CLUSTAL format seed alignment for MF_01521

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MNTP_BACVZ       -MSNLFIGELVSLSIMAFALGTDAFSVGLGMGMIQLK-------------KKQIFHIGVV
MNTP_BACSU       -MSDLFIGELITLSIMAFALGMDAFSVGLGMGMVKLR-------------KKQIFYIGFI
MNTP_BACLD       MNVDVLIGEILTLSMMAFALGMDAFSVGLGMGMAKLK-------------RNQVFQIGVI
MNTP_BACP2       --MYELAGELLTLSIMAFALGMDAFSVGLGMGMIQLR-------------FRQIIYIGLV
MNTP_GEOKA       --MGAFIGEIIALSMMALALGMDAFSVALGMGLLRLR-------------LRQMFYIGLT
MNTP_GEOTN       --MGALIGEMIALSLMALALGMDAFSVALGMGLLRLR-------------LRQIFYIGLT
MNTP_GEOSW       --MKMFIGELVALSMMAFALGMDAFSVALGMGLFRLQ-------------LKQIFYIGIM
MNTP_BACAN       ----MTFEQLIPLIIMAFALGMDAFSVSLGMGMMALK-------------IRQILYIGVT
MNTP_BACAA       ----MTFEQLIPLIIMAFALGMDAFSVSLGMGMMALK-------------IRQILYIGVT
MNTP_BACC0       ----MTFEQLIPLIIMAFALGMDAFSVSLGMGMMALK-------------IRQILYIGVT
MNTP_BACAH       ----MTFEQLIPLIIMAFALGMDAFSVSLGMGMMALK-------------IRQILYIGVT
MNTP_BACAC       ----MTFEQLIPLIIMAFALGMDAFSVSLGMGMMALK-------------IRQILYIGVT
MNTP_BACC3       ----MTFEQLIPLIIMAFALGMDAFSVSLGMGMMALK-------------IRQILYIGVT
MNTP_BACC1       ----MTFEQLIPLIIMAFALGMDAFSVSLGMGMMTLK-------------IRQILYIGVT
MNTP_BACCQ       ----MTFEQLIPLIIMAFALGMDAFSVSLGMGMMALK-------------IRQILYIGVT
MNTP_BACCZ       ----MTFEQLIPLIIMAFALGMDAFSVSLGMGMMALK-------------IRQILYIGVT
MNTP_BACC7       ----MTFEQLIPLIIMAFALGMDAFSVSLGMGMMTLK-------------IRQILYIGVT
MNTP_BACHK       ----MTFEQLIPLIIMAFALGMDAFSVSLGMGMMALK-------------IRQILYIGVT
MNTP_BACCR       ----MTFEQLIPLIIMAFALGMDAFSVSLGMGMMPLK-------------LRQILYIGMT
MNTP_BACC4       ----MTFEQLIPLIIMAFALGMDAFSVSLGMGMMPLK-------------LRQILYIGMT
MNTP_BACC2       ----MTFEQLIPLIIMAFALGMDAFSVSLGMGMMPLK-------------LRQILYIGMT
MNTP_BACMK       ----MTLEQLIPLIIMAFALGMDAFSVSLGMGMVTLK-------------LRQILYIGMT
MNTP_BACSK       ------MHEFVTICIMAAALGMDAFSVALGMGMLKLS-------------GKQIFRIGLT
MNTP_BACHD       -----MVEELIALLIMASALGMDAFSIALGMGTLGLR-------------FSQMFKVGLT
MNTP_OCEIH       ---MPFTSEIISIILLAIGLSMDGFSVSLGLGMQQLR-------------LKRIAYIGLT
MNTP_DESRM       -------MSLFTLFALAVALGTDAFSLCIGIGIAGVN-------------RRQIALISLT
MNTP_PELTS       -------MSFFTLMALAVALGTDALSLSVGIGLTGIS-------------RRRILQISAT
MNTP_CARHZ       -------MSLWEIFLLAVALGTDSFSLCVGLGMGKIK-------------RKEIIALSLT
MNTP_DESAP       -------MTAGTVLLLAGALGTDAFSLCLGLGLNGFR-------------RRMAWMLVGL
MNTP_HELMI       -------MTYWTLGVLAVGLGADAFSMALGIGMEGVR-------------RRDAFMLGLV
MNTP_MOOTA       -------MEPLGLILVAVALGTDAFSLATGLALGGFR-------------GRQAWLFAGT
MNTP_SYNWW       -----MIEILITIILLAIVLGMDALSLAMGMGLRGVA-------------KDYEKKFVLT
MNTP_ARCB4       ---------MLEVLILAFALSMDAFAVSIGLGIK-----------NKQNLKALALKAGLF
MNTP1_WOLSU      ---------MIELLLLSLALSMDAFAVSLGLGAR-----------FGYN-KRESLRPALS
MNTP_COLP3       ---------MIEVIILAIALSMDAFAVSIGLGAT----------KQQSKVAPLGIIVALY
MNTP_SACD2       ---------MIDVVLLALALSMDAFAVSIGLGAK----------NKASPVV-LGLKAALY
MNTP_PSYA2       -----MDIEMIEVILLAIALAMDAFAVSIGLGAK-------SQKQSSAYVLRLAVYAALY
MNTP1_PSYCK      -----MDIEMIEVILLAIALAMDAFAVSIGLGAK-------SQKQSSAYVLRLAVYAALY
MNTP_PSYWF       ---------MIDVLFLAIALAMDAFAVSIGLGAKQANTAFSSAAKAKSMLLKLALMAALY
MNTP2_PSYCK      ---------MLEVLLLALALAADAFAASIGLGST-------HKSDVNSQFMKMALLIGVY
MNTP2_WOLSU      ---------MIELTALAIALSMDAVAVSIALGSK-----------CEEEIRQLALKAGGF
MNTP_CAMFF       ----------MELIFLSIALAMDSVAISMANGAR-----------CMNIKALQIFKMSFL
MNTP_CAMHC       ----------MEILLLAVALSMDCVALSMSNGAK-----------CANYGIFRITKVSFV
MNTP_CAMC1       ----------MQLLLLSFALSMDSAALNMANGAR-----------YKSLGFGKILFIAFM
MNTP_CAMC5       ----------MEILLLAFALAMDSVALSIASGAK-----------CRTLSFLQVLKTALI
MNTP_RUMCH       -------MSLTELILLAIGLSMDASAVSISNSLC-----------IKKIKIKHILQMAVM
MNTP_ACTSZ       ------MSYY-TLWVIAFGLSMDAFAVSVGKGLTLAD-----------FCWKFTLKIALC
MNTP_MANSM       ------MSLF-SLWVMAFGLSMDAFAVSICKGLAMEK-----------FQWCGALKAGLY
MNTP_HUNT2       ------MSSI-ELLIIAVGLSMDAFAVAICKGLSMKK-----------MSYRNAVLTGCF
MNTP_DESHY       ----MIMGNL-ELFLIAVGLSMDAFAVAISKGLSMRR-----------MSYKTALITGLF
MNTP_ALKOO       ------MGLI-ELTFIAVALSMDAFAAAICKGLCMKK-----------NALKNTIIVGIF
MNTP_CAMJE       ------MDFY-SLIFLSCALGMDAFAVSLCKGFSVKK-----------LHLKHYLIVGIY
MNTP_CAMJR       ------MDFY-SLIFLSCALGMDAFAVSLCKGFSVKK-----------LHLKHYLIVGIY
MNTP_CAMJJ       ------MDFY-SLIFLSCALGMDAFAVSLCKGFSVKK-----------LHLKHYLIVGIY
MNTP_CAMJ8       ------MDFY-SLIFLSCALGMDAFAVSLCKGFSVKK-----------LHLKHYLIVGIY
MNTP_CAMJD       ------MDFY-SLIFLSCALGMDAFAVSLCKSFSVKK-----------LHLKHYLIVGIY
MNTP_LACP7       ------MSLF-TLFTLAIGLAMDTFAVSVCKGLAMKK-----------MSLKKAFINGAY
MNTP_BACFR       ------MTGL-EIWLLAIGLAMDCLAVSIASGIILRR-----------IQWRPMLIMAFF
MNTP_BACFN       ------MTGL-EIWLLAIGLAMDCLAVSIASGIILRR-----------IQWRPMLIMAFF
MNTP_BACTN       ------MTGL-EIWLLAIGLAMDCFAVSIASGIILKR-----------TQWRPMLVMALA
MNTP_BACV8       ------MTTL-EIWLLAISLAMDCFTVSITSGIIMRR-----------ICWRTFFIMAFF
MNTP_CROS5       ------MELV-NITCLGLGLAADAFAVSLSSGFVIQR-----------IKFNKALKIALF
MNTP_RIPO1       ------MDLL-NTTFLSIGLAIDAFAVSLSSGFIIKH-----------IKFNKALKIALF
MNTP_GLOC7       ------MEIL-TTTFLSLGLAADAFAVSLTSGFSIKH-----------IKLNKALKIALF
MNTP_PARD8       ------MLYI-EVLLLAIGLSMDSLAVSVTGGAVLKNN----------CTAGNIIKIASV
MNTP_METS3       ----MDTSLI-SIIIIAIALAMDAFSVSLTKGFTQKN-----------LTKSQILYYGLF
MNTP_METST       --------ML-SVILLAIALAMDAFSISITKGFTQKK-----------IQKQEILWYGIF
MNTP_METTH       ------MDLL-SMVLIGVGLAMDAFSISVSRGLALHE-----------SETNYALISALS
MNTP_METLZ       -----MTDLLLSSLVIAVGLAMDSFSVSLAGGAALKD-----------NIVKTAVTAGIF
MNTP_METHJ       ------MDLIFTSVLIGIGLAMDCLAVSFAVGAHQKT-----------SRIRAAFILALF
MNTP_METB6       ------MDLLTSSL-IGIGLSMDCFAVALAIGTSERL-----------PLVRSALVIAAS
MNTP_METAC       ------MSFL-TNFLLGLGLAMDAFAVSMSSGTTIRP-----------FRVSDALKLAVF
MNTP_METMA       ------MSFL-TNFLLGLGLAMDAFAVSMSSGTTVRP-----------FKVSDALKLAVF
MNTP_METBF       ------MSFL-TNFLLGLGLSMDAFAVSMSSSTTIRP-----------FHQKDALKLAVF
MNTP_METMJ       ------MDLV-TTLLIAVGLAMDAFAVSISGGATLRE-----------ERLRWAVIAGAL
MNTP_CLOB1       ------MDLI-SVILISIGLSMDAFAVSITNGAMISK-----------VTASEGIRIGLF
MNTP2_CLOBH      ------MDLI-SVILISIGLSMDAFAVSITNGAMISK-----------VTASEGIRIGLF
MNTP2_CLOBL      ------MDLI-SVILISIGLSMDAFAVSITNGAMISK-----------VTASEGIRIGLF
MNTP_CLOBM       ------MDLV-SIILISIGLSMDAFAVSITNGAMISK-----------VTASEGIRIGLF
MNTP_CLOPE       ------MSIL-SIVLTGFGLAMDAFAVSVAKGITLTR-----------VKAKDALKVALF
MNTP_CLOP1       ------MSIL-SIVLTGFGLAMDAFAVSVAKGITLTR-----------VKAKDALKVALF
MNTP_CLOPS       ------MSIL-SIVLTGFGLAMDAFAVSVAKGITLTR-----------VKAKDALKVALF
MNTP_BIFLO       -----MISIIIQILLISVSVAMDAFAVSIGKGLTVSR-----------VRVQDAVKSTLW
MNTP_BIFLD       -----MISIIIQILLISVSVAMDAFAVSIGKGLTVSR-----------VRVQDAVKSTLW
MNTP_BIFLS       -----MIAIIVQTLLISVSVAMDAFAVSIGKGLTVSR-----------VRPGDAVRSALW
MNTP_BIFAA       --------MLIQILLIGVSVSMDTFAVSIGKGLTVKK-----------LRGLDALKTALW
MNTP_SORC5       -------MNFSAILLLALGLAMDATAVAAARGLSVPA-----------IRARHVLLVAGF
MNTP_ECOLI       ------MNIT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_SHIDS       ------MNIT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_SHIB3       ------MNIT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_ECO24       ------MNIT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_ECO57       ------MNIT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_ECO5E       ------MNIT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_ECOLU       ------MNIT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_ECOK1       ------MNIT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_ECO45       ------MNIT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_ECOL6       ------MNIT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_ECOL5       ------MNIT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_ECO81       ------MNIT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_ECOHS       ------MNIT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_ECOUT       ------MNIT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_ECO8A       ------MNIT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_ECOSE       ------MNIT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_ECOSM       ------MNIT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_ECOBW       ------MNIT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_ECODH       ------MNIT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_ECO55       ------MNIT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_ECOLC       ------MNIT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_SHIFL       ------MNIT-ATVLLAFGMSMDAFAASIGKGAPLHK-----------PKFSEALRTGLI
MNTP_SHIF8       ------MNIT-ATVLLAFGMSMDAFAASIGKGAPLHK-----------PKFSEALRTGLI
MNTP_SHISS       ------MNIT-ATVLLAFGMSMDAFAASVGKGATLHK-----------PKFSEALRTGLI
