-HEKVIGLAEVMDFPSVAKGSD------DILR
ADEC_LISIN       SSVPA---TEGEHNGETLHAKQLHPLYK-HEKVIGLAEVMDFPSVAKGSA------DILT
ADEC_LACPL       SSVPC---VPFDDNGATLHAADLRPLYQ-QSEVRGLAEVMDYGAVARGDT------DTLA
ADEC_BACSU       SSVPA---ASFERSGAILKAADLKPFYE-EEEVLGLAEVMDYVSVQQAEK------DMVQ
ADEC_ALKHC       SCVPA---TPFEHSGARLTAEEVAELFR-DPRIFGLGEVMDYPAVLTRDQ------EMMA
ADEC_OCEIH       SSVPA---TQFEHNGAQLDAKDISSYFQ-NPNVLGLAEVMDFPSVANADQ------KMLE
ADEC_CLOAB       SCVPA---TSFETSGAVLKAEDLKELID-SDRVLGLGEMMNYPGVLSREE------EVLN
ADEC_DESVH       SCVPA---TPFENAGAVLDAAALATLMD-DPRVAGLGEMMNFPGVLAGDA------DVLD
ADEC_ECOLI       SCVPA--LEGCDVNGASFTLEQMLAWRD-HPQVTGLAEMMDYPGVISGQN------ALLD
ADEC_ECO57       SCVPA--LEGCDVNGASFTLEQMLAWRD-HPQVTGLAEMMDYPGVISGQN------ALLD
ADEC_ECOL6       SCVPA--LEGCDVNGASFTLEQMLAWRD-HPQVTGLAEMMDYPGIISGQN------ALLD
ADEC_SHIFL       SCVPA--LEGCDVNGASFTLEQMLAWRD-HPQVTGLAEMMDYPGVINGQN------ALLD
ADEC_BDEBA       SCVPA--LPGFETTGSDFPLEEMKSFKD-HPSVLGLAEMMNFPGVIHADE------EVLA
ADEC1_AGRFC      SCVPA---THLETSGADLPIEKLLPFRN-HPKVIGLAEFMNFPGVIHKDP------VCMA
ADEC1_RHIME      SCVPA---THLETSGADLPVGRLTPFRH-HPKVIGLAEFMNFPGVVNKDP------VCLA
ADEC_BRUME       SCVPA---THMETSGAELLIDDLLPFAD-HPKVIGLAEFMNFPGVLAKDP------ECMA
ADEC_BRUSU       SCVPA---THMETSGVELLIDDLLPFAD-HPKVIGLAEFMNFPGVLAKDP------ECMA
ADEC2_AGRFC      SCVP-SA-PGLERGGADFDAAILADLLS-WPEIGGIAEIMNMRGVIERD----PRMSGIV
ADEC2_RHIME      SCVP-SA-PGLEVAGADFDADAVAEMLS-WPEIGGIAEVMNMRGVIDGD----PRMTAIV
ADEC_DEIRA       SCVP-AS-EFEQ-GGARVDAAQVAEMLA-RPGVLGLAEMMNYPGVLGGD----AGVWDIL
ADEC_RHILO       SCVP-SA-PGLEHAGAELTVADVAEAMT-WENIIGLGEVMNFPGVAAND----PVMSGEI
ADEC3_RHIME      SCVP-SA-PGLENAGATLSAADVREALA-WPNIIGLGEMMNFPGVAAND----SKMVAEI
ADEC1_BRADU      STVPATS-AELETAGGDLTPDKIAGLFDRWPEAVALGEKMDFVPVTMGD----ERSHAIL
ADEC2_BRASO      STVPATS-AALETAGGDLTPDKIAGLFDRWPEAVALGEKMDFVPVCMGD----ERSHAIL
ADEC2_BRADU      SAVP--P-TAYEWGGGWYGRDEQARFMAESLMVTGLDEVMDWPAVWNPDNPSYKRLWGMI
ADEC1_BRASO      SAVP--P-TAYEWGGGWYGGAEQASFMRESLMVTGLDEVMDWPAVWNPDNPSYERLWGMI
ADEC2_JANSC      SAVP--P-TAYEWGGGHFGYDEQAGFLNESLMVAGLDEVMDWPAVWNPENPSYDRLWGMI
ADEC_CLOPE       SSVPSTS-SSLETTGEKITHNEVKRLLE-YDNIICLGEVMNFKDLIEDDD---SNINKII
ADEC_ENTFA       SSVPSTT-PELETTGGIIGLAEVAELLK-EPKVICLGEAMNFKGISYEPD---SLIRQII
ADEC_METJA       SCVPA---TNLETSGAEITAENIEELIL-LDNVLGLGEVMNYPAVINEDE------EMLK
ADEC_ARCFU       SCVPS---SPLETSGARIGVEEIRELLE-EEEVLGLAEMMNFPGVVSADR----------
ADEC_METKA       SCVPALG-PPYETVEGEITVDVARKFAS-HPMVVSVGELMDVAGVMEGEK--------DE
ADEC_CENSY       GGLPV---DGRFSHSNTLSPEEERSAIG-LPDVLGMGEVFSWTKVTSRDP------GTMR
ADEC4_RHIME      CKTPY--TMPRSTVGHYFSPKDHRDTHH-WPECVGIWETVREFIQEEDED-------VLQ
                    *                               : * .                    

