CLUSTAL format seed alignment for MF_01523

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RSMJ_ECOLI      ---------------------------MKICLIDETG-TGDGALSVL----------AAR
RSMJ_SHIFL      ---------------------------MKICLIDETG-AGDGALSVL----------AAR
RSMJ_KLEP7      ---------------------------MKICLIDETG-AGDGALSVL----------AAR
RSMJ_CITK8      ---------------------------MKICLVDETG-AGDGALSVL----------AAR
RSMJ_SALA4      ---------------------------MQICLMDETG-ATDGALSVL----------AAR
RSMJ_SALAR      ---------------------------MKICLLDETG-AGDGALSVL----------AAR
RSMJ_ENT38      ---------------------------MKICLVDETG-AGDGALSVL----------AAR
RSMJ_CROS8      ---------------------------MNICLIDETG-AGDGALSVL----------AAR
RSMJ_ERWT9      ---------------------------MNICLLDESG-AGDGALSVL----------AAR
RSMJ_PECAS      ---------------------------MSICLIAEEG-ADSGALSSL----------AER
RSMJ_PECCP      ---------------------------MSICLIAEEG-ADSGALSSL----------AAR
RSMJ_YERE8      ------------------------MSQVSICLLSEAG-ADPGALSIL----------AER
RSMJ_YERPE      ------------------------MSHVSICLLSEAG-ADPGALSIL----------ADR
RSMJ_SERP5      ---------------------------MSVCLLCEEG-ADPGALSIL----------AQR
RSMJ_EDWI9      --------------------------MAAVQLLAEEG-ADAAALSAL----------AQR
RSMJ_PHOLL      ---------------------------MGICLICEQG-ADNSALSQL----------AER
RSMJ_PROMH      ---------------------------MNICLLCEEG-ADNSALSAL----------AQR
RSMJ_ACTPJ      ---------------------------MTIQLINESS--NTEKFQQI----------CDK
RSMJ_HAEDU      ---------------------------MTIQLINESS--NTAKFQQI----------CEK
RSMJ_HAEPS      ---------------------------MNIQLINESD--FTERFYDI----------CEK
RSMJ_HAES1      ------------------------MVNQKIQLICETE--SAVQFTAL----------CQQ
RSMJ_MANSM      ---------------------------MNIQLICETE--NSQNFTAL----------CKE
RSMJ_PASMU      ---------------------------MNIQLICETE--NPEKFTAL----------CTQ
RSMJ_ACTSZ      ---------------------------MMIQLRSEIK--TDENLTALFRR------QCEA
RSMJ_HAEIE      ----------------------MAHSQVGIQLISESTEKTLAELTAL----------CAE
RSMJ_HAEIG      ----------------------MAHSQVGIQLISESTEKTLAELTAL----------CAE
RSMJ_HAEIN      ----------------------MAHSQVGIQLISESTEKTLAELIAL----------CAE
RSMJ_AERHH      -----------------------------MQILLEDP-AKAPQAEAL----------ASQ
RSMJ_AERS4      -----------------------------MQILLEDP-TKAAQAQVL----------ASQ
RSMJ_TOLAT      --------------------------MYPIQVIAEDP-ERTAQAAEL----------ATR
RSMJ_ALISL      ---------------------------MQIALLCEDL-NRQSELEAI----------ATR
RSMJ_ALIF1      ---------------------------MQIALLSEDP-NRQSELEAI----------ATR