MNTP_ECO27       ------MNIT-ATILLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_ECO7I       ------MNIT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_ESCF3       ------MNIT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_SALA4       ------MHFT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_SALCH       ------MHFT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_SALDC       ------MHFT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_SALNS       ------MHFT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_SALPA       ------MHFT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_SALPB       ------MHFT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_SALSV       ------MHFT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_SALTI       ------MHFT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_SALTY       ------MHFT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_SALHS       ------MHYT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_CITK8       ------MNIT-ATVLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_ENT38       ------MNIS-ATILLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_KLEP3       ------MNLS-ATILLAFGMSMDAFAASIGKGATLHK-----------PKFSEAVRTGLI
MNTP_KLEP7       ------MNLS-ATILLAFGMSMDAFAASIGKGATLHK-----------PKFSEAVRTGLI
MNTP_CROS8       ------MNLS-ATLLLAFGMSMDAFAASIGKGATLHK-----------PKFSEALRTGLI
MNTP_PECAS       ------MNMS-ATLILAFAMSMDAFAASIGKGAVLHN-----------PRFRDAIRTGLI
MNTP_PECCP       ------MNMS-ATLILAFGMSMDAFAASIGKGAVLHN-----------PRFRDAIRTGLI
MNTP_PHOLL       ------MNMY-ATLILALALSMDAFAASICKGAALHR-----------PHFREAIRTGLI
MNTP_PROMH       ------MSFY-ATIILALALSMDAFAVAVCKGATLHK-----------PHFREALRTGFI
MNTP_YERPE       ------MNLS-ATIILAFAMSMDAFAASIGKGATLYK-----------PRFREALRTGLI
MNTP_YERPP       ------MNLS-ATIILAFAMSMDAFAASIGKGATLYK-----------PRFREALRTGLI
MNTP_YERPY       ------MNLS-ATIILAFAMSMDAFAASIGKGATLYK-----------PRFREALRTGLI
MNTP_YERPG       ------MNLS-ATIILAFAMSMDAFAASIGKGATLYK-----------PRFREALRTGLI
MNTP_YERPA       ------MNLS-ATIILAFAMSMDAFAASIGKGATLYK-----------PRFREALRTGLI
MNTP_YERPN       ------MNLS-ATIILAFAMSMDAFAASIGKGATLYK-----------PRFREALRTGLI
MNTP_YERPS       ------MNLS-ATIILAFAMSMDAFAASIGKGATLYK-----------PRFREALRTGLI
MNTP_YERPB       ------MNLS-ATIILAFAMSMDAFAASIGKGATLYK-----------PRFREALRTGLI
MNTP_YERP3       ------MNLS-ATIILAFAMSMDAFAASIGKGATLYK-----------PRFREALRTGLI
MNTP_YERE8       ------MNLS-ATLVLAFAMSMDAFAASIGKGASLHK-----------PRFREAIRTGLI
MNTP_SERP5       ------MNLS-ATLILAFGMSMDAFAASIGKGASLHQ-----------PRFREALRTGLI
MNTP_SODGM       ------MNLS-ATLILAFGMSMDAFAASVGKGATLHK-----------PALREALRTGLI
MNTP_ERWT9       ------MNLY-ATLILAFAMSMDAFAAAICKGASLRR-----------PTLKEALRTGLI
MNTP_PSEAE       ------MNPV-SLIFLAFAMSTDAFAAAIGKGSSLDR-----------PRLSEALRTGII
MNTP_PSEAB       ------MNPV-SLIFLAFAMSTDAFAAAIGKGSSLDR-----------PRLSEALRTGII
MNTP_PSEA8       ------MNPV-SLIFLAFAMSTDAFAAAIGKGSSLDR-----------PRLSEALRTGII
MNTP_PSEF5       ------MNPA-SIIFLAFAMSTDAFAAAVGKGSAMLK-----------PRLLEALRIGLI
MNTP_PSE14       ------MNPI-SLLFLALAMSTDAFAAALGKGASLHK-----------PRFIEALRTGLI
MNTP_PSEU2       ------MNPI-SLLFLALAMSTDAFAAALGKGASLHK-----------PRFLEALRTGLI
MNTP_PSESM       ------MNPI-SLLFLALAMSTDAFAAALGKGASLHK-----------PRFIEALRTGLI
MNTP_ALCBS       ------MNPI-ALLLLAFAMSTDAFAAAIGKGAILKK-----------PRLTEAFRIGII
MNTP_STRMK       ------MSPI-SILLIGFAMSTDAFAAAIGKGAAMRR-----------PVFRDALRAGII
MNTP_STRM5       ------MSPI-SILLIGFAMSTDAFAAAIGKGAAMRK-----------PVFRDALRAGII
MNTP_XANAC       ------MSPF-SIVLIGFAMSTDAFAAAIGKGAAMRK-----------PQWRDALRAGLI
MNTP_XANC5       ------MSPF-SIVLIGFAMSTDAFAAAIGKGAAMRK-----------PQWRDALRAGLI
MNTP_XANOR       ------MSPF-SIVLIGFAMSTDAFAAAIGKGAAMRK-----------PQWRDALRAGLI
MNTP_XANOM       ------MSPF-SIVLIGFAMSTDAFAAAIGKGAAMRK-----------PQWRDALRAGLI
MNTP_XANCP       ------MSPL-SIVLLGFAMSTDAFAAAIGKGAAMRR-----------PRWRDAVRAGLV
MNTP_XANC8       ------MSPL-SIVLLGFAMSTDAFAAAIGKGAAMRR-----------PRWRDAVRAGLV
MNTP_XANCB       ------MSPL-SIVLLGFAMSTDAFAAAIGKGAAMRR-----------PRWRDAVRAGLV
MNTP_XYLFA       ------MSPI-TILLIGIAMSTDAFAAAIGKGAAIGK-----------PRLRDALYVAVI
MNTP_XYLFM       ------MSPI-TILLIGIAMSTDAFAAAIGKGAAIGK-----------PRLRDALYVAVI
MNTP_XYLF2       ------MSPI-TTLLIGIAMSTDAFAAAIGKGAAIGK-----------PRLRDALYVAVI
MNTP_XYLFT       ------MSPI-TTLLIGIAMSTDAFAAAIGKGAAIGK-----------PRLRDALYVAVI
MNTP_PARPJ       ------MNPV-ATLFLAFAMSTDAFAAAIGKGATLNR-----------PHWREAVRTGLI
MNTP_NITEC       -------------MILALAMSTDAFAAAVGKGTALRN-----------PRLSEALRTGII
MNTP_METFK       ------MNIV-STLLLALAMSADAFAAAVSKGAMLHR-----------PRIIEALRTGMI
MNTP_CHRSD       ------MNPA-SLILLAFAMSTDAFAASIGRGAELRK-----------VRLLSALRIGAV
MNTP_NEIMA       ------MGFY-ALLLIALGMSMDAFAVALAKGAAVRM-----------P-PRKIAATALV
MNTP_NEIMB       ------MGFY-ALLLIALGMSMDAFAVALAKGAAVRM-----------P-PRKIAATALV
MNTP_NEIMF       ------MSLY-ALLLIALGMSMDAFAVALAKGAAVRM-----------P-PRKIAATALV
MNTP_NEIG1       ------MSLY-ALLLVALGMSMDAFAVALAKGAAVRM-----------P-PRKIAATALV
MNTP_BRASB       ------MSPF-AVVLLAFSMSVDAFAVSVGRGAALGR-----------PRYSEALRSGAV
MNTP_XANP2       ------MSPA-TILVLAMSMSVDAFAVSVGRGAALGR-----------PRLSEALRTGAV
MNTP_RHOP5       ------MTPG-AIAILSLSMSTDAFAAAVSRGASH-R-----------PGVVSAVKAGFV
MNTP_RHORT       ------MSLA-TLTVLGFSLSADAFAAALGKGAGARR-----------PDLLEAFRVGAY
MNTP_CORGL       ------MPFL-QISLLSIGVAADAFACSVVRGTAIQV-----------NLFKRALVLAGI
MNTP_CORGB       ------MPFL-QIFLLSIGVAADAFACSVVRGTAIRV-----------NLFKRALVLAGI
MNTP_COREF       ------MPLV-HVMLLSCGVAADAFACSIARGTAIRV-----------NIIKRSLILAGI
MNTP_RHOPB       --------MF-QIAILAFSLSTDAFAASVAKGVRFPN-----------MSWLRSAGIALG
MNTP_DEHMB       -------MSLLSVIFIALGLSADCFAVSIGIACTHAS-----------IKSRVIWRVAGT
MNTP_DEHMC       -------MSLLSVIFIALGLSADCFAVSIGIACTHAS-----------IKSRVIWRVAGT
MNTP_DEHM1       -------MSLLSVVFVALALSADCFAVSIGIACTHTD-----------VKPRIMWRVAGT
MNTP_DESAH       -------MNFSTILLLAVALAMDAFAVAVAAGFQLRE-----------LTGRRIFRLSWH
MNTP_DESOH       -------MNTLTIFGIAVALAMDAFAVSIAAGVFLRS-----------IGLRHYFRLAWH
MNTP_DESPS       -------MSTTYLLGLAVALAMDAFAVAIAVGIGLKR-----------IRFRQAFRLSYH
MNTP_DESVH       -------MNTLECLAVAVALAMDAFAVAIATGIRLRE-----------VSPRQTFRLAFH
MNTP_DESVV       -------MNTLECLAVAVALAMDAFAVAIATGIRLRE-----------VSPRQTFRLAFH
MNTP_DESAG       -------METPALLALAVALAMDALAVAVATGCRLRT-----------VSARQTLRLAWH
MNTP_DESAD       -------MPFYEIFIISVALAMDAFTIAVACGLCMPE-----------VSKRQNFRLSFH
MNTP_GEOBB       -------MDWLTILGISVALAMDAFAVALAAGAVISP-----------ITGRHLFRLGFH
MNTP_GEOSM       -------MDWLTILGISVALAMDAFAVALAAGAVISP-----------ITGRHLFRLGFH
MNTP_PELCD       -------MDMITLFGLALALAMDAFAVALGCGLTLER-----------LTGRHLFRLGWH
MNTP_SYNFM       -------MSVVETVLVALALGCDAFAVGMGVGTRFCN-----------P--RQIFRLSFH
MNTP_DESDA       -------MTIFAVFLLAIALSMDAFAVAVVSGCALQK-----------PKVCHYVRLSAA
MNTP_ELUMP       -------MDIFTLLMIAAGLSMDNFAVSLASGCNPNI------------KIKDISKAALL
MNTP_FUSNN       -------MSTISVLITALALSMDAMSLSIYQGIASTE----------SQKKQNFLKIVLT
MNTP_CLOAB       -------MNIYSLFVVAIALSLDAFGVALSIGLDSCVK------------RKNKLLFAIS
MNTP_CLOTE       -------MDFYSLFLIAIALSLDAFGVALCIGLNNNVD------------LKYKSSCAIY
MNTP_CLONN       -----MTVSIYSLFVIAVALALDAFGVSLSIGLSKNLR------------YKNKALFCIS
MNTP1_CLOBH      -------MEVQELFLLALAISLDAFGVILCIGINKGIT------------LKSSMIFVFS
MNTP1_CLOBL      -------MEVQELFLLALAISLDAFGVILCIGINKGIT------------LKSSIIFVFS
                                 .  :. *        .                            

MNTP_BACVZ       IGLFHVMMPLAGMAAGHLLSGF--LGMLAVYIGGSLLFILGVQMIIAAFKQ---------
MNTP_BACSU       IGLFHVIMPLAGMAAGNMLSGL--LGVLAVYIGGALLFVLGVQMLMASFKQ---------
MNTP_BACLD       IGLFHVIMPLGGMIAGQFLSGA--LGALAGYIGGALLLVLGIQMIVASFNK---------
MNTP_BACP2       IGIFHMFMPLFGMLTGQLLSGW--LGLLATYIGGALLLVLGLQMIIASIRK---------
MNTP_GEOKA       IGLFHILMPLAGMAVGRLLSRE--FGSVATYAGGALLLWLGGQMIIASFRR---------
MNTP_GEOTN       IGLFHIFMPLVGMAVGRFLSRE--FGSIATYAGGVLLLWLGGQMIVTSFQQ---------
MNTP_GEOSW       IGLFHIIMPFLGMFLGRFLSYQ--FGSIASYIGGALLLLLGIQMIVTSFKK---------
MNTP_BACAN       IGIFHIIMPFIGMVLGRFLSEQ--YGDIAHFAGAILLIGLGFYIVYSSILE---------
MNTP_BACAA       IGIFHIIMPFIGMVLGRFLSEQ--YGDIAHFAGAILLIGLGFYIVYSSILE---------
MNTP_BACC0       IGIFHIIMPFIGMVLGRFLSEQ--YGDIAHFAGAILLIGLGFYIVYSSILE---------
MNTP_BACAH       IGIFHIIMPFIGMVLGRFLSEQ--YGDIAHFAGAILLIGLGFYIVYSSILE---------
MNTP_BACAC       IGIFHIIMPFIGMVLGRFLSEQ--YGDIAHFAGAILLIGLGFYIVYSSILE---------
MNTP_BACC3       IGIFHIIMPFIGMVLGRFLSEQ--YGDIAHFAGAILLIGLGFYIVYSSILE---------
MNTP_BACC1       IGIFHIIMPFIGMVLGRFLSEQ--YGDIAHFAGAILLIGLGFYIVYSSILE---------
MNTP_BACCQ       IGIFHIIMPFIGMVLGRFLSEQ--YGDIAHFAGAILLIGLGFYIVYSSILE---------
MNTP_BACCZ       IGIFHIIMPFIGMVLGRFLSEQ--YGDIAHFAGAILLIGLGFYIVYSSILE---------
MNTP_BACC7       IGIFHIIMPFIGMVLGRFLSEQ--YGDIAHFAGAILLIGLGFYIVYSSILE---------
MNTP_BACHK       IGIFHIIMPFIGMVLGRVLSEQ--YGDIAHFAGAILLIGLGFYIVYSSILE---------
MNTP_BACCR       IGIFHIIMPFIGMVLGRFLSEK--YGDIAHFAGAILLIGLGFYIVYSTILQ---------
MNTP_BACC4       IGIFHIIMPFIGMVLGRFLSEK--YGDIAHFAGAILLIGLGFYIVYSTILQ---------
MNTP_BACC2       IGIFHIIMPFIGMVLGRFLSEK--YGDIAHFAGAILLIGLGFYIVYSTILQ---------