ADEC_METAC       KLESAKKCGKVIDGHAPGLR-GADLETYIGVGISTDHESFTYEEAVEKIKLGMKILIREG
ADEC_METMA       KLESARKHGKVIDGHAPGLR-GADLQKYIGAGISTDHECFEYEEAREKIELGMKILIREG
ADEC_BORBU       KINSALKRNKVVDGHAPGLS-PNLTLKYASSGISTDHECLTIEDARYKLSLGMKILIREG
ADEC_METTH       KIKAARDLNMPVDGHAPLLS-GDELCTYIGAGISTDHECVSPEEVLEKRRLGMKIMAREG
ADEC_LISMF       KIIDAKKEGGRIDGHGAGLT-SADLNNYLAVGIRTDHESTTAKEATDRLRAGMFVMLREG
ADEC_LISMO       KIIDAKKEGGRIDGHGAGLT-SADLNNYLAVGIRTDHESTTAKEATDRLRAGMFVMLREG
ADEC_LISIN       KIIDAKQEGGRIDGHGAGLT-SADLNNYLAVGIRTDHESTSAKEALDRLRAGMFVMLREG
ADEC_LACPL       KISDAYAYGYHADGHAAGLN-AHQLNVMRNAGLDTDHECMTVAEAQDRVRAGMAVFLREG
ADEC_BACSU       KLLDARVAGKRIDGHLAGLS-TDLINIYRTAFVLNDHEVTSKEEALDRIRRGMYVMMREG
ADEC_ALKHC       KLKAAHSEGRIVDGHGAGLD-SVALNAYTAAGIGNDHEAVTPEEAKARLQRGMYLLIREG
ADEC_OCEIH       KIVSTIQHGGIIDGHAAGLS-KEDLNIYMAAGIRNDHESVSAQEGKDRLEAGMYLMIREG
ADEC_CLOAB       KLKLAGSYNKIVDGHAPSVR-GNELNAYNLAGIKTDHECSSIEEMNEKIRNGMYIAIREG
ADEC_DESVH       KIALALDRGKTVDGHSPGLA-GRDLATYAAARIATDHECTTVDEMHERIALGMYVLLREG
ADEC_ECOLI       KLDAF--RHLTLDGHCPGLG-GKELNAYITAGIENCHESYQLEEGRRKLQLGMSLMIREG
ADEC_ECO57       KLDAF--RHLTLDGHCPGLG-GKELNAYIAAGIENCHESYQLEEGRRKLQLGMSLMIREG
ADEC_ECOL6       KLDAF--RHLTLDGHCPGLG-GKELNAYIAAGIENCHESYQLEEGRRKLQLGMSLMIREG
ADEC_SHIFL       KLDAF--RYLTLDGHCPGLG-GKELNAYIAAGIENCHESYQLEEGRRKLQLGMSLMIREG
ADEC_BDEBA       KIEAF--DDLNMDGHAPLLR-GKALNAYLLAGIQNCHETVTLEEGREKLQKGMGLIIREG
ADEC1_AGRFC      KLEAF--QGQHIDGHAPLLS-GAALNGYLAAGIRTEHECTSAAEALEKIRKGMHILVREG
ADEC1_RHIME      KLDAF--QDGHIDGHAPLLR-GKELNGYLAAGIRTDHECTSAEEALEKIRKGMHILVREG
ADEC_BRUME       KLRAF--QGRHIDGHAPLLR-GLDLNGYIAAGIRTEHEATNAEEALEKLRKGMYVLVREG
ADEC_BRUSU       KLRAF--QGRHIDGHAPLLR-GLDLNGYIAAGIRTEHEATNAEEALEKLRKGMYVLVREG
ADEC2_AGRFC      QAGLAA--EKLVCGHARGLK-NADLNAFMAAGVSSDHELVSGEDLMAKLRAGLTIELRGS
ADEC2_RHIME      EAGLKA--GKPVNGHARGLE-GADLQAFVTAGVSSDHELVSGDDLIAKLRAGLSIELRGS
ADEC_DEIRA       NAGRRS--GKRLDGHAAGLG-GRELLAYAAAGLHSDHEATTPEEARERLRAGLWLMVR--
ADEC_RHILO       AATVRA--GKTVGGHYASRDLGLPFHGYVAGGPEDDHEGTRAEDAIARVRQGMKAMLRLG
ADEC3_RHIME      AATRAA--GLTVGGHYASPDLGRAFHAYAAGGPADDHEGTTVEDAIARVRQGMRSMLRLG
ADEC1_BRADU      AAALKR--GRPVSGHVYGREFVAAYAASGVTDTHEAIDRDIADDLLDAGVWVFLRGGPPT
ADEC2_BRASO      AAALQR--GRPVSGHVYGREFVAAYAASGVTDTHEAIDRDIADDLLDAGVWIFLRGGPPT
ADEC2_BRADU      EATFAA--RGVVEGHASGLRDLPSINAFAAAGLASDHEVQTPEETWDKLTRGLFVELR--
ADEC1_BRASO      GATFAA--RGVVEGHASGLRELPEINAFAAAGLASDHEVQTPEETWDKLTRGLFIELR--
ADEC2_JANSC      EATFEK--RGVIEGHAAGIRDMATINAFAAAGLASDHEAWTTEEVLDKLRRGLFMELR--
ADEC_CLOPE       NISKEK--NIPLEGHCPKIQ-GVDLSLYIYRGVNGDHTQQSVGSLQEKIQNGMFIEMQ--
ADEC_ENTFA       DLCQKQRPTMPLEGHCPKIE-DQELADFLYSGITSDHTHQFPKTLKEKIEAGVFIQFQ--
ADEC_METJA       KIEVAKKYNKLIDGHCPKLK-GWELNKYISHGIMSDHESVDEDEALEKLRLGLKLMIREG
ADEC_ARCFU       EVLEKIVLAGIVDGHAPGLR-GKKLNAYIAAGASSDHETTSFEEGKEKLRLGMWVMIREG
ADEC_METKA       FIELKSLYGLTVDGHAPGLT-GFEAMRYFAAGPETDHECSTAEEFTSRRELGVWTFVRQG
ADEC_CENSY       SIGTMLDGGCIINGHTAGAS-GKKLSAYVSAGILSCHEPVNAEQAEERLRLGMWVMMREG
ADEC4_RHIME      AIEIGQANRLPVLGCCPMTR-GARLNGYMQSGVRADHESYTPEEMLEKLRAGMHVVVRES
                              *                                      .       