RSMJ_VIBCB      ---------------------------MQLQLICEDP-SQQSHLDEL----------AAR
RSMJ_VIBPA      ---------------------------MQLQLICEDP-SQQSHLDEL----------AAR
RSMJ_VIBTL      ---------------------------MQLQLICEDA-TQIDHLNDL----------ATR
RSMJ_VIBVU      ---------------------------MQLQLICEDA-ALQPYLDAI----------ASK
RSMJ_VIBCH      ---------------------------MLIQLICQAP-QRAQELEQI----------AAR
RSMJ_PHOPR      ---------------------------MQLALICENP-ERQNELDEL----------AQR
RSMJ_SHEB8      ------------------------------MTPIFFN-QQYPTLVDI----------CAR
RSMJ_SHEPC      -------------------MTAILLVRRQPVTPIFFN-QQYPTLVDI----------CAR
RSMJ_SHEON      -----------------------------MPIPVFFN-QQYPTLVDI----------CAR
RSMJ_SHESA      -----------------MAAISTCQTVIPLPIPVFFN-QQFPTLVDI----------CAR
RSMJ_SHEDO      ------------------------------MTRIFFN-QQYPTLVDI----------SQR
RSMJ_SHEFN      -------MFTGDGFWHNGVVSYIGMVIILLQTPIFFN-QQYPSLVDI----------AQR
RSMJ_SHEPA      ------------------------------MTSIFFN-RHYPTIESA----------CER
RSMJ_SHEWM      ---------------------MTQVNQTKTSYGIFFN-RHYPTIESA----------CER
RSMJ_SHEHH      ------------------------------MTSIFFN-RHYPTLESA----------CER
RSMJ_SHEPW      ------------MVMGVIIIGSIFIKQSLIVTSIFFN-QQYPTLESV----------AER
RSMJ_SHELP      ---------------------MTASSTQPASVGIFFN-RQYPTLEAV----------CDR
RSMJ_SHESH      ---------------------MTELKQSIQPIGIFFN-AQYPSLEAI----------CQR
RSMJ_SHEAM      ------------------------------MFPIQIA-PNDPRLTQI----------CAR
RSMJ_PSEHT      -----------------------------MVIKCAFK-ECRPYLNEL----------ETR
RSMJ_COLP3      -----------------MSPIIASEHLSNIALGYVDS-VDSEYAKRL----------AKK
RSMJ_PSYIN      ---------------------------MDIPLICNDS-ALSQKAKIL----------RKK
RSMJ_ALTMD      -----------------------MLNSVPLVIAQHSTQDDTSLLNSI----------GNK
RSMJ_PSEA6      -------------------------MAPVVTVPENASPELVEKAKNL----------ASV
RSMJ_BUCAI      ---------------------------MKIYLKFKSY---NKRICKL----------LQL
RSMJ_BUCAP      ---------------------------MNIYLIINHE---NQRIQNL----------IDK
RSMJ_IDILO      ---------------------MTTTARVPILADSDAE---TVAVKAI----------AER
RSMJ_AGRFC      ------------------------------------------------------------
RSMJ_OCHA4      ------------------------------------------------------------
RSMJ_RHOPS      ------------------------------------------------------------
RSMJ_RHOP2      ------------------------------------------------------------
RSMJ_RHOPA      ------------------------------------------------------------
RSMJ_ALKEH      ----------------------MINRNHRPLRGVLSDPDEPAAAAAL----------AHR