MNTP_BACMK       IGIFHIIMPFIGMVLGRFLSER--YGDVANFAGAILLIGLGFYIVYSSILE---------
MNTP_BACSK       IGLFHVAMPLAGMAVGKWLSGH--FDVIATYIGGGLLLVIGVQMALNAFSD---------
MNTP_BACHD       IGVFHVIMPLMGMVAGKLLSAH--LGLFANWLGAGLLLWLGLVMIVSPFQE---------
MNTP_OCEIH       IGFLHMLMPLAGMLLGQVISEQ--IGQWTSFAGGVLLFLIGAHMFFSAFRL---------
MNTP_DESRM       VLIFHILMPLLGWYAGGFLGSK--MGQAASIAGALLLLYLGGKMIWDTIKP---------
MNTP_PELTS       VLLFHIFMPLTGWLVGEFTGSL--IGRAAAVIGSLLLVGLGVKMIWAAWRN---------
MNTP_CARHZ       VLVYHIVMPILGWFAGDLTGRF--LGKVATYIGGAILIYLGYKMIRHGIS----------
MNTP_DESAP       IVALHVVLPVAGWYAGEFTGRL--VGRWAAYLGAAILFYLGVKMVRESLAE---------
MNTP_HELMI       VALFHIFMPWFGILAGSALGLV--VGRLASFIGAAVLFFLGGRMIYHAWKEKREGPAFPV
MNTP_MOOTA       VGLFHIFMPLAGLYLGLLLGRL--LGKVAAIIGALVLATMGTLMLWEAYNNRRQGGS---
MNTP_SYNWW       VGILHVLMPLLGLNLGLVAGRF--LGVWATRLGALVLVYLGWQMLSKGYAEIQPQRY---
MNTP_ARCB4       FGIFQALMPFLGFLGGIGLREY--IQGYDKIVAFILLLAIGGKMIYEAFNENVEEE----
MNTP1_WOLSU      FGIFQGIMPLLGFFVGVTFIAF--ISAFDHYLAFGILALIGAKMIYEGLSQSEEER----
MNTP_COLP3       FGLFQGIMPIIGYLGGKGVLSW--AESYTPWIAFLLLFLIGVKMIFDSFSEGIEED----
MNTP_SACD2       FGVFQALMPLIGYLGGKGMLGW--LASFAPWVAAGLLALIAAKMIYESFAEGIEED----
MNTP_PSYA2       FGIAQGVMPLIGYLLGAVLLGW--LATAAPWIGGGILIVLGAKMLYEAFNGEIEAVLEDG
MNTP1_PSYCK      FGIAQGVMPLIGYLLGAVLLGW--LATAAPWLGGGILILLGAKMLYEAFNGEIEAVLEDS
MNTP_PSYWF       FGVAQGVMPLIGYLLGSALLGW--LASAAPWIGCIILIGLGAKMLYEAIQGDHEEE-ELG
MNTP2_PSYCK      FGVAQGVMPLIGYALGSTMLGW--FAEGASWVAFVILVALGIKMLYESRSVNNDET----
MNTP2_WOLSU      FGVAQMVMPLLGFYLGVQLHDY--IGGIHHWVALGVLGFLGLKMIREATQGEKELA----
MNTP_CAMFF       FGIFQAFMPVIGYFLGLAFVGF--ISYIDHYVAFAILLFLGIKMIKESRQISVH------
MNTP_CAMHC       YGFFQGAMPIIGFFLGALFVGF--IEQIDHFVAFAILGFLGVKMIFDSRENSDE------
MNTP_CAMC1       LGFFQFLMPLLGYFLGISFAKF--ISSIDHFIAFFILCFLGFKMLKEACSSEVG------
MNTP_CAMC5       FGVFQALMPFLGYILGLSFVNF--IQEIDHFIAFGILGFLGAKMILEAHHTKDEP-----
MNTP_RUMCH       FAVFQGIMPLIGYYAANSFENV--IERFDHWIAFILLVIIGGKMIHESITADEEQD----
MNTP_ACTSZ       FGLFQACMPLLGYYVGSHFSDY--ISEFDHWIAFALLCVIGINMIKMSVTNE-NSDDD--
MNTP_MANSM       FGLFQAVMPLIGFLLGVQFSEY--ITDYDHWVAFFLLALIGVNMLRESLSDE-DDEDSC-
MNTP_HUNT2       FGGFQALMPLLGYLLGTQFKDY--ITSIDHWIAFGLLSLIGINMIKESKN---TCEITDE
MNTP_DESHY       FGGFQALMPLIGFLLGTRFESY--ITAIDHWIAFILLSLIGLNMIKESRG---PCEII--
MNTP_ALKOO       FGGFQAIMPLIGYILGTQFNES--ISSIDHWIAFILLSIIGINMIRESREDDCSCDVDYS
MNTP_CAMJE       FGGFQALMPTIGYFIGITFASF--IASIDHWIAFILLSLIGLKMIKESLENE-NCDSNA-
MNTP_CAMJR       FGGFQALMPTIGYFIGITFASF--IASIDHWIAFILLSLIGLKMIKESLENE-NCDSNA-
MNTP_CAMJJ       FGGFQALMPTIGYFIGITFASF--IASIDHWIAFILLSLIGLKMIKESLENE-NCDSNA-
MNTP_CAMJ8       FGGFQALMPTIGYFIGITFASF--IASIDHWIAFILLSLIGLKMIKESLENE-NCDSNA-
MNTP_CAMJD       FGGFQALMPTIGYFIGITFASF--IASIDHWIAFILLSLIGLKMIKESLENE-NCNSNA-
MNTP_LACP7       FGLFQAGMPIIGYFLGISFRNY--ITKIDHWISFVLLVFLGIKMLKEAFDNE-ACSTN--
MNTP_BACFR       FGLFQAIMPLLGWLGASTFSHL--IESVDHWIAFAILAFLGGRMIKESFKEEDCCQR---
MNTP_BACFN       FGLFQAIMPLLGWLGASTFSHL--IESVDHWIAFAILAFLGGRMIKESFKEEDCCQR---
MNTP_BACTN       FGLFQALMPFIGWMFAKTFSHL--IESVDHWIAFAILAFLGGRMILESFKDEDCRQT---
MNTP_BACV8       FGLFQAVMPLIGWFAASRFSHL--IEDYDHWIAFGLLAFWGGRMIKESFSNED-KRC---
MNTP_CROS5       FGIFQAIMPLIGWLTGLSFREF--MTNIDHWIAFILLLGIGSKMIYEAYKEMDDDDK---
MNTP_RIPO1       FGIFQGVMPLIGWLTGLTFRDA--LANFDHWIAFILLAAIGGKMIYEACQDEEENKK---
MNTP_GLOC7       FGCFQAIMPFIGWSAGLTFRDF--ISSFDHWIAFGLLSYIGGKMIYESMEEEKEDKK---
MNTP_PARD8       LGIFQAGMTVIGYTMGLGFEKY--ICAFDHWIAFTLLLYLGGKMIYDSTKEEEEDGK---
MNTP_METS3       FGFFQFIMPVIGYICGTTISSF--VSTVAPWIAFFLLLAIGLNMIRESLDS-DDEYI---
MNTP_METST       FGGFQCFMPIIGYVCGTTIRSF--ISTYAPWIAFILLLCIGLNMIRESITS-SDEKV---
MNTP_METTH       FGTFQAAMPVLGWVSGLEIQRL--VSALAPWAAFILLLIIGLKMIYESLIM-EEE-----
MNTP_METLZ       FGFFQFAMPLLGWGIGVPITQV--IDPFGYWIVVGLFFFIGGKMIWDSFSG--DEEG---
MNTP_METHJ       FGGFQGGMTLLGWLLGSGFADA--IAAYDHWVAAGLLFIIGGKMVLDGIKDGHEEEA---
MNTP_METB6       FGIFQAGMTIAGWIAGASLYTE--ISSYGSWIAFLLLAGIGIKMIYDGIRE-EHEPT---
MNTP_METAC       FGSFQAMMPVLGWIGGSTVSSF--VSDYAPWIAFLLLAFIGCKMIYEALYG-DQDGK---
MNTP_METMA       FGGFQALMPVLGWVGGSAVSGF--VSDYAPWIAFGLLAFIGGKMIYEALYG-DPDGK---
MNTP_METBF       FGGFQAFMPVLGWLGGSAVSGF--VSNYASWIAFGLLTFIGGKMIYEALYG-DPDGK---
MNTP_METMJ       FGGFQAGMPVLGWLGGMGLASF--VGTYGPWIAFLLLALIGGKMIAEAVRG-DGESV---
MNTP_CLOB1       FGGFQALMPLIGWSIGIKFESY--IAALDHWIALILLSIIGGKMIYDSVKENQDHKDEIA
MNTP2_CLOBH      FGGFQALMPLIGWSIGIKFESY--IAALDHWIALILLSIIGGKMIYDSVKENQDHKDEIA
MNTP2_CLOBL      FGGFQALMPLIGWSIGIKFESY--IAALDHWIALILLSIIGGKMIYDSVKENQDHKDEIA
MNTP_CLOBM       FGGFQALMPLIGWSIGIKFESY--IAALDHWIALILLSIIGGKMIYDSIKENRDNKDEIA
MNTP_CLOPE       FGGFQALMPLIGWGAGRYFADY--IKAFDHWIAFILLSFIGGKMIFEALKEDDEEKAEVA
MNTP_CLOP1       FGGFQALMPLIGWGAGRYFADY--IKAFDHWIAFILLGFIGGKMIFEALKEDDEEKAEVA
MNTP_CLOPS       FGGFQALMPLIGWGAGRYFADY--IKAFDHWIAFILLGFIGGKMIFEALKEEDEEKAEVA
MNTP_BIFLO       FGGFQMLFPILGYFAASTFSKY--VTQFDHWIIFALLVFIGGNMVHEAFEEDEENSKE--
MNTP_BIFLD       FGGFQMLFPILGYFAASTFSKY--VTQFDHWIIFALLVFIGGNMVHEAFEEDEENSKE--
MNTP_BIFLS       FGGSQALFLILGHYAASAFSAY--VTAFDHWIIFGLLAFIGGNMVHEAYEEDAENAKE--
MNTP_BIFAA       FGGFQALFPLLGYFAASTFSKY--VTAVDHWIIFGLLALIGGNMVREAFEEDEENAKE--
MNTP_SORC5       FGGAQALMPVIGWLLGARIGPR--VQAWDHWIAFVLLAFIGGKMLWEARGDGGDDGGEGE
MNTP_ECOLI       FGAVETLTPLIGWGMGMLASRF--VLEWNHWIAFVLLIFLGGRMIIEGFRGADDE---DE
MNTP_SHIDS       FGAVETLTPLIGWGMGMLASRF--VLEWNHWIAFVLLIFLGGRMIIEGFRGADDE---DE
MNTP_SHIB3       FGAVETLTPLIGWGMGMLASRF--VLEWNHWIAFVLLIFLGGRMIIEGFRGADDE---DE
MNTP_ECO24       FGAVETLTPLIGWGMGMLASRF--VLEWNHWIAFVLLIFLGGRMIIEGFRGADDE---DE
MNTP_ECO57       FGAVETLTPLIGWGMGMLASRF--VLEWNHWIAFVLLIFLGGRMIIEGFRGADDE---DE
MNTP_ECO5E       FGAVETLTPLIGWGMGMLASRF--VLEWNHWIAFVLLIFLGGRMIIEGFRGADDE---DE
MNTP_ECOLU       FGAVETLTPLIGWGMGMLASRF--VLEWNHWIAFVLLIFLGGRMIIEGFRGADDE---DE
MNTP_ECOK1       FGAVETLTPLIGWGMGMLASRF--VLEWNHWIAFVLLIFLGGRMIIEGFRGADDE---DE
MNTP_ECO45       FGAVETLTPLIGWGMGMLASRF--VLEWNHWIAFVLLIFLGGRMIIEGFRGADDE---DE
MNTP_ECOL6       FGAVETLTPLIGWGMGMLASRF--VLEWNHWIAFVLLIFLGGRMIIEGFRGADDE---DE
MNTP_ECOL5       FGAVETLTPLIGWGMGMLASRF--VLEWNHWIAFVLLIFLGGRMIIEGFRGADDE---DE
MNTP_ECO81       FGAVETLTPLIGWGMGMLASRF--VLEWNHWIAFVLLIFLGGRMIIEGFRGADDE---DE
MNTP_ECOHS       FGAVETLTPLIGWGMGMLASRF--VLEWNHWIAFVLLIFLGGRMIIEGFRGADDE---DE
MNTP_ECOUT       FGAVETLTPLIGWGMGMLASRF--VLEWNHWIAFVLLIFLGGRMIIEGFRGADDE---DE
MNTP_ECO8A       FGAVETLTPLIGWGMGMLASRF--VLEWNHWIAFVLLIFLGGRMIIEGFRGADDE---DE
MNTP_ECOSE       FGAVETLTPLIGWGMGMLASRF--VLEWNHWIAFVLLIFLGGRMIIEGFRGADDE---DE
MNTP_ECOSM       FGAVETLTPLIGWGMGMLASRF--VLEWNHWIAFVLLIFLGGRMIIEGFRGADDE---DE
MNTP_ECOBW       FGAVETLTPLIGWGMGMLASRF--VLEWNHWIAFVLLIFLGGRMIIEGFRGADDE---DE
MNTP_ECODH       FGAVETLTPLIGWGMGMLASRF--VLEWNHWIAFVLLIFLGGRMIIEGFRGADDE---DE
MNTP_ECO55       FGAVETLTPLIGWGMGMLASRF--VLEWNHWIAFVLLIFLGGRMIIEGFRGADDE---DE
MNTP_ECOLC       FGAVETLTPLIGWGMGMLASRF--VLEWNHWIAFVLLIFLGGRMIIEGFRGADDE---DE
MNTP_SHIFL       FGAVETLTPLIGWGMGMLASRF--VLEWNHWIAFVLLIFLGGRMIIEGFRGADDE---DE
MNTP_SHIF8       FGAVETLTPLIGWGMGMLASRF--VLEWNHWIAFVLLIFLGGRMIIEGFRGADDE---DE
MNTP_SHISS       FGAVETLTPLIGWGMGMLASRF--VLEWNHWIAFVLLIFLGGRMIIEGFRGADDE---DE
MNTP_ECO27       FGAVETLTPLIGWGMGMLASRF--VLEWNHWIAFVLLIFLGGRMIIEGFRGADDE---DE
MNTP_ECO7I       FGAVETLTPLIGWGMGMLASRF--VLEWNHWIAFVLLIFLGGRMIIEGFRGPDDE---DE
MNTP_ESCF3       FGAVETLTPLIGWGMGMLASRF--VLEWNHWIAFVLLIFLGGRMIIEGIRGGDDE---DE
MNTP_SALA4       FGAVETLTPLIGWGLGILASKF--VLEWNHWIAFVLLIFLGGRMIIEGIRGGSDE---DE
MNTP_SALCH       FGAVETLTPLIGWGLGILASKF--VLEWNHWIAFVLLIFLGGRMIIEGIRGGSDE---DE
MNTP_SALDC       FGAVETLTPLIGWGLGILASKF--VLEWNHWIAFVLLIFLGGRMIIEGIRGGSDE---DE
MNTP_SALNS       FGAVETLTPLIGWGLGILASKF--VLEWNHWIAFVLLIFLGGRMIIEGIRGGSDE---DE
MNTP_SALPA       FGAVETLTPLIGWGLGILASKF--VLEWNHWIAFVLLIFLGGRMIIEGIRGGSDE---DE
MNTP_SALPB       FGAVETLTPLIGWGLGILASKF--VLEWNHWIAFVLLIFLGGRMIIEGIRGGSDE---DE
MNTP_SALSV       FGAVETLTPLIGWGLGILASKF--VLEWNHWIAFVLLIFLGGRMIIEGIRGGSDE---DE
MNTP_SALTI       FGAVETLTPLIGWGLGILASKF--VLEWNHWIAFVLLIFLGGRMIIEGIRGGSDE---DE
MNTP_SALTY       FGAVETLTPLIGWGLGILASKF--VLEWNHWIAFVLLIFLGGRMIIEGIRGGSDE---DE
MNTP_SALHS       FGAVETLTPLIGWGLGILASKF--VLEWNHWIAFVLLIFLGGRMIIEGIRGGSDE---DE
MNTP_CITK8       FGAVETLTPLIGWGLGMLASKF--VLEWNHWVAFILLVFLGIRMIIEGVRGGNDE---DD
MNTP_ENT38       FGAIETLTPLIGWSLGMLASQF--ILEWNHWIAFTLLVFLGGRMVIEGFRNTPDE---DD
MNTP_KLEP3       FGVIETLTPLVGWGLGMLASQF--VLEWNHWIAFILLVFLGGRMIVEGVRGDSDE---AC
MNTP_KLEP7       FGAIETLTPLVGWGLGMLASQF--ILEWNHWIAFILLVFLGGRMIVEGFRGDSDE---AC
MNTP_CROS8       FGVIEAITPLVGWLLGLLATQF--VLTWNHWIAFVLLVFLGGRMIIEGVRGC-EE---AS
MNTP_PECAS       FGVIEAITPLIGWALGFFASQY--ILEWDHWVAFTLLLILGGRMVVEGFKDSPDC---RC
MNTP_PECCP       FGVIEAITPLIGWALGFFASQY--ILEWDHWVAFTLLLILGGRMVVEGFKGSSDC---RC
MNTP_PHOLL       FGLAEACTPLIGWSLGLYASQY--IIEWDHWVAFTLLFILGCRMITESFKTKQEK---KC
MNTP_PROMH       FGIIEASTPIIGWALGLYTSQY--IIQWDHWVAFGLLVILGGRMIYQSLKRGDDC---IC
MNTP_YERPE       FGVIEAITPLIGWCIGLFASQY--IMEWDHWIAFSLLFILGCRMIFEGMKQRVA-----E
MNTP_YERPP       FGVIEAITPLIGWCIGLFASQY--IMEWDHWIAFSLLFILGCRMIFEGMKQRVA-----E