ADEC_METAC       SSARNFETLYSLIDE----YPEAVMLCTDDSHPDTLIYEGHIDKLIRRGQEKGLDIFNLI
ADEC_METMA       SSARNFETLYPLIDE----YPDHVMLCTDDSHPDTLIYEGHIDKLIRRGQEKGLDIYNLI
ADEC_BORBU       SAAKNFESLHPLISECSKKYCDSLMFCFDDAHPND-ILNGHINLIVARAIKHGHDFFDVL
ADEC_METTH       SSARNLRDLAAAGCD---------FLVSDDIHPAD-LLEGHMDRILRRAVDYGIDPVSAV
ADEC_LISMF       ---TVGRDLLQTIPAVSEKNSHRFCFCTDDKLINDLITEGSINYNIRLAIKNGIDPITA-
ADEC_LISMO       ---TVGRDLLQTIPAVSEKNSHRFCFCTDDKLINDLITEGSINYNIKLAIKNGIDPITA-
ADEC_LISIN       ---TVGRDLKQTISAVTEKNSHRFCFCTDDKLINDLLTEGSINYNIRLAIENGVEPITA-
ADEC_LACPL       ---TVERDVLPTIGAVTEANASRFAFCTDDKMISDLLTEGSIDYNVRLAMQSGMRPELA-
ADEC_BACSU       ---SVAKNTLNVLPAVNEKNARRFFFCTDDKHVDDLLSEGSVNHQVKMAIQAGLNPFLA-
ADEC_ALKHC       ---TAAKDFDALMKAITPMNSRRALFVTDDKHLDELVEEGSIDHHVRKAIQIGVNPLQA-
ADEC_OCEIH       ---TVAKDLEALLPIINDKNARRCIFVTDDMLLDDLVENGDIDHIIRKAIQLGLDPVMA-
ADEC_CLOAB       ---SAAKNLDILIKGVNAKNERRIMFCADDRHPDDILKSGHMDNCVRRAIYNGIENTAA-
ADEC_DESVH       ---SAARDMARLAPGITPGNARRCVFCTDDRQPADILRDGHIDNHLRIAVSHGVDPVTA-
ADEC_ECOLI       ---SAARNLNALAPLINEFNSPQCMLCTDDRNPWEIAHEGHIDALIRRLIEQHNVPLHVA
ADEC_ECO57       ---SAARNLNALAPLINEFNSPQCMLCTDDRNPWEIAHEGHIDALIRRLIEQHNVPLHVA
ADEC_ECOL6       ---SAARNLNALAPLINEFNSPQCMLCTDDRNPWEIAHEGHIDALIRRLIEQHNVPLHVA
ADEC_SHIFL       ---SAASNLNALAPLINEFNSPQCMLCTDDRNPWEIAHEGHIDALIRRLIEQHNVPLHVA
ADEC_BDEBA       ---SVAKNLRTLAPLVNEFSSPQCLLCTDDRNPFEIAHEGHINYLIKELINKHGVAVHVA
ADEC1_AGRFC      ---SVSKDLHALMPIITERLSPYLALCTDDRNPLDIAEQGHLDYMIRTAIASGVEPLAI-
ADEC1_RHIME      ---SVSKDLQALMPILTERLSPYLALCTDDRNPLDIAEQGHLDNMIRTAISAGVEPLAI-
ADEC_BRUME       ---SVSKDLKALMPIITERHAQFLALCTDDRNPLDIADQGHLDYLIRTAIAGGVEPLAI-
ADEC_BRUSU       ---SVSKDLKALMPIITERHAQFLALCTDDRNPLDIADQGHLDYLIRTAIAGGVEPLAI-
ADEC2_AGRFC      --HDHLLPEFVAALNTLGHLPQTVTLCTDDVFPDDLLQGGGLDDVVRRLVRYGLKPEWAL
ADEC2_RHIME      --HDHLLPEFVIALGTLGHLPQTVTLCTDDVFPDDLHRDGGLDDVVRRLVRYGLKAEWAL
ADEC_DEIRA       --EGSAARNLAALLPVLRDLPRRALLVSDDVSVDELLELGHLDRLLRTCVAGGLHPADAV
ADEC_RHILO       SAWYDVASQIKAVTEGGIDP-RNFILCTDDSHSGTLVHEGHMDRVVRHAIQQGLKPVTAI
ADEC3_RHIME      SAWFDVAAQVKAITERGIDP-RNFVLCTDDSHSGTLVSDGHMNRVVRHAISQGLKPITAI
ADEC1_BRADU      TPWHSLPQAIRTITELGASH-KRTAVCTDDRDADDLLLFG-LDWVVREAVKAGMSPEQAW
ADEC2_BRASO      TPWHSLPQAIRTITELGASH-KRTAVCTDDRDADDLMLFG-LDWVVREAVKAGMSPEQAW
ADEC2_BRADU      --VYAMDEIVRWLLAKGLQDWSQIAFTTDDRSASHTLELGASDHNARLAIEAGLAPEIAI
ADEC1_BRASO      --IYAMPEIIGWLLKKGLQDWSQIAFTTDDRSASHTLALGASDHNARVAIEAGLAPEIAI
ADEC2_JANSC      --PHSLSEMVKGLLEAGLEDWGQFALTTDDRSCSDTLKMGATDHNVRLAISAGLSPEVAI
ADEC_CLOPE       ----HKSMTLENIKFLIENNLYEHFALVTDDVMADKLVKGHLDEILKEAVKLGMSIENAI
ADEC_ENTFA       ----NKSITPENIQVIVDNDFYNYASIITDDVMADDLLKGHLNENVKKAVHAGLPIEKAI
ADEC_METJA       ---TASKNIYLLNICKKIKDFRNIMLVSDD------VCIKDLDGYMLNILRKATNYVSPI
ADEC_ARCFU       -----SAARNLVALKGLTGNRHTMLVTDGDRSVKDIIEEGYLDHVFRRAIEEGIDEIKAL
ADEC_METKA       -----SSSKDMEVALETLEDLRGVCFVTDDLHVKD-MDEISLRKIVGRAIEAGFDPLESL
ADEC_CENSY       S-IRRDLAEILPPMLKKEAGLDRLMFCTDGIDPVDMGEKGHIDHCVREAVRLGADPVRAI
ADEC4_RHIME      SISHFLSDNLRIVTEMGVKALRRISFCTDDVVASDILSRGHLDNMVRMAMAMGISPMAAI
                                              .                              