RSMJ_HALHL      ----------------MHAGLRCDASTDPGLCGVVAVGDHPAAAAAW----------AEQ
RSMJ_THISH      -------------------------MSDTRISIRYASEDLRERAEAL----------AAE
RSMJ_CHRVO      ---------------------------MTATPLYCAEPARLDTARRL----------CER
RSMJ_LARHH      MHEMIFPCGLSHQRSSADNAPLPRLMVAMFHGLLATPDVSPATLERF----------AAG
RSMJ_NEIGO      ------------------------------MTDILIDDTATEAVRTL----------IRA
RSMJ_NEIMA      ------------------------------MTDILIDNTATETVRTL----------IRA
RSMJ_NITOC      ---------------------------MQNAGIAFDSLEQLNAARQL----------ACR
RSMJ_PSEAE      ---------------------MTD-SAAPRLHVQALSADCAEAARRW----------AER
RSMJ_PSEA7      ---------------------MTD-SAAPRLHVQALSADWAEAARHW----------AER
RSMJ_PSEMY      ---------------------MTDEPRNASIRMDALQAHHAEAAARW----------ATR
RSMJ_PSEU5      ---------------------MS--ASNSLVRVEPLAPSFAAVAGQW----------AQR
RSMJ_AZOVD      ---------------------MADESPAVWVRVEALDTVFHEAAQAL----------AGR
RSMJ_PSEP1      -----------------------MEEQGTGIRVEAMAAEYAQQARVW----------AER
RSMJ_PSEPW      -----------------------MEEQGMGIRVEAMSPEYAHQATAW----------AER
RSMJ_PSEPG      -----------------------MEEQGTGIRVEALSAEFAAQAAAW----------AER
RSMJ_PSEE4      ---------------------MAEQEQGTGIRVEALAPEFQAQAQAW----------AQR
RSMJ_PSEPF      ---------------------MIEQPAACRIHVEALGPTFEAQAEQW----------AQR
RSMJ_PSEFS      ---------------------MSEQPAASRIQVEALGDGFKARAEQW----------ASL
RSMJ_PSEF5      ---------------------MNEQPAACRIKVEALGAGFAPAAEQW----------AER
RSMJ_PSE14      ---------------------MIEQQTGSRIRVEALAVAGQEQAEHW----------AQR
RSMJ_PSEU2      ---------------------MIEQQAGSRIRVEALAVGGQEQAAQW----------AQR
RSMJ_PSESM      ---------------------MIEQQAGSRIRVEALAIDGQEHAAQW----------AQR
RSMJ_DECAR      -----------------------------------MGPAFASAALAL----------SEA
RSMJ_CHRSD      --------------------------------MSDAVVAVGEPLRDL----------AAR
RSMJ_MARHV      -----------MPSPSSHTELPDSSSLRHILAVAHSPLAEPGVARTL----------ATE
RSMJ_MARMS      --------------------------MLNSIAVATTDKFLESESRLL----------AKS
RSMJ_CELJU      ----------------------------MLSIPLVCSSDFAPAAQVL----------AQE
RSMJ_HAHCH      ------------------------MISYDDQVLVSYSNQRWEEAEAF----------SSQ
RSMJ_SACD2      ---------------------------MKSGFVVRSTISSWESAERF----------CRQ
RSMJ_COXBU      --------------------------MNDTLAITYSTPARLSEAEKL----------ARQ
RSMJ_DESPS      ----------------------MLHNITLSLVPEIITDNILIKAKEI----------AQF
RSMJ_MAGMM      -------------------------MSLLSVMPATTAQQS--RAEQV----------AHH
RSMJ_HYDCU      -------------------------MQTSSFPIVIDDHLLPDKAHAL----------AQQ