MNTP_YERPY       FGVIEAITPLIGWCIGLFASQY--IMEWDHWIAFSLLFILGCRMIFEGMKQRVA-----E
MNTP_YERPG       FGVIEAITPLIGWCIGLFASQY--IMEWDHWIAFSLLFILGCRMIFEGMKQRVA-----E
MNTP_YERPA       FGVIEAITPLIGWCIGLFASQY--IMEWDHWIAFSLLFILGCRMIFEGMKQRVA-----E
MNTP_YERPN       FGVIEAITPLIGWCIGLFASQY--IMEWDHWIAFSLLFILGCRMIFEGMKQRVA-----E
MNTP_YERPS       FGVIEAITPLIGWCIGLFASQY--IMEWDHWIAFSLLFILGCRMIFEGMKQRVA-----E
MNTP_YERPB       FGVIEAITPLIGWCIGLFASQY--IMEWDHWIAFSLLFILGCRMIFEGMKQRVA-----E
MNTP_YERP3       FGVIEAITPLIGWCIGLFASQY--IMEWDHWIAFSLLFILGCRMIFEGMKQRVA-----E
MNTP_YERE8       FGVIEAITPLIGWCIGLFASQY--ILEWDHWIAFSLLFILGCRMIFEGAKQQVE-----E
MNTP_SERP5       FGVVEAITPIIGWGIGLFASQY--IMEWDHWVAFSLLFILGMRMIVEGVRNRPD-----E
MNTP_SODGM       FGVIEAITPLIGWGLGLLSSQY--IMRWDHWVAFTLLAFLGGRMVLAGWKQQPL-----E
MNTP_ERWT9       FGVIEALTPLVGWAIGIAASQY--VMAWDHWVAFGLLFILGARMIVEGIRKKECS---LE
MNTP_PSEAE       FGVIEAITPLVGWLLGQAASQF--VADWDHWIAFVLLVLLGLHMIHNGLRADHA----TE
MNTP_PSEAB       FGVIEAITPLVGWLLGQAASQF--VADWDHWIAFVLLVLLGLHMIHNGLRADHA----TE
MNTP_PSEA8       FGVIEAITPLVGWLLGQAASQF--VADWDHWIAFVLLVLLGLHMIHNGLRADHE----TE
MNTP_PSEF5       FGVIEAITPVVGWFIGQAATQW--VANWDHWIAFSLLLLLGLHMIYNGTRQQAE----AE
MNTP_PSE14       FGAIETITPVIGWGIGQVAARF--AESWDHWIAFTLLLVLGLHMIYNGIKHDDD----EE
MNTP_PSEU2       FGAIETITPVIGWGIGQVAARF--AESWDHWIAFTLLLVLGLHMIYNGIKHDDD----EE
MNTP_PSESM       FGAIETITPVIGWGIGQVAARF--AESWDHWIAFTLLLVLGLHMIYNGLKHDHE----EE
MNTP_ALCBS       FGSIEAITPLVGWLIGKSAASY--VEAWDHWIAFSLLTVLGLHMIYEGTRPDGG----SE
MNTP_STRMK       FGVIEAITPIIGWLLGRAALQY--VEAFDHWIAFGLLGALGIHMIYNGLR--PDSAEEDE
MNTP_STRM5       FGVIEAITPIIGWLLGRAALQY--VEAFDHWIAFGLLGALGIHMIYNGLR--PDSAEEDE
MNTP_XANAC       FGCIEAITPVIGWLLGRAAASY--VSAYDHWIAFVLLGALGTHMIVAGLRNGPEDAEDAA
MNTP_XANC5       FGCIEAITPVIGWLLGRAASSY--VSAYDHWIAFVLLGALGTHMIVAGLRNGPEEAEDAA
MNTP_XANOR       FGCIEAITPVIGWVLGRAASSY--LSAYDHWIAFVLLGALGTHMMIAGLRNGPDDANDAE
MNTP_XANOM       FGCIEAITPVIGWVLGRAASSY--LSAYDHWIAFVLLGALGTHMMIAGLRNGPDDANDAE
MNTP_XANCP       FGCIEAITPVIGWMLGRAASDY--LAAFDHWIAFGLLGALGAHMIVAGLRNESE-VDEAL
MNTP_XANC8       FGCIEAITPVIGWMLGRAASDY--LAAFDHWIAFGLLGALGAHMIVAGLRNESE-VDEAL
MNTP_XANCB       FGCIEAITPVIGWMLGRAASDY--LAAFDHWIAFGLLGALGAHMIVAGLRNESE-VDEAL
MNTP_XYLFA       FGVIETATPIAGWLLGQIASHY--IATFDHWIAFGLLSGLGIHMIVNGLKNNGNTCKDNA
MNTP_XYLFM       FGVIETATPIAGWLLGQIASHY--IAAFDHWIAFGLLSGLGIHMIINGLKNNGNTCKDNA
MNTP_XYLF2       FGVIETATPIAGWLLGQVASHY--IATFDHWIAFGLLGGLGIHMIVNGLKNNGNTCKDNA
MNTP_XYLFT       FGVIETATPIAGWLLGQVASHY--IATFDHWIAFGLLGGLGIHMIVNGLKNNGNTCKDNA
MNTP_PARPJ       FGVIEALTPLVGWFLGKAAAQY--VSAWDHWIAFSLLLVLGARMVFNSFNTKEV-----E
MNTP_NITEC       FGVIEGLTPLVGWALGSIAADS--VADWDHWIAFTLLLILGLLMIRAGLRAEEP-----E
MNTP_METFK       FGVIEATTPLVGWSLGRVAADY--VTAWDHWIAFSILAFLGIRMTWSGLKHDGK-----V
MNTP_CHRSD       FGVVEAIMPLLGWALGHVAMRF--VSGVDHWIAFVMLALLGGHMIWAGVKKEDCAAIKAA
MNTP_NEIMA       FGSVEALTPLAGWVGGFYAKPF--ISEWDHWAAFVLLGGLGLKMMREGLSGKAED-----
MNTP_NEIMB       FGTVEALTPLAGWVGGFYAKPF--ISEWDHWVAFVLLGGLGLKMMREGLSGEAED-----
MNTP_NEIMF       FGTVEALTPLAGWVGGFYAKPF--ISEWDHWAAFVLLGGLGLKMMHEGLSGEAED-----
MNTP_NEIG1       FGTVEAFMPLAGWVGGFYAKPF--ISEWDHWVAFVLLGGLGLKMMREGLSGEAED-----
MNTP_BRASB       FGVVEAITPVIGWVAGVAASSF--VQAVDHWLAFGLLAAVGLHMLYAAVWKK------AD
MNTP_XANP2       FGAVEAATPLIGWAAGMVASSY--LEAIDHWIAFGLLAGVGLHMLVAAFSRRDEE---AD
MNTP_RHOP5       FGVIEAITPLIGWSLGLVAADL--VKEVDHWIAFGLLTIVGGKMIWEATRSQDHH---EE
MNTP_RHORT       FGAFEAAAPLIGWALGLTFAAR--IAAFDHWVAFTLLAGVGGHMVIAALRAPKAETAEAS
MNTP_CORGL       FGVFQAAMPLIGWFIGRFFAGITFIAEIDHWIAFALLGIVGTKMIWDAFQPEDDE-----
MNTP_CORGB       FGVFQAAMPLIGWVIGRFFAGITFIAEIDHWIAFALLGVVGAKMIWDAFQPEDDE-----
MNTP_COREF       FGVFQALMPVIGWGIGYFFAELSFIRAIDHWVAFLLLAGVGAKMIWDAFHQDADV-----
MNTP_RHOPB       FGTLEGLAPLIGYLLGKQFAGT--IEGYDHWFAFIILAGLGLRMIWRSFHPETLS-----
MNTP_DEHMB       FGLFQAGMVVIGFFAGLSVIDI--ISAFDHWIAFGLLLFIGVRMIYEALQGEDDQELV--
MNTP_DEHMC       FGLFQAGMVVIGFFAGLSVIDI--ISAFDHWIAFGLLLFIGVRMIYEALQGEDDQELV--
MNTP_DEHM1       FGLFQAGMAVIGYYAGLSIADV--ISSFDHWVAFGLLTVIGGRMVYESVQGEDDQKLV--
MNTP_DESAH       FGLFQALMPVIGWLSGKAVVSY--IEAYDHWAAFILLCWIGANMIRESFDTSSDTP----
MNTP_DESOH       FGLFQALMPIVGWYAGLSVRGL--IERYDHWIAFFLLAFVSFNMIRESFDAGENHT----
MNTP_DESPS       FGLFQALMPIIGWALGTGIRQF--TQSYAHWIAFTLLALVGANMIREALSDDEEEPG---
MNTP_DESVH       FGLFQALMPVAGWTLGLTVRGY--IEQWDHWLAFGLLLYIGVRMMREAFEETEENDD---
MNTP_DESVV       FGLFQALMPVAGWTLGLTVRGY--IEQWDHWLAFGLLLYIGVRMMREAFEETEENDD---
MNTP_DESAG       FGLFQAAMPIAGWFMGQGIRSF--VDAWAHWIAFGLLAFIGLKMLKEAFEHDDAECG---
MNTP_DESAD       FGLFQALMPLLGWLAGLTVKSM--VETYAPWISFFLLAFVGGKMIQESFETDDSCDT---
MNTP_GEOBB       FGLFQALMPIGGWLLGMTVQKW--ISAYDHWIAFGLLAYVGGRMVHEAFEEDDEEKT---
MNTP_GEOSM       FGLFQALMPIGGWLLGMTVQRW--ISAYDHWIAFGLLVFVGGRMVHEAFE-DDEDKT---
MNTP_PELCD       FGLFQAMMPIIGWLAGLTVQKW--IETYDHWVAFGLLVCVGGKMIHEAFQDEETRES---
MNTP_SYNFM       FGLFQMMMPIAGWFVGSRAADL--VSTWGPWISFALLLFIGGKMAYESFRSLEAEDGE--
MNTP_DESDA       FGFFQFAMPVIGWWLGVSVREY--MEAWDHWIAFVLLGWIGGKMALSGLRALRNRESCAC
MNTP_ELUMP       FVAAHLVMFSLGWFGVSVIAER--FDAYDHWISFGLLVFIGLRMIKEAAAKKGQQE----
MNTP_FUSNN       FGIFQFAMALVGSLSGILFIHY--ISLYSKYVSFAIFLFLGLMMLKEALKKEEMEYD---
MNTP_CLOAB       FGFFQFLCTFIGAYSGFLFNTY--ITYVPQIIGGMIIAFVGAFMIKEGFDNKEEK-----
MNTP_CLOTE       FGFFQFLFAIIGGYAGFLFNKY--IATMPQIVGGVVICIVGIIMIKEGIENEDSC-----
MNTP_CLONN       FGFFQFMLAYIGSYLGVLFNKY--ILVIPNIIGGIVIFVVGILMLKDGMKKDNKH-----
MNTP1_CLOBH      FGFFQFFLSFLGGYIGTIFNKY--IVPIPTIVGGLIIIIVGILMITEGFKEKEES-----
MNTP1_CLOBL      FGFFQFFLSFLGGYIGTIFNKY--IVPIPTIVGGLIIIIVGILMITEGFKEKEES-----
                     .      *                       ::   .  :                

MNTP_BACVZ       ---------------------SDGPLISPAGSGLLLFAIGVSLDSFSVGLSLGMNG----
MNTP_BACSU       ---------------------SEERFMSPAGPGLLLFAIGVSLDSFSVGLSLGIYG----
MNTP_BACLD       ---------------------SGEQIISPHGFGLFVFAVGVSLDSFSVGLSLGLYG----
MNTP_BACP2       ---------------------EDKPFIAPVGAGLVLFATSVSLDSFSVGLSLGIYG----
MNTP_GEOKA       ---------------------DDGSPLFPRGVGLLFFAFSVSLDSFSVGLSLGIFG----
MNTP_GEOTN       ---------------------EEGTSFLPHGAGLLFFAFSVSLDSFSVGLSLGIFG----
MNTP_GEOSW       ---------------------ESDRFVSPMGIGLIFFAFSVSLDSFSVGLSLGIYG----
MNTP_BACAN       ---------------------NEETRTAPIGISLFVFAFGVSIDSFSVGLSLGIYG----
MNTP_BACAA       ---------------------NEETRTAPIGISLFVFAFGVSIDSFSVGLSLGIYG----
MNTP_BACC0       ---------------------NEETRTAPIGISLFVFAFGVSIDSFSVGLSLGIYG----
MNTP_BACAH       ---------------------NEETRTAPIGISLFVFAFGVSIDSFSVGLSLGIYG----
MNTP_BACAC       ---------------------NEETRTAPIGISLFVFAFGVSIDSFSVGLSLGIYG----
MNTP_BACC3       ---------------------NEETRTAPIGISLFVFAFGVSIDSFSVGLSLGIYG----
MNTP_BACC1       ---------------------NEETRTAPIGISLFVFAFGVSIDSFSVGLSLGIYG----
MNTP_BACCQ       ---------------------NEETRTAPIGISLFVFAFGVSIDSFSVGLSLGIYG----
MNTP_BACCZ       ---------------------NEETRTAPIGISLFVFAFGVSIDSFSVGLSLGIYG----
MNTP_BACC7       ---------------------NEETRTAPIGISLFVFAFGVSIDSFSVGLSLGIYG----
MNTP_BACHK       ---------------------NEETRTTPIGISLFVFAFGVSIDSFSVGLSLGIYG----
MNTP_BACCR       ---------------------NEETRTAPIGISLFVFAFGVSIDSFSVGLSLGIYG----
MNTP_BACC4       ---------------------NEETRTAPIGISLFVFAFGVSIDSFSVGLSLGIYG----
MNTP_BACC2       ---------------------NGETRTVPIGISLFVFAFGVSIDSFSVGLSLGIYG----
MNTP_BACMK       ---------------------GEETRTAPIGISLFVFAFGVSIDSFSVGLSLGIYG----
MNTP_BACSK       ---------------------HEAEGLKPAGWGLLLFAVGVSLDSFSAGLSFGILG----
MNTP_BACHD       ---------------------KERTFVDPSGIGLFVFALSVSLDSLSAGLSLGMVG----
MNTP_OCEIH       ---------------------TEGFRWQPVGVGLWIIAFSVSLDSFTVGLGLGISG----
MNTP_DESRM       ------------------GKDEGPRFVITNTGGLLLLSASVSMDALSVGFTLGTQQ----
MNTP_PELTS       ------------------GGETEPSLVRFNFWGLLLLGASVSMDALSAGFTLGTRQ----
MNTP_CARHZ       -------------------QEEELPHVTYNLVGLLLIGLSVSMDALSVGFTLGTVK----
MNTP_DESAP       ------------------GRTATGKLERAGFLGLTVLAGSVSMDALSVGFTLGTAG----
MNTP_HELMI       SVPRRRGNGSGGGAIVGAGAIVGGRLFAPTRWELVVIGAAVSMDALSVGFSLGTVG----
MNTP_MOOTA       -----------MVGQVLRVIPGRG-GVLGGVMAILFMAGSVSLDALSVGFGLGAIS----
MNTP_SYNWW       -----------NFAEAKTILAGKQQSTLDSWTSILLLGLSVSIDALTVGFTLGTLK----
MNTP_ARCB4       -------------------------ISQITNKILLTLAIATSLDAMAAGYSLHLFN----
MNTP1_WOLSU      -------------------------LDELSHRTLLILSIATSIDALAAGVSLHLID----
MNTP_COLP3       -------------------------ISKITHRVLLILAIATSIDAMAAGFSLTLLP----
MNTP_SACD2       -------------------------ISQLTHRVLLLLAIATSIDALAAGFALTVLP----
MNTP_PSYA2       FDE--------------------NIRKKINHRMMFTLAIATSIDAMAAGFTLNLLA----
MNTP1_PSYCK      FDR--------------------NMQEKINHRMMFTLAIATSIDAMAAGFTLNLLA----
MNTP_PSYWF       LDD--------------------N--QSVDHKLMGTMAIATSIDAMAAGFTLNLLA----
MNTP2_PSYCK      -------------------------RINLSHKTLLSLAIATSLDAMGAGFTLNLLA----
MNTP2_WOLSU      ------------------------LSSHPSSSKLLLLAFVTSLDAMAAGLTLTLLG----
MNTP_CAMFF       ------------------------CSLNLSLRMLMLGAFATSLDALAVGITFSFEE----
MNTP_CAMHC       ------------------------ITANLGLKELISGAVATSIDALAVGVTFSFTS----