ADEC_METAC       RAAVINPVEHYGLN--VGLLREGDPADFITVDDL-KSFNVLSTFIDGECVYEN-----GK
ADEC_METMA       RTAVFNPVEHYGLN--VGLLREGDPADFIIVDNL-KSFNILSTFIDGECVYEN-----GK
ADEC_BORBU       KIACINPVLHYKIP--VGLLRIGDPADFIITKDI-KTFKINKTYINGKLVFND-----GI
ADEC_METTH       QMVTINPAEHYGLS--TGAIAPGWDADFVVVDSL-RDFNVKRVYIDGRPVADR-----GR
ADEC_LISMF       IQMATINAANCHNLPYLGAVAAGYQADIVFLTDI-ETVEISKVLKNGEVVVDN---GVRH
ADEC_LISMO       IQMATINAANCHNLPYLGAVAAGYQADIVFLTDI-ETVEISKVLKNGEVVVDN---GVRN
ADEC_LISIN       IQMATINAANCHNLPYLGAVAAGYQADIVFLKDL-KTIEISKVLKNGQVVVEN---GTRK
ADEC_LACPL       YTLASLNGAMAHRLSDRGSLSAGQLADLVVLDDL-EHVRIARTMKRGQWILPS---TTK-
ADEC_BACSU       YQLGSLNAAECYGLDTKGAIAPGFDADLLFVSDL-ENVTVTMTMVKGQTVAEDSKAVYQD
ADEC_ALKHC       IQMASLNAAECFKLAKKGAIAPGFTADLLFIEDL-QSLAITHVFKNGTCVAKNGKLIVP-
ADEC_OCEIH       YQMATLNTAECFGLRELGAVAPGYIADFLILNDE-NQVDIHQVYKNGKCVVDEGEINQSY
ADEC_CLOAB       IRMASINAAECYKLERVGAIAPSYKADLVVLEDL-KDVKVNMVIKSGEVVFKDN--KHLK
ADEC_DESVH       VTIATLNAAECFGLRDRGAVAPGRVADFVLVDDL-TGFAVRKVYAAGRLVARDG--AVVV
ADEC_ECOLI       YRVASWSTARHFGLNHLGLLAPGKQADIVLLSDA-RKVTVQQVLVKGEPIDAQT--LQAE
ADEC_ECO57       YRVASWSTARHFGLNHLGLLAPGKQADIVLLSDA-RKVTVQQVLVKGEPIDAQT--LQAE
ADEC_ECOL6       YRVASWSTARHFGLNHLGLLAPGKQADIVLLSDA-RKVTVQQVLVKGEPIDAQT--LQAE
ADEC_SHIFL       YRVASWSTARHFGLNHLGLLAPGKQADIVLLSDA-RKVTVQQVLVKGEPIDAQT--LQAE
ADEC_BDEBA       YRLATYSAARHFGLKRLGLVAPGKKADLVFLKDL-KAVDIQEVMIGGKFVSELK--LQDS
ADEC1_AGRFC      YRAASISAAKAFGLRDRGLVAPGWRADLVVIDTL-QNCKASMVLSGGRLVDDAL--FATR
ADEC1_RHIME      YRAASISAARAFGLRDRGLVAPGWRADLVIVDSL-ENCKAELVLSAGRRVTDAL--FAGR
ADEC_BRUME       YRAASVSAARVFGLFDRGLVAPGQRADLVVVDSL-EGCHAEIVLSAGRVVSEAL--FAAR
ADEC_BRUSU       YRAASVSAARAFGLFDRGLVAPGQRADLVVVDSL-EGCHAEIVLSAGRVVSEAL--FAAR
ADEC2_AGRFC      RAATLNAAQRLGRS-DLGLIAAGRRADIVVFEDL-NGFSARHVLASGRAVAE--GGRMLV
ADEC2_RHIME      QAATLNAARRLGRA-DLGLIAPGRRADIVLFEDI-RDFRALHVLANGRLVAS--GGGMLQ
ADEC_DEIRA       ALVTSQPAEYWGLH-DLGVIAPGYHADFVLLRDL-QHFGVLETFVGGEEARP--GG----
ADEC_RHILO       QMATINTAQHFRLEREIGSIAPGRLADLLIVSDL-AAMTIDEVYARGVRLAK--GGKLDI
ADEC3_RHIME      QMATLNTAQHFGLERDLGSIAPGRRADLIVTSDL-TALPIEIVFVRGRLLAE--KGVLVA
ADEC1_BRADU      SMGSLHGATRFGMEGDIGGLGGGRRADLVLMDD---QLKPQCTWYGGELVVE--HGKITP
ADEC2_BRASO      SMGSLHGATRFAMDGEIGGLGGGRRADLVLLDD---GLKPQSTWYGGELVVD--QGKITS
ADEC2_BRADU      QCLTINPARHMRLTPFVGSLAPGRFGDVVLLSDV-GKLTIAEVWADGVQISE--GERYIG
ADEC1_BRASO      QCLTINPARHMRLTPFVGSLAPGRFGDVVLLSDV-GKLEIAEVWADGAQVSE--GTRYLG
ADEC2_JANSC      QMVTINPARHMRLTPWVGSLAPGRFADIVLLDDL-PSVSIRQVWADGELVAE--DGTYLK
ADEC_CLOPE       YASTYTPARRMNLL-DRGTIAPGKLADFILLDSI-EDFNIYEVYKNGEMVFNRDKGLKEE
ADEC_ENTFA       YMATYTPAKRMGLH-DRGEIAPGKKADFLLLNDL-ESFDINTVYKSGKVVFE--KGEPFH
ADEC_METJA       EAIQMVTINPANYFGFDVGIKAGNEASFVIFEDL-DNFKVYNIVIKGRFLDD-----VLN
ADEC_ARCFU       QMLTLNPAEYFGIN--AGLIAPSRLADIVLLKNL-RKFEVRDVFVGGR------------
ADEC_METKA       SAVTLNPSLCYGLQ--SGRLVPGFHADIVVVEDLDENMELTDVWIGGKRSERVRFRDAEA
ADEC_CENSY       AMASRNCFDYYNMARDLGGISPGRIADIQMLYDL-ESFRPEDVFVGGNRMVSG-----GK
ADEC4_RHIME      QMATINGAEALRIDHKVGSISPGRTADILIVNDL-RDFRIEAVVANGTVAARD---GRMV
                                    :  .  ...                  *             