RSMJ_BDEBA      -------------------MVSASLDGGLRICVRASAPEVHDKAVAWASFLKAPLN----
RSMJ_LEGPC      ------------------------------MNRIKAVGYENNELKEKAQLLADQLN----
RSMJ_ALCBS      --------------------------MRQSEWLDTVLGLLPGCPKGL----------PGF
RSMJ_FRAP2      -------------------------MNVYDLAVISHIENITDIEFEY-------------
RSMJ_FRATF      -----------------------MQINISNLDVKNHLDKFIEDRLEY-------------
RSMJ_DICNV      --------------------------MTDYFALKERPPYFPERVPCH-------------
RSMJ_ACIB5      ---------------------MEKNCGSGQSKLKALRMHMYFEVDFQ-------------
RSMJ_ACIAD      ---------------------------------MVKPMHLFAVVDAL-------------
RSMJ_PSYA2      --------------MINAKQVPTADMSCQLLYISESQACQVYSLQAL-------------
RSMJ_PSYCK      --------------MTNLKQVLTADISCQLLYVNETQASQVESLQAL-------------
                                                                            

RSMJ_ECOLI      W-----GLEH------DEDN---LMALVLTPEH-----LELRKRDEP-----------KL
RSMJ_SHIFL      W-----GLEH------DEDN---LMALVLTPEH-----LELRKRDEP-----------KL
RSMJ_KLEP7      W-----GLEQ------DDDN---PMALALTTEH-----LELRKRDEP-----------KL
RSMJ_CITK8      W-----GLEH------DENN---PMALVLTTAH-----LELRKRDEP-----------KL
RSMJ_SALA4      W-----GLEH------DEDN---PMALVLTPQH-----LELRKRDEP-----------KL
RSMJ_SALAR      W-----GLEH------DENN---LMALVLTPQH-----LELRKRDEP-----------KL
RSMJ_ENT38      W-----GLEH------DEQN---LMALVMTPEH-----LELRKRDEP-----------KL
RSMJ_CROS8      W-----GLTH------DADN---PMALVMTSAR-----LELRKRDEP-----------KL
RSMJ_ERWT9      W-----QLEH------DDSA---PMALVLTPQH-----LELRKRDEP-----------KL
RSMJ_PECAS      W-----GLVS------DPNA---VMALVLTTER-----LELRKQDEP-----------KL
RSMJ_PECCP      W-----GLVS------DPDA---VMALVLTAER-----LELRKQDEP-----------KL
RSMJ_YERE8      W-----GLVS------DEQS---IMALVLTPER-----LELRKRDEP-----------KL
RSMJ_YERPE      W-----GLVS------DDQA---VMALVLTAER-----LELRKRDEP-----------KL
RSMJ_SERP5      W-----QLTS------DDEA---LMALVLTPER-----LELRKRDEP-----------KL
RSMJ_EDWI9      W-----GLCH------DADA---VLALVLTPQR-----LELRKLDEP-----------KL
RSMJ_PHOLL      W-----GLVH------DENA---IMALVLTPQH-----LELRKRDEP-----------KL
RSMJ_PROMH      W-----GLIH------DATQ---TMALVLTPTH-----LELRKQDEP-----------KL
RSMJ_ACTPJ      W-----RLVH------DRSA---ILALVLTDER-----LELRKLDEP-----------KL
RSMJ_HAEDU      W-----QLVH------DKSA---SLALVLTDTR-----LELRKLDEA-----------KL
RSMJ_HAEPS      W-----KLKH------NPSS---NLALVQTNER-----LELRKLNQP-----------KL
RSMJ_HAES1      K-----GLIH------DPDS---YLALVQTKVE-GQVRLELRKLDEP-----------KL
RSMJ_MANSM      K-----GLTH------DPAS---VLALVQTETD-GEVRLELRKLDEP-----------KL