MNTP_CAMC1       ------------------------ESLSMDIKTIFVGAFATSIDALAVGVTLSFEA----
MNTP_CAMC5       ------------------------CLINLSSKDLALGAVATSIDALAVGITFSFAN----
MNTP_RUMCH       -----------------------CSLFSLTFKLLLVQAVATSIDALAVGVSLSALN----
MNTP_ACTSZ       -------------------------PSDFSLRHLTMLGVATSIDALAMGVSFAFLK----
MNTP_MANSM       -------------------------SNDFNFKTMMTLGFATSIDALAVGVTFAFLS----
MNTP_HUNT2       -------------------------DDTFSLKSLTVMAFATSIDALAIGVTFAFLQ----
MNTP_DESHY       -------------------------EDRFNLKDMIILSLATSIDALAVGITFAFLH----
MNTP_ALKOO       -------------------------DSSFGMKNMTLLALATSIDALAVGVTFAFLK----
MNTP_CAMJE       --------------------------NQFGFKTMLALAIATSIDALAVGVSFAFLN----
MNTP_CAMJR       --------------------------NQFGFKTMLALAIATSIDALAVGVSFAFLN----
MNTP_CAMJJ       --------------------------NQFGFKTMLALAIATSIDALAVGVSFAFLN----
MNTP_CAMJ8       --------------------------NQFGFKTMLALAIATSIDALAVGVSFAFLN----
MNTP_CAMJD       --------------------------KQFGFKTMLALAIATSIDALAVGVSFAFLN----
MNTP_LACP7       --------------------------DSVAFRVMIVLAVATSIDALAVGITFAFLK----
MNTP_BACFR       -------------------------FNPASLKVVITMAVATSIDALAVGVSFAFLGIKSC
MNTP_BACFN       -------------------------FNPASLKVVITMAVATSIDALAVGVSFAFLGIKSC
MNTP_BACTN       -------------------------FNPASPKVVFTMAIATSIDALAIGISFALLGINNY
MNTP_BACV8       -------------------------FDPTKLKVVVTLAIATSIDALAIGISFAFVGINSF
MNTP_CROS5       -------------------------FNPLDTYTLLALAIATSIDALAAGLGLSLLK----
MNTP_RIPO1       -------------------------FNPLDNYTLFALAIATSIDALAAGLGLSVLR----
MNTP_GLOC7       -------------------------FNPLDSYTLTTLAIATSIDALAAGIGLSVLK----
MNTP_PARD8       -------------------------FDPLCNRTLCGLGIATSIDALAVGISLAILK----
MNTP_METS3       -------------------------MDTFSFKELTLLAVATSIDAFAVGITFALLN----
MNTP_METST       -------------------------ADIFSFKEVTLLAIATSIDAFAVGVTFAILN----
MNTP_METTH       -------------------------EFIFSYRELLVLSIATSIDAFAVGVSFALLD----
MNTP_METLZ       -------------------------ISLIGWKVLLLLAVATSIDALAVGISFALIG----
MNTP_METHJ       -------------------------PDVFNFVAVFILAVATSIDALAVGLSFSLLH----
MNTP_METB6       -------------------------LSGLHAIPVILLSLATSIDAFAAGVSFGVLG----
MNTP_METAC       -------------------------VNSLNYSVLFLLAVATSIDALAVGMSFAFLG----
MNTP_METMA       -------------------------VNSLNYSMLFLLAVATSIDALAVGISFAFLG----
MNTP_METBF       -------------------------INSLNYSVLLMLAIATSIDALAVGISFAFLN----
MNTP_METMJ       -------------------------RFENGATVLLLLAVATSIDALAVGVSFAVLD----
MNTP_CLOB1       CDYAAGE------------------KKCLNNKTLILLAIATSIDALAVGVSFAFLK----
MNTP2_CLOBH      CDYAAGE------------------KKCLNNKTLILLAIATSIDALAVGVSFAFLK----
MNTP2_CLOBL      CDYAVGE------------------KKCLNNKTLILLAIATSIDALAVGVSFAFLK----
MNTP_CLOBM       CDYAVGE------------------KKCLNNKTLTLLAIATSIDALAIGVSFAFLK----
MNTP_CLOPE       VSMEVSKNKE-------REFANMKRKEELSAKNLTVLAIATSIDALAVGVSFAFLG----
MNTP_CLOP1       VSMEVSKNKE-------REFANMKRKEELSAKNLTVLAIATSIDALAVGVSFAFLG----
MNTP_CLOPS       VSMEVNKNKE-------REFANMKRKEELSAKNLTVLAIATSIDALAVGVSFAFLG----
MNTP_BIFLO       -------------------------TAQFDWKHMLPLAVACSIDAFAVGVSLAFMFTKA-
MNTP_BIFLD       -------------------------TAQFDWKHMLPLAVACSIDAFAVGVSLAFMFTKA-
MNTP_BIFLS       -------------------------TAQFDWKHMLPLAVACSIDAFAVGVSLAFMATS--
MNTP_BIFAA       -------------------------TPEFDWKHMLPLAVACSIDAVAVGVSFAFMTLN--
MNTP_SORC5       TT-----------------------ADPFALSAMFVLAIATSIDALAVGITLPMLNAP--
MNTP_ECOLI       E-----------------------PRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_SHIDS       E-----------------------PRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_SHIB3       E-----------------------PRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_ECO24       E-----------------------PRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_ECO57       E-----------------------PRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_ECO5E       E-----------------------PRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_ECOLU       E-----------------------PRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_ECOK1       E-----------------------PRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_ECO45       E-----------------------PRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_ECOL6       E-----------------------PRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_ECOL5       E-----------------------PRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_ECO81       E-----------------------PRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_ECOHS       E-----------------------PRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_ECOUT       E-----------------------PRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_ECO8A       E-----------------------PRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_ECOSE       E-----------------------PRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_ECOSM       E-----------------------PRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_ECOBW       E-----------------------PRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_ECODH       E-----------------------PRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_ECO55       E-----------------------PRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_ECOLC       E-----------------------PRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_SHIFL       E-----------------------PRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_SHIF8       E-----------------------PRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_SHISS       E-----------------------PRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_ECO27       Q-----------------------PRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_ECO7I       E-----------------------PRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_ESCF3       E-----------------------PRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_SALA4       T-----------------------PLRRHSFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_SALCH       T-----------------------PLRRHSFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_SALDC       T-----------------------PLRRHSFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_SALNS       T-----------------------PLRRHSFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_SALPA       T-----------------------PLRRHSFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_SALPB       T-----------------------PLRRHSFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_SALSV       T-----------------------PLRRHSFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_SALTI       T-----------------------PLRRHSFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_SALTY       T-----------------------PLRRHSFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_SALHS       T-----------------------PLRRHSFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_CITK8       E-----------------------PLRRHSFWLLVTTAIATSLDAMAVGVGLAFLQ----
MNTP_ENT38       A-----------------------PQYRHGFWILVTTAIATSLDAMAVGVGLAFLQ----
MNTP_KLEP3       D-----------------------APRRHGFWLLVTTAFATSLDAMAVGVGLAFLQ----
MNTP_KLEP7       E-----------------------APHRHGFWLLVTTAFATSLDAMAVGVGLAFLQ----
MNTP_CROS8       E-----------------------KIRRHSFWLLVTTAFATSLDAMAVGVGLAFLQ----
MNTP_PECAS       E-----------------------KVKNHSLALLVCTAIATSLDAMAIGVGLAFLQ----
MNTP_PECCP       E-----------------------KVKNHSLALLVCTAIATSLDAMAIGVGLAFLQ----
MNTP_PHOLL       E-----------------------SPCRHNSIVLITTAIATSLDAMAIGIGLAFLE----
MNTP_PROMH       EE----------------------APQRHGSLSLIATGIATSLDAMAIGVGLAFLQ----
MNTP_YERPE       TE----------------------KMRSHSFWVLVTTAIATSLDAMAIGVGLAFLQ----
MNTP_YERPP       TE----------------------KMRSHSFWVLVTTAIATSLDAMAIGVGLAFLQ----
MNTP_YERPY       TE----------------------KMRSHSFWVLVTTAIATSLDAMAIGVGLAFLQ----
MNTP_YERPG       TE----------------------KMRSHSFWVLVTTAIATSLDAMAIGVGLAFLQ----
MNTP_YERPA       TE----------------------KMRSHSFWVLVTTAIATSLDAMAIGVGLAFLQ----
MNTP_YERPN       TE----------------------KMRSHSFWVLVTTAIATSLDAMAIGVGLAFLQ----
MNTP_YERPS       TE----------------------KMRSHSFWVLVTTAIATSLDAMAIGVGLAFLQ----
MNTP_YERPB       TE----------------------KMRSHSFWVLVTTAIATSLDAMAIGVGLAFLQ----
MNTP_YERP3       TE----------------------KMRSHSFWVLVTTAIATSLDAMAIGVGLAFLQ----
MNTP_YERE8       TE----------------------KMRSHSFWVLVMTAIATSLDAMAIGVGLAFLQ----
MNTP_SERP5       VE----------------------KVKRHGFWLLVATAIATSLDAMAIGVGLAFLQ----
MNTP_SODGM       TS----------------------LVGKHSLGVLIATAIATSLDALAIGVGLAMLQ----
MNTP_ERWT9       D-----------------------APSRHGFWLLACTAVATSLDAMAVGVGLAFLQ----
MNTP_PSEAE       QE----------------------KPGQHSFWILAVTALATSIDALAVGVGLAFVD----
MNTP_PSEAB       QE----------------------KPGQHSFWILAVTALATSIDALAVGVGLAFVD----
MNTP_PSEA8       QE----------------------KPGQHSFWILAVTALATSIDALAVGVGLAFVD----