ADEC_METAC       VLFPMK--KVPAKNVFNRNKISIDAAKLAVPAEETGDR--KEGMRKIRVIVARDGELVTG
ADEC_METMA       VLFPLE--KVPAKNVFNRNKISIDDVKLVPPAGAIQEQTTEKGIKKIRVIVANDGELVTG
ADEC_BORBU       SLIPLI--NEIPINNFNCSKKSISDFKFSTKN------------KMIPVIKCISNQIITH
ADEC_METTH       YLIRRSGGTRAPPRKLEVPDFPVERLNIRAEGDE----------ATVRVIDVLDGQLITE
ADEC_LISMF       EAAFKQQAAVPFVSPPINHHVSLQDLALPLTKET---------CYVIGMQPNSLFTEKRI
ADEC_LISMO       EAAFKQQAAVPFVSPPINHHVHLQDLALPLTKET---------CYVIGMQPNSLFTEKRI
ADEC_LISIN       EAAFKKENKAKFISPKINHHLSIKDLELPLTNET---------CYVIGMQQNNLFTEKLM
ADEC_LACPL       --------PLPFTATRVQHHAQLADFQLPLATGL---------ANVIGVQPNHIETDHLT
ADEC_BACSU       HASTAAPDQALLDSVKLAAPLNKQDFHMPIDSEQQ--------INVIQIIPNQLETRLVQ
ADEC_ALKHC       IRETVQPPQRLLESVNMKLVTK-EQLELSLQSDEE--------AHLIQIQPGSIVTKHIR
ADEC_OCEIH       FAASLTYDATTLPKPRIQQLKA-SDFSIDL-TDDY--------CNIIEIVPNKIITNHVC
ADEC_CLOAB       DMGSKSDITKVSNTVNIKKVSE-ENLELKLDTDV---------CSIISVALNSISTKNVK
ADEC_DESVH       DLPDHAD-PAVRDTVNIRPLDD-TAFRLPLPTGL---------ARVIGLQPHSLLTDALE
ADEC_ECOLI       ESARLAQSAPPYGNTIARQPVSASDFALQFTPGKR--------YRVIDVIHNELITHSHS
ADEC_ECO57       ESAKLAQSAPPYGNTIARQPVSASDFALQFTPGKR--------YRVIDVIHNELITHSHS
ADEC_ECOL6       ESARLAQSAPPYGNTIDRQPVSASDFALQFTPGKR--------YRVIEVIHNELITHSRS
ADEC_SHIFL       ESARLALSAPPYGNTIARQPVSASDFALQFTPGKR--------YRVIDVIHNELITHSRS
ADEC_BDEBA       LQEKLQTSQPPLENTMKRSPLTEKELTVNLLPGV---------YNVIEIVPHEIITQHLT
ADEC1_AGRFC      KPVAPVGL-----DSVKARPVLASHFGVPVTEGE---------TPVMGVLPGKIITEHRR
ADEC1_RHIME      KPVEPVGL-----DSVKAREVKAADFGLPYNEGE---------TSVLGVLPGKIITEHRR
ADEC_BRUME       KPVAEVGR-----NSVKAPRVTASNFRSQSNSGK---------TRAIGIVPGKIITQNLE
ADEC_BRUSU       KPVAEVGR-----NSVKAPRVTASNFRSQSNSGK---------TRAIGIVPGKIITQNLE
ADEC2_AGRFC      DIPTCDTTVLKGSMKLPLRMANDFLVKSQGAKVRL--------ATIDRPRFTQWGETEAD
ADEC2_RHIME      APVAAGVSPLRHTMKIEPLTEDDFRIAATGSTARV--------VTIDRPRFTRWGETRAE
ADEC_DEIRA       --------------ETPPLPGGGVDLGPGWDGATF--------DPP--AHWPTLQMFPDQ
ADEC_RHILO       DIPAYDYPKTAKNTVKLGKKLRAGDFDITAPKGAN--------EVRVRVIGVIENQAPTR
ADEC3_RHIME      DIPAYDYPASAKNTVKLGKRLAPTDFDICAA-GSS--------EVEVRVIGVIENQAPTK
ADEC1_BRADU      RLDQALSQRYQYPKAAYATVKLPEKVKLTPELPAK--------ACTVNAIKTALPGITLI
ADEC2_BRASO      LLDQALSQRYQYPKAAYATVKLPAQMKLTPELPAK--------ACTVNAIKTALPGITLI
ADEC2_BRADU      QVPEIVWPDWATKTVNIKRSIKPQDFELRAEPGRA--------TMKAAVIRPFHWHPEFY
ADEC1_BRASO      DVPRIAWPDWATQTINIKREIKAEDFALPAAPGRT--------TMQAAVIRPFHWHPEFY
ADEC2_JANSC      PIPKIDWPDWATQTVKIDRAMMADDFAIPAKRGRD--------TMHAALLRPFHWDDDFI
ADEC_CLOPE       FFEDKSKLDYRFYNSIELNNITKESLEVKVPNKYK--------NKVNCRTMKVLKNTTFT
ADEC_ENTFA       YPEKIEEFPATYQQTIQCKKLTEEDLLLKVATT-K--------ETVRCNVIQKQEIGTFT
ADEC_METJA       ELNKNKKRKIPEKLMNTLKYQYKNEGDFLIKGIDY--------KERDGFIRVIKPLKDSL
ADEC_ARCFU       -RPEFKRFNHPEWAKKTVKARKITPESIQLKTGRV--------RVIEVYDGEIVTGEAIE
ADEC_METKA       ELPDVELSVDPREVSFQDGKYEVRCVGLVRGSIRT-----------EEIVREITVKDGAV
ADEC_CENSY       LVSRQHPVKAPSWTRRTIRLGRLTAADFAVHSRKK---------TEQVNTITMKTEIITE
ADEC4_RHIME      VKLVPPQRSAGLLRSVKTTPVTAADIAVPFTGTTPF-------AEVLAIAVTPEKVFVRT
                                                                             