RSMJ_PASMU      Y-----GLVH------DPES---YLALVQTYDEQGQVRLELRKLDEA-----------KL
RSMJ_ACTSZ      A-----GLIH------DETS---PLALVQAAMGEHDWRLELRKLDEP-----------KL
RSMJ_HAEIE      H-----NIIH------HEKS---PLALVQTDER-----LELRKLDEP-----------KL
RSMJ_HAEIG      Y-----NIIH------NEKS---PLALVQTDER-----LELRKLDEP-----------KL
RSMJ_HAEIN      H-----NIIH------NEKS---PLALVQTDDR-----LELRKLDEP-----------KL
RSMJ_AERHH      L-----GQT--------DLP---QFALVFTAAR-----LELRKLDEP-----------KL
RSMJ_AERS4      L-----NQT--------DYP---QFALVFTPER-----LELRKLDEP-----------KL
RSMJ_TOLAT      L-----QQQM-------AES---PFALVWGEQH-----LELRKLDEP-----------KL
RSMJ_ALISL      W-----GLTH------DEDN---VFALVLTTQQ-----LELRKRDEP-----------KL
RSMJ_ALIF1      W-----GLEH------DEDN---VFALVLTDKQ-----LELRKRDEP-----------KL
RSMJ_VIBCB      W-----QLSH------TDDS---DFALVLTTER-----LELRKVDEP-----------KL
RSMJ_VIBPA      W-----QLSH------TDES---DFALVLTAER-----LELRKVDEP-----------KL
RSMJ_VIBTL      W-----NLSH------DENS---DFALVLTCER-----LELRKVDEP-----------KL
RSMJ_VIBVU      W-----QLTH------DADS---HFALVLTFER-----LELRKLDEP-----------KL
RSMJ_VIBCH      W-----QLQA------SDDS---PFALVLSEER-----LELRKLDEP-----------KL
RSMJ_PHOPR      W-----GLSH------DENS---IFALVLTDTQ-----LELRKLDEA-----------KL
RSMJ_SHEB8      W-----QLVY------DANA---TFELRFESDT-----LSLHKRDEP-----------KL
RSMJ_SHEPC      W-----QLIY------DANA---PFELRFESDS-----LTLHKRDEP-----------KL
RSMJ_SHEON      W-----QLVY------DANA---TFELRFESDT-----LSLHNRDEP-----------KL
RSMJ_SHESA      W-----QLVF------DADA---PFELRFESDT-----LTLHKRDEP-----------KL
RSMJ_SHEDO      W-----QLEF------DKEA---EFELKFEQNQ-----LSLHKRDEP-----------KL
RSMJ_SHEFN      W-----QLVW------DKDA---AFELRFDQNC-----LSLHKRDEP-----------KL
RSMJ_SHEPA      W-----GLVY------DPDA---EFELVFEDNI-----LTLIKRDEP-----------KL
RSMJ_SHEWM      W-----GLVY------DANA---EFELVFEDNI-----LTLIKRDEP-----------KL
RSMJ_SHEHH      W-----GLEF------DANA---EFELVFENDI-----LTLIKRDEP-----------KL
RSMJ_SHEPW      W-----GLTY------SKDA---EFELVFENNI-----LSLIKRDEP-----------KL
RSMJ_SHELP      W-----GLVF------DENA---LFELVFEDNC-----LVLNKRDEP-----------KL
RSMJ_SHESH      W-----GLVF------DKEA---AFELVFENNC-----LVLNKRDEP-----------KL
RSMJ_SHEAM      W-----DLTP------NDNA---EFSLLFEEDI-----LTLKKRDEP-----------KL
RSMJ_PSEHT      F-----GLAHWA----DQSS---GFSLHYDDTG-----LSLYKTDEP-----------KL
RSMJ_COLP3      WQFNYLGHVAAA----SKQP---KLEFMLQMHH---HALELCKLDEP-----------KL
RSMJ_PSYIN      W-----GFLSTQ----SDH-------FQLHLLP---EYLALEQKDDP-----------KQ
RSMJ_ALTMD      W-----GFPVVS----HSEKPAEGFYLQIQNGV-----LGLADASEK-----------KV