MNTP_PSEF5       EE----------------------KPRQHGFWLLAVTGLATSIDALAVGVGLAFVN----
MNTP_PSE14       QE----------------------KPGQHSFWILAVTAFATSIDALAVGVGLAFVD----
MNTP_PSEU2       QE----------------------KPGQHSFWILAVTAFATSIDALAVGVGLAFVD----
MNTP_PSESM       QE----------------------KPGSHSFWILAVTAFATSIDALAVGVGLAFVD----
MNTP_ALCBS       EH----------------------KAQKMSLLRTCLTAFSTSIDAMAVGVSLAFIN----
MNTP_STRMK       -D----------------------PSQHHGFWKLALTGFATSIDAMAVGIGLAFMD----
MNTP_STRM5       -D----------------------PSQHHGFWKLALTGFATSIDAMAVGIGLAFMD----
MNTP_XANAC       SD----------------------TPKRHGVLGLATTGFATSIDAMAVGVSLAFLD----
MNTP_XANC5       SD----------------------TPKRHGVLGLATTGFATSIDAMAVGVSLAFLD----
MNTP_XANOR       AK----------------------TPKRHGLLGLATTGFATSIDAMAVGVSLAFLD----
MNTP_XANOM       AK----------------------TPKRHGLLGLATTGFATSIDAMAVGVSLAFLD----
MNTP_XANCP       RD----------------------TPKRYGLLALAATGFATSIDAMAVGVSLAFLD----
MNTP_XANC8       RD----------------------TPKRYGLLALAATGFATSIDAMAVGVSLAFLD----
MNTP_XANCB       RD----------------------TPKRYGLLALAATGFATSIDAMAVGVSLAFLD----
MNTP_XYLFA       DT----------------------HNRNSRWLPLAATALATSIDAAAIGISLAFLD----
MNTP_XYLFM       DT----------------------HNRNSRWLTLAATALATSIDAAAIGISLAFLD----
MNTP_XYLF2       DT----------------------HNRNSRWLTLAATALATSIDAAAIGISMAFLD----
MNTP_XYLFT       DT----------------------HNRNSRWLTLAATALATSIDAAAIGISMAFLD----
MNTP_PARPJ       ET----------------------KPSAHSFWLLALTGFATSIDAMAVGAGLAFVD----
MNTP_NITEC       AT----------------------PAIRHSFWLLAATGFATSIDAMAVGVSLAFID----
MNTP_METFK       VE----------------------KSRSHSFILLAMTALGTSIDAMSVGVSLAFLD----
MNTP_CHRSD       ET----------------------QPENRSIWLIAFTALATSIDAMAVGITLALTD----
MNTP_NEIMA       VR----------------------ESKRESLWMTVLTAFGTSIDSMIVGVGLAFME----
MNTP_NEIMB       VR----------------------ESKRESLWMTVLTAFGTSIDSMIVGVGLAFME----
MNTP_NEIMF       AR----------------------ENKRESWWLTVLTAFGTSIDSMIVGVGLAFME----
MNTP_NEIG1       VR----------------------ESKQESLWMTVLTAFGTSIDSMIVGVGLAFME----
MNTP_BRASB       AK----------------------PVGRS-FTVLMATAIGTSLDAMAVGVSLAFLN----
MNTP_XANP2       DT----------------------PRGRS-IWVLLATALGTSIDAMAVGVSLAFLN----
MNTP_RHOP5       GA----------------------APKRSNRWALIATAVGTSIDAAAVGVGLAFIG----
MNTP_RHORT       KAR---------------------QKRALSPLRLALAALATSIDATAVGIGLAVTE----
MNTP_CORGL       TIV---------------------DDGRVQFRPAIILGLATSIDALAVGMGLAFVE----
MNTP_CORGB       TIV---------------------DDGRVQFRPAIILGLATSIDALAVGMGLAFVE----
MNTP_COREF       DVI---------------------DTGAVQLRPALILGLATSIDALAVGMGMAFVH----
MNTP_RHOPB       SPQ-----------------------MTPTWAAVLATAVGTSIDATAVGLTLALFG----
MNTP_DEHMB       ------------------------KLDLTRGLGLLGVAVATSIDALAVGLAFAVEE----
MNTP_DEHMC       ------------------------KLDLTRGLGLLGVAVATSIDALAVGLAFAVEE----
MNTP_DEHM1       ------------------------RLDLTRGLGLLGVAIATSIDALAVGLTFSLSE----
MNTP_DESAH       ------------------------QKDPTRGARLILLSLATSMDALAVGFSLAALK----
MNTP_DESOH       ------------------------KADPTRGLRLVLLSIATSIDALAVGLSLSVLN----
MNTP_DESPS       ------------------------EKDPTRGLRLIILSLATSIDALAVGLSLSMLE----
MNTP_DESVH       ------------------------RCDPTRGLTLIMLAVATSIDALAVGLSLSVLG----
MNTP_DESVV       ------------------------RCDPTRGLTLIMLAVATSIDALAVGLSLSVLG----
MNTP_DESAG       ------------------------MADPTRGTSLIMLSVATSIDALAVGVTLSMLG----
MNTP_DESAD       ------------------------YKDPTKGLSLVFLSVATSLDALAVGLSFSIMD----
MNTP_GEOBB       ------------------------PSDPTKGMTMVMLSVATSIDAFAVGLSIAMLG----
MNTP_GEOSM       ------------------------PSDPTKGMTMVMLSVATSIDAFAVGLSIAMLG----
MNTP_PELCD       ------------------------RDDPTRGMSLIMLSVATSIDALAVGLSLAIVG----
MNTP_SYNFM       ------------------------CPDPTKGSSLVMLSVATSMDALGVGFSFGILG----
MNTP_DESDA       P-----------------------SVDPTAGRNLVVLGVATSIDALAVGLSLAILG----
MNTP_ELUMP       -----------------------CVNITETFSRLLLIALATSMDALAVGISLSLAG----
MNTP_FUSNN       -------------------------EKYLDFKTLIIMGIATSLDALLVGLTFSILPF---
MNTP_CLOAB       --------------------------LLLNFKMYFVLGISVSIDAAVVGFTMFNKISSN-
MNTP_CLOTE       --------------------------KILKPGMNIILGISVSIDAMVVGFTALNKIQSG-
MNTP_CLONN       --------------------------MNIHKKMYFILGISVSIDAAIVGFTVLNSITSK-
MNTP1_CLOBH      --------------------------IFLNKIMYLILGVSVSIDALVIGFTTLSYINNL-
MNTP1_CLOBL      --------------------------IFLNKIMYLILGVSVSIDALVIGFTTLSYINNL-
                                                      .   *:*:   *           

MNTP_BACVZ       SNPFLAVTLFGVFSTVLTWAGLLAGRK--VQSWLGSYSEALGGAILIGFGLKLLLPV---
MNTP_BACSU       SHPLLTITLFGLFSMMLTWLGLLVGKQ--VQSWLGTYSEALGGIILIVFGLKLLLPI---
MNTP_BACLD       TKPILTIFLFGLFSMVLTWAGLLLGKK--VQTWLGAYSEALGGAILLSFGLKLLLPI---
MNTP_BACP2       SHVWMTILLFGFFSMILTWLGLLLGKQ--VRSWVGSYSGALGGIILLAFGIKLLFPL---
MNTP_GEOKA       ARTMVTILLFGLFSMVLTWVGLFVGRH--FQQWLGSYSEALGGSILLAFGLKLLFL----
MNTP_GEOTN       ARTMATILLFGLFSTVLTWIGLLVGRH--FRQWLGSYSEALGGSILLVFGLKLLFS----
MNTP_GEOSW       VRILLTILLFGFFSTVLTWMGLMLGRH--FQQWLGAYSEALGGSILLAFGLKLLFSF---
MNTP_BACAN       AQTIITILLFGFVSMLLAWIGLLIGRH--AKGMLGTYGEIVGGIILVGFGLYLLFPI---
MNTP_BACAA       AQTIITILLFGFVSMLLAWIGLLIGRH--AKGMLGTYGEIVGGIILVGFGLYLLFPI---
MNTP_BACC0       AQTIITILLFGFVSMLLAWIGLLIGRH--AKGMLGTYGEIVGGIILVGFGLYLLFPI---
MNTP_BACAH       AQTIITILLFGFVSMLLAWIGLLIGRH--AKGMLGTYGEIVGGIILVGFGLYLLFPI---
MNTP_BACAC       AQTIITILLFGFVSMLLAWIGLLIGRH--AKGMLGTYGEIVGGIILVGFGLYLLFPI---
MNTP_BACC3       AQTIITILLFGFVSMLLAWIGLLIGRH--AKGMLGTYGEIVGGIILVGFGLYLLFPI---
MNTP_BACC1       AQTIITILLFGFVSMLLAWIGLFIGRH--AKDMLGTYGEIVGGIILVGFGLYLLFPI---
MNTP_BACCQ       AQTVITILLFGFISMLLAWTGLFIGRH--AKGMLGTYGEIVGGIILVGFGLYLLFPI---
MNTP_BACCZ       AQTVITILLFGFISMLLAWTGLFIGRH--AKGMLGTYGEIVGGIILVGFGLYLLFPI---
MNTP_BACC7       AQTVITILLFGFISMLLAWTGLFIGRH--AKGMLGTYGEIVGGIILVGFGLYLLFPI---
MNTP_BACHK       AQTIITILLFGFVSMLLAWTGLFIGRH--AKGMLGTYGEIVGGIILVGFGLYLLFPI---
MNTP_BACCR       AQTIITILLFGFVSMLLAWIGLLIGRH--AKDMLGTYGEIVGGIILVGFGLYILFPI---
MNTP_BACC4       AQTIITILLFGFVSMLLAWIGLLIGRH--AKDMLGTYGEIVGGIILVGFGLYILFPI---
MNTP_BACC2       AQTIITILLFGFVSMLLAWIGLLIGRH--AKDMLGTYGEIVGGIILVGFGLYILFPI---
MNTP_BACMK       AETIITILLFGLISMLLAWMGLLLGSH--AKNILGTYGEIVGGIILVGFGLYLLFPI---
MNTP_BACSK       TEMFVTVGMIGAMSMVMSWIGLIVGSH--FQKFLGAYGELLGGLVLIGFGLKIMLPL---
MNTP_BACHD       AKMALAVVAMGVMSTVLSWLGLFIGMR--FQRYVGPYSELLGGFILCGFGVKLLLPY---
MNTP_OCEIH       VQIFVTLFAFGIVSCFLTWLGMLIGRK--VYRFLGVYSELLGGSILCGFGIFILFS----
MNTP_DESRM       VSLVLAAGVIGLVAGMMTFAGLTLGKY--VGDWIGERAELVGGIILVGIGVKLFF-----
MNTP_PELTS       VNLLLAAGVIGLVAGAMTAGGLVFGRF--LGSRVGERAQLLGGLILVGIGIKLFF-----
MNTP_CARHZ       VNLWFVALITGIVAGVMTLSGLLLGRR--VSKVLGERAQIVGGLILLLIAGKLIFRG---
MNTP_DESAP       AALLLTAGVIGLVAGLMSAAAFVLAHR--VEDWVGRRAELLGGLVLIGVGLRLLF-----
MNTP_HELMI       AQLLPTVLTFGVVAGIMTVAGCRIGQQ--VSRMLGATAQLAGGLILLGIGIKLLLGSASP
MNTP_MOOTA       VNVPLTVLTMGFIAATMTALGLLAGRR--LGSFFGNRAELAGGLILVAIGLKMLVGV---
MNTP_SYNWW       MPILITVLIMGLIAASMSWVGFAGGRV--LGRLTGSYAQILGGVVLLALAIKFVV-----
MNTP_ARCB4       LNIYLSLFVIGFTTFIISYIGVYVGSR--GGEKYESKAEILGGVVLILIGLKILLF----
MNTP1_WOLSU      VNVFLSCTIIAFTTFLLSYLGVLWGKR--AGEQCKRGAEILGGVILIGIGSKILLEHLFF
MNTP_COLP3       VNPLIACLIIASVTFIFSWLGVLVGTK--GGTWLENKAEFVGGITLIVMAIKIIITS---
MNTP_SACD2       VAPLVSCALIGVITAIFSFAGVFIGKR--AGTWLESKAELAGGLVLLLIALKIIAVAV--
MNTP_PSYA2       LNAWLACLIIAIVTAGFGFFGIYLGKS--SGTWLEDKAEILGGLVLIAIGVKVMLFS---
MNTP1_PSYCK      LNAWLACSIIAIVTAGFGFFGIYLGKS--SGTWLEDKAEILGGLVLIAIGIKVMFIR---
MNTP_PSYWF       VNAWLACLIIALVTALFSFFGVYLGRQ--SGTWLEDKAEVVGGVVLIAIGIKMVL-----
MNTP2_PSYCK      VNAYLACLIIALTTAVLSVLGAYIGRK--SGTWLGSWAEALGGLVLIAIGVNMVV-----
MNTP2_WOLSU      LPLWFCLLFIGGSTFLLSFGGVHLGRK--SGTYLEEKAEYLGGIILILIGVKIFIEHS--
MNTP_CAMFF       INIAIAAFVIGLVCFVLCVIASYMGRV--LGEMLESKALVLGGVILILIGCKIIITHLIN
MNTP_CAMHC       LNIWFSCAIIAFVCFILSFAATFIGKK--LGEIFKDKALILGGLILIFIGFKILITHLGI
MNTP_CAMC1       VSIFESALIIGIVCFALSLAAFYIGKF--MGEILEKKALFLGGAILIFLGFKILITHLLE
MNTP_CAMC5       VDVTYSCLIIGTVCFVLCTAACYVGKI--LGAWLEAKALVLGGLILIGLGTKILITHLVD
MNTP_RUMCH       VDILYSITIIGIVTFICCTAAILLANR--FGNLLGKRAGIVGGLILVGIGVKIFVQHMFF
MNTP_ACTSZ       VNIWTAAAIIGITTTILSLFGVKAGHW--LGDRIHKQAELLGGIILIAMGVKVLIEHRVF
MNTP_MANSM       VDIYSSVVTIGLITAALSIIGVKSGHF--LGKKIKTKAEILGGLILIGLGVKILMEHTLF
MNTP_HUNT2       VNIIPAVTMIGITTFTFSFLGVKIGNL--FGVKFQSKAEIVGGLILIGMGCKILFDHLGV
MNTP_DESHY       VDIVPAVSMIGVTTFLFSFLGVKIGNV--FGECYKARAELAGGVILILMGLKILLEHLGF
MNTP_ALKOO       VKIAPAIGIIGAITFILSIIGVKIGTV--FGMKYKSKAEIAGGVILITMGAKILLEHLL-
MNTP_CAMJE       VNLLLAIFLIGIITFILCIIALKIGNK--FGIYLKNKAELLGGLVLIILGVKILIEHLFF
MNTP_CAMJR       VNLLLAIFLIGIITFILCIIALKIGNK--FGIYLKNKAELLGGLVLIILGVKILIEHLFF
MNTP_CAMJJ       VNLLLAIFLIGIITFILCIIALKIGNK--FGIYLKNKAELLGGLVLIILGVKILIEHLFF
MNTP_CAMJ8       VNLLLAIFLIGIITFILCIIALKIGNK--FGIYLKNKAELLGGLVLIILGVKILIEHLFF
MNTP_CAMJD       VNLLLAIFLIGIITFILCIIALKIGNK--FGIYLKNKAELLGGLVLIILGVKILIEHLFF
MNTP_LACP7       VNLLLAVSLIGIITFLLSMLGVRLGHV--FGARYKRVAECVGGIVLIVLGFKILLEHLGI