ADEC_METAC       QELAFPKVENGNMVSDPEKDILKMVVLSRYADDP---VQIGFIKNIGLKEGAIASSIAHD
ADEC_METMA       QELIVPKIENGNLVSDPERDILKMVVLSRYSDDP---VRIGFIKNIGLEKGAIASSIAHD
ADEC_BORBU       KTMIDSNLLAPDFQSNIAEDILKIAIINRYKDNSK--ISIGFIKNFGIRNGAIGSTVAHD
ADEC_METTH       ELIATLEVEDGTVQADTSSDILRVSVLDRYGRGN---ISSGFVHGFGLQEGAIASTVAHD
ADEC_LISMF       E---QVAIQDGKFVPTVENDLLKMAVVERHHDTGC--VGLGIVKGFGLTEGAIATTVAHD
ADEC_LISMO       E---QVTIQGGKFVPTVENDLLKMAVVERHHDTGC--VGVGIVKGFGLTEGAIATTVAHD
ADEC_LISIN       E---QVTIKNGKFVPSIEKDLLKMAVVERHHNTGC--VGVGIVKGFGLTEGAIATTVAHD
ADEC_LACPL       L---PIDATQ-NFEADCQRDILKMVVIERHHNTGK--VGVGLVHGFALKQGAIAGTVAHD
ADEC_BACSU       V---PAPVAR-EFEPDTELDLLKIAVVERHKGLKE--TGLGVVKGFGFKSGAIATTISHD
ADEC_ALKHC       E---KVAVKDGVFIPSVARDQLKLVVAERHHKRGT--VGVGIVKGFGLTKGAIATTVAHD
ADEC_OCEIH       E---RVEVKEGKFVPSVDKDQLLIAVVERHKGLGY--IGKGIVKGFKMKEGAIATSVAHD
ADEC_CLOAB       R---KVNLSNGIFKCELNYGINKVAVIERHKKSGS--IGIGLVENFGLKRGAIASTVAHD
ADEC_DESVH       R---DVPRDASGCFTPGD-GLVKLAVVERHKATGN--VGVGIIEGYGLRGGAVATTVAHD
ADEC_ECOLI       S---VYSENG-----FDRDDVSFIAVLERYGQRLA--PACGLLGGFGLNEGALAATVSHD
ADEC_ECO57       S---VYSENG-----FERNDVCFIAVLERYGQRLA--PACGLLGGFGLNEGALAATVSHD
ADEC_ECOL6       S---VYSENG-----FDRDDVCFIAVLERYGQRLA--PACGLLGGFGLNEGALAATVSHD
ADEC_SHIFL       S---VYSENG-----FDRDDVCFIAVLERYGQRLA--PACGLLGGFGLNEGALAATVSHD
ADEC_BDEBA       V---AFDGQK-----FAESDVLYMANIERYGKGLP--PALGLVKGMGLKSGALASSVAHD
ADEC1_AGRFC      Y---KLPTDGNQTTVDLENDIIKVAVIERHGKNGN--HANGFVQGFGLKKGAIASTVGHD
ADEC1_RHIME      Y---RLPAEGNRTGVDLDRDIIKVAVIERHGVNGN--HANGFVQGFGLKKGAIASTVGHD
ADEC_BRUME       F---DLKVGPNGVEPDLERDVVKVAVIERHGKNGN--IATGFVHGFGLKAGAIASTVSHD
ADEC_BRUSU       F---DLKVGPNGVEPDLERDVVKVAVIERHGKNGN--IATGFVHGFGLKAGAIASTVSHD
ADEC2_AGRFC      VKDGFVVP---------PEGATMISVTHRHG-MAEPTTKTGFLTGWGRWNGAFATTVSHD
ADEC2_RHIME      VSGGYLVP---------PKGMTLIAVAHRHG-RADSRPRVGLLEGWGEWRGAFATTVSHD
ADEC_DEIRA       IVTGRAAP---------GSGDARLVVADRYG-RGE--WSSCWTLGSGLRGGTLGISILHD
ADEC_RHILO       ALEADLPVEDGLVAMDRRNDVCQIALVERHRGTGGVTNAFVSGFG-YMGDCAMASSVAHD
ADEC3_RHIME      ALQRRLPVECGVVQMDRASDVCQIALVERHRATGGVINAFVSGFG-YDTHCAMASTVAHD
ADEC1_BRADU      HEKVAIEPAKDWPTLFARYGLCFVTVVERHGKSAGNVAYGLLKDF-GLKRGAVASSVGHD
ADEC2_BRASO      HEKVAIKPANDWDTLFARHGLCFVAVIERHGKSAGNVAHGLLKDF-GLKRGAVASSVGHD
ADEC2_BRADU      TLELPVR--DGAVQRDESEAITKFAIVDRFSGDGRIAKMFWRGCGPRTPETAVACSVAHD
ADEC1_BRASO      TFELAVR--DGAVQRDESQAITKFAIVDRFSGDGLVSKMFWKGCGPRTPETALACSVAHD
ADEC2_JANSC      TMDLPVK--DGQVQRDPRRNVTKFAIVDRFSGEGKTSAMFWLGTGPRTSDTALACSMGHD
ADEC_CLOPE       EEGEVTLNVYNNILQWEKSSCALIAVFERYGKNNN--ISFGLVEGEIIKEGAIATTWAHD
ADEC_ENTFA       ERITKEIPVENGLLQWQKANCALLIVMERYGKNGN--ISFSLMDQPLSEKGAIATTWAHD
ADEC_METJA       ITEELIFSTEEIKILLNENAINKIFVIERHKNTGN---IGKGLIYNFLEEGALASSYAHD
ADEC_ARCFU       E----------VQGVDVERDILKAVVVERHIRSGR--VGKAYVRGFGLKRGAIAQSIAHD
ADEC_METKA       K----------------DDDVAFLVVTDRYGQGSW---SIGFVEGFEELDCAVVSTVAHD
ADEC_CENSY       QGSAELSVKEGNVEPSRDSDVWKVAAFDRLSGNGG--RTVGFLENFGADIGALASSWSFH
ADEC4_RHIME      RRDVRLPVVDGKILADASQNVQYVTVVERYGKTLN--RPVAFVSGFNLKSGAIASSTAPD
                                             *                      :.  :   .