RSMJ_PSEA6      W-----QLNFDG----NVRH---GLVLMQSEAH-----LALKQLDEP-----------KV
RSMJ_BUCAI      F-----KLEHD------QNC---SMGLLINHNS-----LELYNRDNV-----------NQ
RSMJ_BUCAP      Y-----HLKHD------ENS---SMALIMNSNS-----LELYDRSKP-----------RN
RSMJ_IDILO      W-----GLPFET----TDND---VFQLWLTEGV-----LALHWLQSPQ----------KM
RSMJ_AGRFC      ------------------------------------------MKEQN-------------
RSMJ_OCHA4      ----------------------------------------MSQKIDT-------------
RSMJ_RHOPS      -----------------------------------------MSAISR-------------
RSMJ_RHOP2      -----------------------------------------MAAAGR-------------
RSMJ_RHOPA      -----------------------------------------MAETAR-------------
RSMJ_ALKEH      L-----DLPLLT-----EPPETPALFLHHSRNGLA---LRSSGSNAP-------------
RSMJ_HALHL      L-----GVPVLE-----HRPQEGSGVILLADEPPA---LQLLGRRAP-------------
RSMJ_THISH      L-----NLPLAG-----ESAGTP-LVLILDGHGLS---LALTAPDAP-------------
RSMJ_CHRVO      F-----SLPLIK-----QRPADGY---WLELGSER---LELLTTGKH-------------
RSMJ_LARHH      Y-----GLSCLA-----TPPDEGY---WLAWRAGV---LGL-ESPHH-------------
RSMJ_NEIGO      F-----PLVPVS-----QPPEQGS---YLLAEHDT---VSLRLVGEK-------------
RSMJ_NEIMA      F-----PLVPVS-----QPPEQGS---YLLAEHDT---VSLRLVGEK-------------
RSMJ_NITOC      L-----GLPLLT-----PPLNLGRPTITLVLSAQR---LELHHPELG-------------
RSMJ_PSEAE      L-----GLPLAA-----DDEAEFAVQVG--EQGLQ---VLQLGADSP-------------
RSMJ_PSEA7      L-----GLPLAA-----DDQADFAVQVG--EQGLQ---VLQLGPDSP-------------
RSMJ_PSEMY      L-----GLPR-------VGETDFALQLG--DQGLQ---LVELGDKAP-------------
RSMJ_PSEU5      L-----GLPQE------LAEAEFALQVG--EAGLQ---LQLLEAQAP-------------
RSMJ_AZOVD      L-----GLPFG-------GEARFALQLG--EQGLQ---LAELGAQAP-------------
RSMJ_PSEP1      L-----GLPLQ------DDTAAFAVQVG--ADGLQ---IQQLGPQAP-------------
RSMJ_PSEPW      L-----GLPLQ------DDAAGFAVQVG--ADGLQ---IQQLGPQAP-------------
RSMJ_PSEPG      L-----ELPLH------DEAADFAVQVG--ADGLQ---IQQLGPQAP-------------
RSMJ_PSEE4      L-----GLPMT------DDEAGFAVQVG--VDGLQ---VQQLGPQAP-------------
RSMJ_PSEPF      L-----NLPLQ------VADGEFALQVG--EQGLQ---LQQLGPDAP-------------
RSMJ_PSEFS      L-----GLPLQ------LADADFSLQVG--EHGLQ---LQQLGPDAP-------------
RSMJ_PSEF5      L-----GLALQ------VDEAEFALQVG--EQGLQ---LQQLGPDAP-------------
RSMJ_PSE14      L-----GLPLH------DAEADFALQST--DDGLQ---LQQLGDDAP-------------
RSMJ_PSEU2      L-----GLPLT------DAHADFALQLT--DEGLQ---LQQLGDDAP-------------
RSMJ_PSESM      L-----GLPLH------DADADFALQLT--DDGLQ---LQQLGDDVP-------------
RSMJ_DECAR      L-----NLPSS-------GEADFVLQVG--TEGLQ---LQELGPHAP-------------