MNTP_BACFR       SSILYPAGIIGFVSFFMSLIGLIFGIRFGCGIARKLRAELWGGIILILIGTKILIEHLFF
MNTP_BACFN       SSILYPAGIIGFVSFFMSLIGLIFGIRFGCGIARKLRAELWGGIILILIGTKILIEHLFF
MNTP_BACTN       TEILSPILIIGFVSFVMSLIGLYFGIKCGCGCARKLKAELWGGIILVAIGLKILIEHLFL
MNTP_BACV8       TSILSPIVIIGFTSFVISTLGSLIGVF--CGKRFNLRMELWGGLVLIIIGVKILIEHLFL
MNTP_CROS5       TSILLPCTLIGLITFVLSFIGVFIGHK--FGSIFNKKIEIIGGLTLIIIGSKILIEDLIK
MNTP_RIPO1       VSILLACTLIASITFSLSFIGVFIGHK--FGSIFNQKLEILGGITLIGIGTKILVEGLII
MNTP_GLOC7       GSILLACTLIGFITFGLCFIGVFIGHR--FGDILNQKIEIVGGVVLILIGTKILLEHLGF
MNTP_PARD8       SPLLLQASTIGVVTFAISAFGVYFGNR--FGKRIDLKLDLIGGLILIGIGTKILIEHLFF
MNTP_METS3       MSLLLPCTIIGIVAFIFSISGIFIGKK--LGNYFGDKFEILGGAVLILIGIKILLGY---
MNTP_METST       ISLVIPCAIIGIITFLFSIVGIFIGKK--LGDYFGDKFQILGGVILILLGFKILLGF---
MNTP_METTH       ISIWLPVIVIGLITFILSLAGSYIGER--VGHIFENRLEALGGLILILIGLKILLENVSF
MNTP_METLZ       EAVLLPAVIIGVVAFLFSFFGVLAGHK--LSSILGNKMQILGGVILVLIGIKFLIEYCL-
MNTP_METHJ       IVPLIPALIIGLISAIFSVGGVYSGGK--IGHILGKRVDILGGVILTLIGIRILLEHLVW
MNTP_METB6       STVLMPALAIGLVCFVVSCAGVFCGMR--LEKLLGNRTEIFGGVILILIGIQILTDILPL
MNTP_METAC       TPILEPVIIIGCVTFVMSFCGAILGYR--LGHFFEHEVEILGGLILIGLGGKILAEHMLW
MNTP_METMA       TPILEPVIIIGCVTFVMSFCGAVLGYR--IGHFFENEVEILGGLILIGLGVKILAEHMDW
MNTP_METBF       TPILEPVIIIGCVTFVMSFCGAVLGHR--IGHFFEHEVEIIGGLILIGIGGKILAEHLLW
MNTP_METMJ       TAIALPAITIGVVTFAFSAAGVLLGSA--FGHIMGRKACIVGGIILVGIGLRILLEHLFF
MNTP_CLOB1       VSIINTIIIIGSITFVICFIGVMIGKK--CGKLLKKRAEILGGVVLILIGVKIFIQHTNI
MNTP2_CLOBH      VSIINTIIIIGSITFVICFIGVMIGKK--CGKLLKKRAEILGGVVLILIGVKIFIQHTNI
MNTP2_CLOBL      VSIINTIVIIGSITFVICFIGVMIGKK--CGKLLKKRAEILGGVVLILIGVKIFIQHTNI
MNTP_CLOBM       VSIINTIIIIGSITFVICFIGVMIGKK--CGKLLKKRAEILGGIVLIFIGIKIFIEHTNI
MNTP_CLOPE       ISIVQTIIIIGIITFVLCFLGVIIGEK--LGDIFKNYAEIVGGVILILIGINILLEHTGI
MNTP_CLOP1       ISIVQTIIIIGIITFVLCFLGVIIGEK--LGDIFKNYAEIVGGVILILIGINILLEHTGI
MNTP_CLOPS       ISIVQTIIIIGIITFVLCFLGVIIGEK--LGDIFKNYAEIVGGVILILIGINILLEHTGI
MNTP_BIFLO       -HMAFAILSIGVVTGLFSAAGLHIGRA--FGSRWQKPAQIAGGVVLILLGIKVLLEHLGV
MNTP_BIFLD       -HMAFAILSIGVVTGLFSAAGLHIGRA--FGSRWQKPAQIAGGVVLILLGIKVLLEHLGV
MNTP_BIFLS       --VPFAILCISVVTGLFSAAGLYIGRA--FGAHWQKPAQIAGGVVLILIGVKVLLEHLGV
MNTP_BIFAA       --IWLSVVIIGITTGLFSAAGLYIGRV--FGSRWQKPAQIAGGVVLILIGLKVLFEHLGF
MNTP_SORC5       --FAISVVTIGVVTALLSAAGLFAGRR--FGALLGKRLDLAGGVVLIGLGFKILLEHLVL
MNTP_ECOLI       VNIIATALAIGCATLIMSTLGMMVGRF--IGSIIGKKAEILGGLVLIGIGVQILWTHFHG
MNTP_SHIDS       VNIIATALAIGCATLIMSTLGMMVGRF--IGSIIGKKAEILGGLVLIGIGVQILWTHFHG
MNTP_SHIB3       VNIIATALAIGCATLIMSTLGMMVGRF--IGSIIGKKAEILGGLVLIGIGVQILWTHFHG
MNTP_ECO24       VNIIATALAIGCATLIMSTLGMMVGRF--IGSIIGKKAEILGGLVLIGIGVQILWTHFHG
MNTP_ECO57       VNIIATALAIGCATLIMSTLGMMVGRF--IGSIIGKKAEILGGLVLIGIGVQILWTHFHG
MNTP_ECO5E       VNIIATALAIGCATLIMSTLGMMVGRF--IGSIIGKKAEILGGLVLIGIGVQILWTHFHG
MNTP_ECOLU       VNIIATALAIGCATLIMSTLGMMVGRF--IGSIIGKKAEILGGLVLIGIGVQILWTHFHG
MNTP_ECOK1       VNIIATALAIGCATLIMSTLGMMVGRF--IGSIIGKKAEILGGLVLIGIGVQILWTHFHG
MNTP_ECO45       VNIIATALAIGCATLIMSTLGMMVGRF--IGSIIGKKAEILGGLVLIGIGVQILWTHFHG
MNTP_ECOL6       VNIIATALAIGCATLIMSTLGMMVGRF--IGSIIGKKAEILGGLVLIGIGVQILWTHFHG
MNTP_ECOL5       VNIIATALAIGCATLIMSTLGMMVGRF--IGSIIGKKAEILGGLVLIGIGVQILWTHFHG
MNTP_ECO81       VNIIATALAIGCATLIMSTLGMMVGRF--IGSIIGKKAEILGGLVLIGIGVQILWTHFHG
MNTP_ECOHS       VNIIATALAIGCATLIMSTLGMMVGRF--IGSIIGKKAEILGGLVLIGIGVQILWTHFHG
MNTP_ECOUT       VNIIATALAIGCATLIMSTLGMMVGRF--IGSIIGKKAEILGGLVLIGIGVQILWTHFHG
MNTP_ECO8A       VNIIATALAIGCATLIMSTLGMMVGRF--IGSIIGKKAEILGGLVLIGIGVQILWTHFHG
MNTP_ECOSE       VNIIATALAIGCATLIMSTLGMMVGRF--IGSIIGKKAEILGGLVLIGIGVQILWTHFHG
MNTP_ECOSM       VNIIATALAIGCATLIMSTLGMMVGRF--IGSIIGKKAEILGGLVLIGIGVQILWTHFHG
MNTP_ECOBW       VNIIATALAIGCATLIMSTLGMMVGRF--IGSIIGKKAEILGGLVLIGIGVQILWTHFHG
MNTP_ECODH       VNIIATALAIGCATLIMSTLGMMVGRF--IGSIIGKKAEILGGLVLIGIGVQILWTHFHG
MNTP_ECO55       VNIIATALAIGCATLIMSTLGMMVGRF--IGSIIGKKAEILGGLVLIGIGVQILWTHFHG
MNTP_ECOLC       VNIIATALAIGCATLIMSTLGMMVGRF--IGSIIGKKAEILGGLVLIGIGVQILWTHFHG
MNTP_SHIFL       VNIIATALAIGCATLIMSTLGMMVGRF--IGSIIGKKAEILGGLVLIGIGVQILWTHFHG
MNTP_SHIF8       VNIIATALAIGCATLIMSTLGMMVGRF--IGSIIGKKAEILGGLVLIGIGVQILWTHFHG
MNTP_SHISS       VNIIATALAIGCATLIMSTLGMMVGRF--IGSIIGKKAEILGGLVLIGIGVQILWTHFHG
MNTP_ECO27       VNIIATALAIGCATLIMSTLGMMVGRF--IGSIIGKKAEILGGLVLIGIGVQILWTHFHG
MNTP_ECO7I       VNIIATALAIGCATLIMSTLGMMVGRF--IGSIIGKKAEILGGLVLIGIGVQILWTHFHG
MNTP_ESCF3       VNIIATALAIGCATLIMSTLGMMVGRF--IGPILGKKAEILGGLVLIGIGVQILWTHFHG
MNTP_SALA4       VNIIATALAIGCATLIMSTLGMMIGRF--IGPMLGKRAEILGGVVLIGIGVQILWTHFHG
MNTP_SALCH       VNIIATALAIGCATLIMSTLGMMIGRF--IGPMLGKRAEILGGVVLIGIGVQILWTHFHG
MNTP_SALDC       VNIIATALAIGCATLIMSTLGMMIGRF--IGPMLGKRAEILGGVVLIGIGVQILWTHFHG
MNTP_SALNS       VNIIATALAIGCATLIMSTLGMMIGRF--IGPMLGKRAEILGGVVLIGIGVQILWTHFHG
MNTP_SALPA       VNIIATALAIGCATLIMSTLGMMIGRF--IGPMLGKRAEILGGVVLIGIGVQILWTHFHG
MNTP_SALPB       VNIIATALAIGCATLIMSTLGMMIGRF--IGPMLGKRAEILGGVVLIGIGVQILWTHFHG
MNTP_SALSV       VNIIATALAIGCATLIMSTLGMMIGRF--IGPMLGKRAEILGGVVLIGIGVQILWTHFHG
MNTP_SALTI       VNIIATALAIGCATLIMSTLGMMIGRF--IGPMLGKRAEILGGVVLIGIGVQILWTHFHG
MNTP_SALTY       VNIIATALAIGCATLIMSTLGMMIGRF--IGPMLGKRAEILGGVVLIGIGVQILWTHFHG
MNTP_SALHS       VNIIATALAIGCATLIMSTLGMMIGRF--IGPMLGKRAEILGGVVLIGIGVQILWTHFHG
MNTP_CITK8       VNIIATALAIGCATLIMSTLGIMVGRF--IGPLLGKRAEILGGAVLIGIGAQILWTHFHG
MNTP_ENT38       VNIIATALAIGCATLIMSTIGMMVGRF--IGPLLGKRAEILGGIVLIGIGGQILWSHFAG
MNTP_KLEP3       VSIVTTALAIGCATFLMSTLGIMVGRF--IGPLLGKRAEILGGIVLIGIGSEILWSHFAG
MNTP_KLEP7       VSIVTTALAIGCATFIMSTLGMMVGRF--IGPLLGKRAEILGGIVLIGIGSEILWSHFAG
MNTP_CROS8       VDIIKTALAIGCATLIMSTLGMMVGRF--IGPLLGKRAEILGGVVLIGIGCQILWSHFAG
MNTP_PECAS       VNIFHTAMVIGCATMIMVTLGMMIGRY--IGPILGKKAEIIGGLVLIGIGCNILYEHLG-
MNTP_PECCP       VNILHTAMVIGCATMIMVTLGMMIGRY--IGPILGKKAEVMGGLVLIGIGCNILYEHLGY
MNTP_PHOLL       VNIVHTAMAIGMMTMIMATLGMLIGRY--IGPRLGKRAELIGGLILIAIGFNILFEHLEL
MNTP_PROMH       VDIVHTAMTIGMMTMIMATLGMLIGRY--IGPVLGKKAEIIGGMVLIAIGFNILFEHLDL
MNTP_YERPE       VDIVHTAMAIGLATMIMATLGMLIGRY--IGPLLGKRAEIIGGIVLIGIGFNILYEHMHL
MNTP_YERPP       VDIVHTAMAIGLATMIMATLGMLIGRY--IGPLLGKRAEIIGGIVLIGIGFNILYEHMHL
MNTP_YERPY       VDIVHTAMAIGLATMIMATLGMLIGRY--IGPLLGKRAEIIGGIVLIGIGFNILYEHMHL
MNTP_YERPG       VDIVHTAMAIGLATMIMATLGMLIGRY--IGPLLGKRAEIIGGIVLIGIGFNILYEHMHL
MNTP_YERPA       VDIVHTAMAIGLATMIMATLGMLIGRY--IGPLLGKRAEIIGGIVLIGIGFNILYEHMHL
MNTP_YERPN       VDIVHTAMAIGLATMIMATLGMLIGRY--IGPLLGKRAEIIGGIVLIGIGFNILYEHMHL
MNTP_YERPS       VDIVHTAMAIGLATMIMATLGMLIGRY--IGPLLGKRAEIIGGIVLIGIGFNILYEHMHL
MNTP_YERPB       VDIVHTAMAIGLATMIMATLGMLIGRY--IGPLLGKRAEIIGGIVLIGIGFNILYEHMHL
MNTP_YERP3       VDIVHTAMAIGLATMIMATLGMLIGRY--IGPLLGKRAEIIGGIVLIGIGFNILYEHMHL
MNTP_YERE8       VNIVHTAMAIGLATMIMATLGMLIGRY--IGPLLGKRAEIIGGIVLIGIGFNILYEHIYR
MNTP_SERP5       VNIVHTAMAIGCATMIMATLGMMIGRF--IGPLLGKRAEILGGVVLIGIGVNILLEHLGY
MNTP_SODGM       VNILHAALLIGLATLIMSTIGMLLGRF--VGPCLGSKAEIIGGLILIGIGCNILYSHIGE
MNTP_ERWT9       VNIVTTALAIGASTMIMATMGILLGRF--LGPVMGKWAEIFGGVVLIGIGSSILVEHLGL
MNTP_PSEAE       VNIFLAAGAIGLATMTMVTLGTMLGRA--LGAVTGKRAEMVGGVVLILVGATILYEHLSA
MNTP_PSEAB       VNIFLAAGAIGLATMTMVTLGTMLGRA--LGAVTGKRAEMVGGVVLILVGATILYEHLSA
MNTP_PSEA8       VNIFLAAGAIGLATMTMVTLGTMLGRA--LGAVTGKRAEMVGGVVLILVGATILYEHLSA
MNTP_PSEF5       VNIWVAASAIGLATMTMVTLGVMLGRA--IGTVMGQRAEVLGGVVLIIVGSRILYEHLSA
MNTP_PSE14       VNIVIAALAIGLATTVMVTIGVMLGRV--LGTMVGKRAEIVGGIVLIIVGATILYEHLSA
MNTP_PSEU2       VNIVVAALAIGLATTVMVTIGVMLGRV--LGTMVGKRAEIIGGIVLIVVGATILYEHLSA
MNTP_PSESM       VNIMVAALAIGLATTVMVTIGVMLGRV--LGTMVGKRAEIVGGIVLIVVGTTILYEHLTA
MNTP_ALCBS       VNIWIASALIGLATTLMVTIGIMLGRA--IGSVMGHRAEIFGGLTLIAVGAWILYGQL--
MNTP_STRMK       VHIGVMAAVIGLCTLTMVTAGIMFGRV--LGSMVGKRAEIIGGVILVIIGATILYEHLHG
MNTP_STRM5       VHIGVMAVVIGLCTLTMVTVGIMLGRV--LGSMVGKRAEIIGGVILVIIGATILYEHLHG
MNTP_XANAC       VHIGVVAVVVGLCTFSMVTAGVMLGRA--LGNLIGKRAEMLGGLILVIVGSVILYEHLSG
MNTP_XANC5       VHIGVVAVVVGLCTFSMVTAGVMLGRA--LGNLIGKRAEMLGGLILVIVGSVILYEHLSG
MNTP_XANOR       VHIGVVAVVVGLCTFSMVTAGVMLGRA--LGNLIGKRAEILGGLILVIVGSVILYEHLGA
MNTP_XANOM       VHIGVVAVVVGLCTFSMVTAGVMLGRA--LGNLIGKRAEILGGLILVIVGSVILYEHLGA
MNTP_XANCP       VHIGVVAAVVGLCTLSMVTAGVMLGRA--LGALIGKRAEILGGVILILIGSTILYEHLSG
MNTP_XANC8       VHIGVVAAVVGLCTLSMVTAGVMLGRA--LGALIGKRAEILGGVILILIGSTILYEHLSG
MNTP_XANCB       VHIGVVAAVVGLCTLSMVTAGVMLGRA--LGALIGKRTEILGGVILILIGSTILYEHLSG
MNTP_XYLFA       IHISIVAAVIGLCTFTMVIFGVMLGRV--LGTFVGNRAEIVGGIILIIVGSTILYEHLSN
MNTP_XYLFM       IHIGIVAAVIGLCTFTMVIFGVMLGRV--LGTFVGNRAEIVGGIILIIVGSTILYEHLSN
MNTP_XYLF2       IHIGIVAAVIGLCTFTMVIFGVMLGRV--LGTFVGNRAEIVGGIILIIVGSTILYEHLSN
MNTP_XYLFT       IHIGIVAAVIGLCTFTMVIFGVMLGRV--LGTFVGNRAEIVGGIILIIVGSTILYEHLSN
MNTP_PARPJ       VNIYSTAAAIGLATMAMVTIGVMLGRV--IGHVAGRRAELAGGIVLIGIGSTILAEHLNI
MNTP_NITEC       NNILITAAAIGLATFLMVTLGVMVGRL--IGNVAGKWAEILGGLALMGVGTVILYEHLTM
MNTP_METFK       IDIVPVAFAIGIVTCIMVSAGVMLGRV--LGSASKHTVEIIGGLILIGIGSLILYKHLYG
MNTP_CHRSD       INIIAASVAIGLATALMVTLGTLLGRA--IGTIVGKWAEILGGLILIGIGIAVLYEHLAG