ADEC_METAC       SHNIIAVGATDKDIVEAVNRLVENKGGIVVGTAE--NLLDLPLEVAGLMSTLDGVEVASR
ADEC_METMA       SHNIIAVGATDEDIVETVNRLIKNKGGIAVGTAE--NLLDLPLEVAGLMSTLEGEEVASR
ADEC_BORBU       SHNIILVGSNDEYLCKAANTIIQNKGGLCALNNE--KTIIMELPISGLMSTLSAERVASQ
ADEC_METTH       SHNLIVVGVDPELMKRAVDILKKAGGGLVAVSGD--DHRVLQLPVAGLMSDGDVFEVADG
ADEC_LISMF       SHNIVAVGISDEAMKAAIDHITQTGGGIAVVNGAGQVLHDLALPIAGLLSDKSYEEVEND
ADEC_LISMO       SHNIVAVGVSDEAMKAAIDHITQTGGGIAVVNGAGQVLHDLALPIAGLLSDKSYEEVEND
ADEC_LISIN       SHNIVAVGVSDEAMEKAIDHVTKTGGGIAVVDAAGNVLHDLALQVAGLLSDKPYEEVEND
ADEC_LACPL       AHNIVAVGTSDAAILRAVAQITQDNGGIAVVDNE-QVLATMPLAIGGLLSAASYQKVAEQ
ADEC_BACSU       SHNIIAVGTNDEDIAAAVNKLQEIGGGLTIIKNG-EELHSVPLPIAGLLSDQSAEQVNQS
ADEC_ALKHC       SHNIVAVGTNDEDLLAAIKELENIQGGMTIVKDG-KVLVSLPLTIGGLMSDQSYDVVCEQ
ADEC_OCEIH       SHNFVVVGTSEEEMLSAIKKVEQLDGGLVVTKRK-QVKAHLALPIGGLMSDKDYLDAYEE
ADEC_CLOAB       SHNIIVLGNNDEDMVKAVNEIERVGGGITISLDG-KIIETLELEIAGLMSNKSMEFVAER
ADEC_DESVH       SHNIVVAGDNDADMLVAVRELERTGGGITLCAGG-RVLASLPLPVAGLMSDRPATEVSAT
ADEC_ECOLI       SHNIVVIGRSAEEMALAVNQVIQDGGGLCVVRNG-QVQSHLPLPIAGLMSTDTAQSLAEQ
ADEC_ECO57       SHNIVVIGRSAEEMALAVNQVIQDGGGLCVVRNG-QVQSHLPLPIAGLMSTDTAQSLAEQ
ADEC_ECOL6       SHNIVVIGRSAEEMALAVNQVIQDGGGLCVVRNG-QVQSHLPLPIAGLMSTDTAQSLAEQ
ADEC_SHIFL       SHNIVVIGRSAEEMALAVNQVIQDGGGLCVVRNG-QVQSHLPLPIAGLMSTDTAQSLAEQ
ADEC_BDEBA       SHNIMVIGTNPADMVLAVNTLIKSGGGFAVADQG-EIKALVELPIAGLLSLKSAEEIKDG
ADEC1_AGRFC      SHNICVVGVSEDDMALAANRLGDIKGGFVVVEDG-RVTGEIALPVAGLMSLEPYETVRDT
ADEC1_RHIME      SHNICVVGVNDDDMALAVNRLGEIKGGFVVVHDG-KVTGEIALPVAGLMSLEPYERVRDT
ADEC_BRUME       SHNICVVGASDEDIATAANRLGEIEGGFVVVRDG-KVLAEIPLPIAGLMSTEPYETVREA
ADEC_BRUSU       SHNICVVGASDEDIATAANRLGEIEGGFVVVRDG-KVLAEMPLPIAGLMSTEPYETVREA
ADEC2_AGRFC      SHNLTVFGGNAGDMALAANAVIGTGGGMAVASEG-KVTAILPLPLSGLVSDAPLEEVARA
ADEC2_RHIME      SHNLTVFGSSPRDMRVAANAVIEAGGGMAVVAEG-KVEALLPLPLCGLVSDAPLAEVAAG
ADEC_DEIRA       AHQVALLGGSDADLRAAGRALERLGGGIVLVVDG-EVREQLPLPYAGLMTDHAPAEAAAA
ADEC_RHILO       AHHIICVGTNKQDMALAVNRLGQVGGGVVLFSKG-KELALVEMPIAGLMSDERAEIVAAK
ADEC3_RHIME      SHHMIVVGTNKADMAQAANRLQEVGGGIVLIAGG-RELALVELPVAGLMSDQRAEIVAEK
ADEC1_BRADU      SHNIIVAGTNEPDMQVAIAAIKEHQGAVCVVADG-KVRALVPLPIAGLLSDKRVTEVAEE
ADEC2_BRASO      SHNIIVAGTNEADMQTAVAAIGAQQGGVCVVADG-KVRAMVPLPIAGLLSDKRVTAVAEE
ADEC2_BRADU      KHNIWVVGSSDAAMAKAVNALIELQGGWALVREG-ELVATVRFEVGGLMSCRSAQALDAE
ADEC1_BRASO      KHNIWAVGSSDAAMAKAVNALVAQQGGWALVREG-ELAATVRFEVGGLMSCRRAEALDAE
ADEC2_JANSC      KHNVWAVGSSDAAMAMAVNALRDIQGGWALVREG-QLVATVRYEVGGLMTCRPPAELDAE
ADEC_CLOPE       HHNLMVMGRNISDMTIAANEVINSRGGYVVSKNN-EVIAKLELPIGGIISDEPIEIIGEK
ADEC_ENTFA       HHNLMVMGNTIEDILLAQNELLAMQGGYLVASDQ-QVMATCPLPIGGILSQAPIEQLGAS
ADEC_METJA       SHNVIAIGNNEKDLALAVNKLKDIGGGFIAAKDG-EVVEYLPLPVGGIMGDD-GKYIAEK
ADEC_ARCFU       AHNIVCVGVDDGSICAAVNRVIELQGGIVVADAE--VRAELPLPIAGIMSDERAERVLER
ADEC_METKA       SHNVVVAGRRLDDVRRALQLVSEVGGCVGAVAGD--RAEFVRLDVAGLMSSSDPEEVKKS
ADEC_CENSY       ENDLVVLGSSEIEMAKAANAVMDKGGGIAVVQKG-RVSAMLPLQICGIISSDPFGKVSEG
ADEC4_RHIME      DNNIICIGADPQDMAIAINHLVANNGGQVVVDKG-EVVEFLHLPIGGIVSDIDPAEMAAF
                  :..   *     :  :   :    *                    *::           

ADEC_METAC       YRLLNEEARK----------------LGTSLESPFMTLAFMSLLVIPELKLGDKGLFDVT
ADEC_METMA       YHLLNEEARK----------------LGTSLESPFMTLAFMSLLVIPELKLGDKGLFDVT
ADEC_BORBU       YIKLNDFCKNV---------------LGSRLDDPLMTLSFMSLTVVPHLKINDKGLFDVD
ADEC_METTH       FENLNTFTEQ----------------LGSRLSAPFMTMSFLSLLVIPRLKIGDRGLFDVE
ADEC_LISMF       LAGLLNAFKQIS---------------TADGFDPFLTLSFLTLPVIPELKLTDQGLFDFA
ADEC_LISMO       LAGLLNAFKQIS---------------TANGFDPFLTLSFLTLPVIPELKLTDQGLFDFA
ADEC_LISIN       LAGLLKAFNQIS---------------KAKGFDPFLTLSFLTLPVIPELKLTDQGLFDFA
ADEC_LACPL       LAELKRAYEVISE--------------RPLSFDPFITLSFLTLPVIPTLKLTARGLFDYA
ADEC_BACSU       LLTLHDKLSLIG---------------FTGGFNPFLTLSFLALPVIPDIKMTTTGLFDVK
ADEC_ALKHC       IKSVDAAIGALG---------------FVGDFNPFLTLSFLALPVIPEIKLTDQGLFDVT
ADEC_OCEIH       VLKLNHVAVENG---------------IPSNFNPFLTLSFLTLPVIPTLKVTDQGLFDFK
ADEC_CLOAB       VSKMINICHNTLG--------------VNKDIQPFMTLAFLALPVIPEIRITDKGVFDVV
ADEC_DESVH       FAQMLSIAHETLH--------------ISRDIEPFMTLSFLTLPVIPALKLTDRGLFDVR