MNTP_NEIMA       VNIAFAAAIIGMATTVMVAVGLAAGGA--LGGLFGKRAEFAGGLVLIAIGTWTLLSHLGL
MNTP_NEIMB       VNIAFAAAIIGMATTVMVAVGLTAGRA--LGVLFGRCAEFAGGLVLIAIGTWTLLSHLGL
MNTP_NEIMF       VNIAFAAAIIGMATTVLVAVGLTVGRA--LGVLFGRRAEFAGGLVLIAIGTWTLLSHLGL
MNTP_NEIG1       VNIAFAAAVIGMAATVMVTIGLTAGKA--FGVLFGRRAEFAGGLVLIAIGTWTLLSHLGL
MNTP_BRASB       VNIVVVATAIGLATFLMSSGGMLIGRL--IGEHFGRIAEAVAGIALFGLGLSILIEHLTA
MNTP_XANP2       VNIVVVALAIGAMSFLMSSGGMLVGRM--VGQKFGRLAEVVAGVALCGLGLAILIEHLSA
MNTP_RHOP5       ANIWVIAASIGFTTFVCTTVGMLIGKT--VGQRFGKMAELIGGLALVGLGAMILIQHTGV
MNTP_RHORT       VNILMACALIGAITTVVAAGGVLLGRG--AGPLLGRKAEVLGGLALIGIGLKILIEHLSA
MNTP_CORGL       VSILKVALSMGSITFALSLAGAWIGHH--GGGKFGKWATILGGIILIGIGANIVYEHLSA
MNTP_CORGB       VSILKVALSMGLITFALSLVGAWIGHH--GGGKFGKWATILGGIILIGIGANIVYEHLSA
MNTP_COREF       APIITLALAMGLTTFVLSLVGAWMGHH--GGGRFGGWATVIGGLVLIGLGGNILFDHMLG
MNTP_RHOPB       DNIPLTLFVIGIVTFVLTLIGLRVGGL--IGERTGRWAELAGGFGLIAIGANILVTHLTA
MNTP_DEHMB       TNIGLAALLIGLVSLTVSFLGFKLGNRIS--FMASRWVGVAGGLVLVFIGLKILAEHTLG
MNTP_DEHMC       TNIGLAALLIGLVSLTVSFLGFKLGNRIS--FMASRWVGVAGGLVLVFIGLKILAEHTLG
MNTP_DEHM1       TNIGLAALLVGAVSLAVSYLGFKLGNRIS--HLASRWVGIAGGLILCLIGLKILAEHTLG
MNTP_DESAH       VSIILPVVVIGVVALVFTWIGLLLGNRMLSSRKVGKQAELMGGGILILIGVKILHEHNVF
MNTP_DESOH       VSVWMPATVIGITAAVFTVGGLMMGSRAGDIPWLRRYADRVGAGVLLFIGLRILYAHGVF
MNTP_DESPS       VSIWYPALIIGLVAGAFTLFGMLLGQRIAKLQRFSSYAEVLGGIILWAIGLNILYDNGVF
MNTP_DESVH       IDIVTPAIVIGVVCLLFTATGLHLGRMLSRAESLGRRAALAGGVVLIGIGLRILYEHGVF
MNTP_DESVV       IDIVTPAIVIGVVCLLFTATGLHLGRMLSRAESLGRRAALAGGVVLIGIGLRILYEHGVF
MNTP_DESAG       LSIWMPAAVIGLVCLGLTAAGVQLGRVLAASSALSRYAEILGGAVLLGIGFKILHESGVF
MNTP_DESAD       YPIAFPCVMIGITALVLTSFGLWLGKSFAKASSYSHIAERIGGVVLILIGLKLLLQ----
MNTP_GEOBB       VSVWLPATVIGLVAGVLTVAGMLLGRRLG--EKWGKRVEICGGLVLCLIGLKILLEHTLL
MNTP_GEOSM       VSVWLPATVIGLVAGVLTVAGMLMGRRLG--EKWGKRVEICGGLVLCLIGLKILLEHTLL
MNTP_PELCD       ISVWFPALIIGIIAGVMTVIGMLLGRRAG--ARWGQRVEIAGGLILIGIGLKILWEHTLG
MNTP_SYNFM       QQLFLSAVWIGITAGIMTWGAMRLGNRLS--RQFGRRMETVGGLILVAIAVKLLLF----
MNTP_DESDA       TPIWADAAIIGIVCAVITACGVYLGKTLANLCALNGWAELAGGLTLLAIACNILREHQVF
MNTP_ELUMP       VHFVLSVAAISFFVLITTFFGFKIGGK--LGDKLGIKAEIFGGIVLIGIALKILLDAMM-
MNTP_FUSNN       YQTFLYTVEIGVITAIIAGLGFILGDK--FGNILGQKSHFLGAALLIFISINILL-----
MNTP_CLOAB       YVILGDSVFIGIVTLILSIIAFIISRYLKRIQLVCKYADYIGGIILVIFGLKMMFF----
MNTP_CLOTE       LLILRDTLFIGIVTLFVSILAFITSKYLKKIDVIGKYADYIGGIILIFFGLKMIFF----
MNTP_CLONN       LLLLESTIFIGIITSILCLIAFLISGYLKRINTISKYANYIGGVILMLFGLEMIFM----
MNTP1_CLOBH      FYLFMSSLFMGLIATIICSLGIILSKYIKKISIISSYADYIGGIILILFGLKMLFF----
MNTP1_CLOBL      FYLFMSSLFMGLIATIICSLGIILSKYIKKISIISSYADYIGGIILILFGLKMLFF----
                           .         .   .                ..  *  ..   .      

MNTP_BACVZ       ------------
MNTP_BACSU       ------------
MNTP_BACLD       ------------
MNTP_BACP2       ------------
MNTP_GEOKA       ------------
MNTP_GEOTN       ------------
MNTP_GEOSW       ------------
MNTP_BACAN       ------------
MNTP_BACAA       ------------
MNTP_BACC0       ------------
MNTP_BACAH       ------------
MNTP_BACAC       ------------
MNTP_BACC3       ------------
MNTP_BACC1       ------------
MNTP_BACCQ       ------------
MNTP_BACCZ       ------------
MNTP_BACC7       ------------
MNTP_BACHK       ------------
MNTP_BACCR       ------------
MNTP_BACC4       ------------
MNTP_BACC2       ------------
MNTP_BACMK       ------------
MNTP_BACSK       ------------
MNTP_BACHD       ------------
MNTP_OCEIH       ------------
MNTP_DESRM       ------------
MNTP_PELTS       ------------
MNTP_CARHZ       ------------
MNTP_DESAP       ------------
MNTP_HELMI       G-----------
MNTP_MOOTA       ------------
MNTP_SYNWW       ------------
MNTP_ARCB4       ------------
MNTP1_WOLSU      ------------
MNTP_COLP3       ------------
MNTP_SACD2       ------------
MNTP_PSYA2       ------------
MNTP1_PSYCK      ------------
MNTP_PSYWF       ------------
MNTP2_PSYCK      ------------
MNTP2_WOLSU      ------------
MNTP_CAMFF       ------------
MNTP_CAMHC       L-----------
MNTP_CAMC1       EGVL--------
MNTP_CAMC5       HI----------
MNTP_RUMCH       GG----------
MNTP_ACTSZ       G-----------
MNTP_MANSM       G-----------
MNTP_HUNT2       ISFVFDSLNKFN
MNTP_DESHY       LG----------
MNTP_ALKOO       ------------
MNTP_CAMJE       D-----------
MNTP_CAMJR       D-----------
MNTP_CAMJJ       D-----------
MNTP_CAMJ8       D-----------
MNTP_CAMJD       D-----------
MNTP_LACP7       LAQLF-------
MNTP_BACFR       NN----------
MNTP_BACFN       NN----------
MNTP_BACTN       Q-----------
MNTP_BACV8       S-----------
MNTP_CROS5       PI----------
MNTP_RIPO1       H-----------
MNTP_GLOC7       SLV---------
MNTP_PARD8       S-----------
MNTP_METS3       ------------
MNTP_METST       ------------
MNTP_METTH       T-----------
MNTP_METLZ       ------------
MNTP_METHJ       NGAGA-------
MNTP_METB6       ------------
MNTP_METAC       I-----------
MNTP_METMA       I-----------
MNTP_METBF       I-----------
MNTP_METMJ       ------------
MNTP_CLOB1       LSYIF-------
MNTP2_CLOBH      LSYIF-------
MNTP2_CLOBL      LSYIF-------
MNTP_CLOBM       LSKIF-------
MNTP_CLOPE       IEKLFS------
MNTP_CLOP1       IEKLFS------
MNTP_CLOPS       IEKLFS------
MNTP_BIFLO       IAF---------
MNTP_BIFLD       IAF---------
MNTP_BIFLS       IAF---------
MNTP_BIFAA       LG----------
MNTP_SORC5       S-----------
MNTP_ECOLI       ------------
MNTP_SHIDS       ------------
MNTP_SHIB3       ------------
MNTP_ECO24       ------------
MNTP_ECO57       ------------
MNTP_ECO5E       ------------
MNTP_ECOLU       ------------
MNTP_ECOK1       ------------
MNTP_ECO45       ------------
MNTP_ECOL6       ------------
MNTP_ECOL5       ------------
MNTP_ECO81       ------------
MNTP_ECOHS       ------------
MNTP_ECOUT       ------------
MNTP_ECO8A       ------------
MNTP_ECOSE       ------------
MNTP_ECOSM       ------------
MNTP_ECOBW       ------------
MNTP_ECODH       ------------
MNTP_ECO55       ------------
MNTP_ECOLC       ------------
MNTP_SHIFL       ------------
MNTP_SHIF8       ------------
MNTP_SHISS       ------------
MNTP_ECO27       ------------
MNTP_ECO7I       ------------
MNTP_ESCF3       ------------
MNTP_SALA4       ------------
MNTP_SALCH       ------------
MNTP_SALDC       ------------
MNTP_SALNS       ------------
MNTP_SALPA       ------------
MNTP_SALPB       ------------
MNTP_SALSV       ------------
MNTP_SALTI       ------------
MNTP_SALTY       ------------
MNTP_SALHS       ------------
MNTP_CITK8       ------------
MNTP_ENT38       ------------
MNTP_KLEP3       ------------
MNTP_KLEP7       ------------
MNTP_CROS8       ------------
MNTP_PECAS       ------------
MNTP_PECCP       AA----------
MNTP_PHOLL       FMYAK-------
MNTP_PROMH       FMYAH-------
MNTP_YERPE       TA----------
MNTP_YERPP       TA----------
MNTP_YERPY       TA----------
MNTP_YERPG       TA----------
MNTP_YERPA       TA----------
MNTP_YERPN       TA----------
MNTP_YERPS       TA----------
MNTP_YERPB       TA----------
MNTP_YERP3       TA----------
MNTP_YERE8       LA----------
MNTP_SERP5       LA----------
MNTP_SODGM       AMLAHLPG----
MNTP_ERWT9       LG----------
MNTP_PSEAE       A-----------
MNTP_PSEAB       A-----------
MNTP_PSEA8       A-----------
MNTP_PSEF5       VA----------
MNTP_PSE14       A-----------
MNTP_PSEU2       AQ----------
MNTP_PSESM       AA----------
MNTP_ALCBS       ------------
MNTP_STRMK       VG----------
MNTP_STRM5       VA----------
MNTP_XANAC       AG----------
MNTP_XANC5       AA----------
MNTP_XANOR       AT----------
MNTP_XANOM       AT----------
MNTP_XANCP       AA----------
MNTP_XANC8       AA----------
MNTP_XANCB       AA----------
MNTP_XYLFA       NG----------
MNTP_XYLFM       TG----------
MNTP_XYLF2       TG----------
MNTP_XYLFT       TG----------
MNTP_PARPJ       FG----------
MNTP_NITEC       ------------
MNTP_METFK       AA----------
MNTP_CHRSD       LASA--------
MNTP_NEIMA       IG----------
MNTP_NEIMB       IQ----------
MNTP_NEIMF       IG----------
MNTP_NEIG1       IQ----------
MNTP_BRASB       ------------
MNTP_XANP2       ------------
MNTP_RHOP5       LKTQLG------
MNTP_RHORT       ------------
MNTP_CORGL       ------------
MNTP_CORGB       ------------
MNTP_COREF       ------------
MNTP_RHOPB       ------------
MNTP_DEHMB       WDILL-------
MNTP_DEHMC       WDILL-------
MNTP_DEHM1       WDILL-------
MNTP_DESAH       ------------
MNTP_DESOH       Y-----------
MNTP_DESPS       SPFL--------
MNTP_DESVH       DTAATLARSVLG
MNTP_DESVV       DTAATLARSVLG
MNTP_DESAG       G-----------
MNTP_DESAD       ------------
MNTP_GEOBB       K-----------
MNTP_GEOSM       K-----------
MNTP_PELCD       M-----------
MNTP_SYNFM       ------------
MNTP_DESDA       ------------
MNTP_ELUMP       ------------
MNTP_FUSNN       ------------
MNTP_CLOAB       ------------
MNTP_CLOTE       ------------
MNTP_CLONN       ------------
MNTP1_CLOBH      ------------
MNTP1_CLOBL      ------------