ADEC_ECOLI       IDALKAAARECG----------------PLPDEPFIQMAFLSLPVIPALKLTSQGLFDGE
ADEC_ECO57       IDALKAAARECG----------------PLPDEPFIQMAFLSLPVIPALKLTSQGLFDGE
ADEC_ECOL6       IDALKAAARECG----------------PLPDEPFIQMAFLSLPVIPALKLTSQGLFDGE
ADEC_SHIFL       IDALKAAARECG----------------PLPDEPFIQMAFLSLPVIPALKLTSQGLFDGE
ADEC_BDEBA       IADLKTAFRSLG----------------VHLDEPFIQMAFLALPVIPTLKLTDRGLVNVT
ADEC1_AGRFC      LHTLRKAAYALG----------------TTLEEPFLQVAFLPLPVIPHLKISDMGMVDVD
ADEC1_RHIME      LHHLRQAAFALG----------------ATLEEPFLQLAFLPLPVIPHLKISDRGLVDVD
ADEC_BRUME       LRKLRHAAEDLG----------------SVLEEPFLQLAFIALPVIPHLKITDRGLVDVD
ADEC_BRUSU       LRKLRHAAEDLG----------------SVLEEPFLQLAFIALPVIPHLKITDRGLVDVD
ADEC2_AGRFC      FEDLREAVGKV------------VEWQPPYLVFKACFGATLACNIGPHQTDMGIADVLTG
ADEC2_RHIME      FAAIREAAGRI------------VEWQPPYLVFKACFGATLACNAGPHQTDRGIADVATG
ADEC_DEIRA       LGRVTAAARLL------------GCMPAGRL-----------------------------
ADEC_RHILO       AEKLTEA----------------MRKMGCSLNNAYMQHSLLALVVIPELRISDVGLIDVT
ADEC3_RHIME      ASRLVEA----------------MRACGCKLNNAYMQHSLLALVVIPELRISDVGLIDVT
ADEC1_BRADU      VKVLKKE----------------WAEAGCTI--PYMGFNLIPLSVIPEIRITDKGLVLVP
ADEC2_BRASO      VKLLKKE----------------WAEAGCTI--PYMGFNLIPLSVIPEIRITDKGLVLVP
ADEC2_BRADU      MQALYAEGRKVDWMYEPTYRPRWYPGFPERLMFATLTCAPWSWVLVAPCEQAPLGFINVQ
ADEC1_BRASO      MQALYAEGRKVDWMYEPTFRPRWYPGFPERLMFATLTCAPWSWVLVAPCEQAPQGFINVQ
ADEC2_JANSC      MQALYAEGEKIDWMYEPTVSPRWFPGFPERLAFATLTCAPWRWVLVAPSDRAPDGFVNVA
ADEC_CLOPE       LGEVRNA----------------MRDLGYNHMNEIMSFSTLSLPVSPALKITDKGLIDVK
ADEC_ENTFA       LQKVRQA----------------MQALGYQNMNEIMSFSTLSLPVSPAIKVTDFGMMDTK
ADEC_METJA       INALYKKIEGWS-----------------SFENPFLSMSFFSLPVIPELKITDKGLVKDM
ADEC_ARCFU       LSEIEEEVRKLG----------------CRLKSPVITLSFIALPVIPKLKLTDLGLVDVE
ADEC_METKA       YEDVLELIRSSS----------------GVDWDPFQALSFVTLPVVPELRLTDRGLVKVE
ADEC_CENSY       LSKLTSVMTDAG----------------CTFQRPHLVPVFLPFLALPSVRILYSGMVDVR
ADEC4_RHIME      ELRLDEAARRLG----------------CDLPWPFMYMFVLQITAIPDYAMTDLGVVDCV
                    :                                                        

ADEC_METAC       --KFEFVELFAEE---------------------
ADEC_METMA       --KFEFVDLFADE---------------------
ADEC_BORBU       --SFCFVDY-------------------------
ADEC_METTH       --KFEIKNLMEM----------------------
ADEC_LISMF       --TFQIISNEVN----------------------
ADEC_LISMO       --TFQIISNEVN----------------------
ADEC_LISIN       --TFQIIPNEVN----------------------
ADEC_LACPL       --TFDFIPVAIQDNQRQTV---------------
ADEC_BACSU       --SFQHISLQ------------------------
ADEC_ALKHC       --SFSFIDQQVYAEETN-----------------
ADEC_OCEIH       --TFSHINVEVEEK--------------------
ADEC_CLOAB       --NFKFL---------------------------
ADEC_DESVH       --TFSFTTVGV-----------------------
ADEC_ECOLI       --KFAFTTLEVTE---------------------
ADEC_ECO57       --KFAFTTLEVTE---------------------
ADEC_ECOL6       --KFAFTTLEVTE---------------------
ADEC_SHIFL       --KFAFTTLEVTE---------------------
ADEC_BDEBA       --NFSFIPLQVEA---------------------
ADEC1_AGRFC      --RFALI---------------------------
ADEC1_RHIME      --RFMLIG--------------------------
ADEC_BRUME       --KFEFVGN-------------------------
ADEC_BRUSU       --KFEFVGN-------------------------
ADEC2_AGRFC      --KVMESPVIEVLG--------------------
ADEC2_RHIME      --KLLESPVLETF---------------------
ADEC_DEIRA       ----------------------------------
ADEC_RHILO       --TFQKVDLFV-----------------------
ADEC3_RHIME      --RFESTEVIVR----------------------
ADEC1_BRADU      --QMELAPLFE-----------------------
ADEC2_BRASO      --QMELAPLFE-----------------------
ADEC2_BRADU      --TGEAHPVIW-----------------------
ADEC1_BRASO      --TGKTHPVVW-----------------------
ADEC2_JANSC      --TGQTHPVVW-----------------------
ADEC_CLOPE       --KGSIVSLF--KKGLY-----------------
ADEC_ENTFA       --SQRFYPLVFPEDGVLLHENTH-----------
ADEC_METJA       --QLVDLFI-------------------------
ADEC_ARCFU       --AFRVVDLQAD----------------------
ADEC_METKA       PDEIRFVDIITDGDPVE-----------------
ADEC_CENSY       --RRSYIPVIAGARTASQRPKTLRNIKKGPKSVR
ADEC4_RHIME      --NLRIISPLAPDGPAKANTLAAE----------