RSMJ_CHRSD      L-----GLAWQA-----EGDATAALRLAMTPEGLA---LSGEARHYG-------------
RSMJ_MARHV      L-----GLDWLGVVAP-KQVRDYGLLLFMDEHGLA---LQQTGKGAP-------------
RSMJ_MARMS      L-----NLDFLFLNEPLKFVSKYDYLLLKTSDGIG---VAKTGKGAP-------------
RSMJ_CELJU      F-----NLPIRVGEVP-ETIGDCEFVLVLDETGLA---LQQTGRKAP-------------
RSMJ_HAHCH      F-----GLRLVALEALPAKSDRAVYLLNFSDTRVE---LVNWREQAP-------------
RSMJ_SACD2      F-----SLPLLDMQA---KHNQEVFQLIFDHQNVH---LLDCRAKKP-------------
RSMJ_COXBU      M-----KLPLVS-----LNSTDYSFLLVFTPAHLE---LRSTGTKAP-------------
RSMJ_DESPS      L-----NIPLS------DRREEYPQALIWDRDGLS--LCSISAKDGS-----------HA
RSMJ_MAGMM      F-----HWPLV------AVEALCPTPLLL-WVGPT--GLALKSADGK-----------HQ
RSMJ_HYDCU      L-----NLPLI------SATEAEKSAPLMKLGWWQ--DGKKSGDHTNEIDYKLALFPPST
RSMJ_BDEBA      ----------------PENPEQYFFHFFVEPEG-----VYVRDQEKR-------------
RSMJ_LEGPC      ----------------LQLDQNADTCLFVTPEK-----LTLKIRNFS-------------
RSMJ_ALCBS      W---------------VENEAQASGQALELVLGWHDDCLGLWRPGGK------------Q
RSMJ_FRAP2      -----------------ILSSQDDKYLYVDNNI-----LKLHYKDKE-------------
RSMJ_FRATF      -----------------EFCKQD-KYLYLENDN-----LKLHYNNKE-------------
RSMJ_DICNV      -----------------ILEHVPQGFYLAKHEQ-----RWALCCTDK-------------
RSMJ_ACIB5      ------EQAQHYQAVLHSRGVTVDLQPIEKLNARFLRLNPDLALCVDE-----NGLWLSA
RSMJ_ACIAD      ------EQAQQFQQVLASRDVSTELVQIEQLNARFLRHHPELALCVDL-----DGLWLSA
RSMJ_PSYA2      ------IAEHELSIILNVERYVDKLNQKRRQQLSQESTQPVLLLDDK------NKLSWLS
RSMJ_PSYCK      ------IAKHKLPIILNAELVTEKLNQKRRQQLSQIVTQPILLLDEK------DKLSWLS
                                                                            

RSMJ_ECOLI      GGIFVDFVGGAMAHRRKFGGGRGEAVAKAVGIKG-DYLPDVVDATAGLGRDAFVLASVGC
RSMJ_SHIFL      GGIFVDFVGGAMAHRRKFGGGRGEAVAKAVGIKG-DYLPDVVDATAGLGRDAFVLASVGC
RSMJ_KLEP7      GGIFVDFVGGAMAHRRKFGGGRGEAVAKAVGIKG-DYLPDVVDATAGLGRDAFVLASVGC
RSMJ_CITK8      GGIFVDFVGGAMAHRRKFGGGRGEAVAKAVGIKG-DYLPDVVDATAGLGRDAFVLASVGC
RSMJ_SALA4      GGIFVDFVGGAMAHRRKFGGGRGEAVAKAVGIKG-DYLPDVVDATAGLGRDAFVLASVGC
RSMJ_SALAR      GGIFVDFLGGAMAHRRKFGGGRGEAVAKAVGIKG-DYLPDVVDATAGLGRDAFVLASVGC
RSMJ_ENT38      GGIFVDFADGAMAHRRKFGGGRGEAVAKAVGVKG-SYLPDVVDATAGLGRDAFVLASVGC
RSMJ_CROS8      GGIFVDFVEGAMAHRRKFGGGRGEAVAKAVGIKG-SYLPQVVDATAGLGRDAFVLASVGC
RSMJ_ERWT9      GGIFVDFVSGAMAHRRKFGGGRGEAVAKAVGIKS-GYLPDVVDATAGLGRDAFVLAALGC
RSMJ_PECAS      GAIFVDFVAGPMAHRRRFGGGRGEAVAKAVGIKK-DYLPDVVDATAGLGRDAFVLAALGC
RSMJ_PECCP      GAIFVDFVAGTMAHRRRFGGGRGEAVAKAVGIKK-DYLPDVVDATAGLGRDAFVLAALGC
RSMJ_YERE8      GGIYVDFVAGTLAHRRKFGGGRGEAVAKAVGIKK-GYLPRVVDATAGLGRDAFVLAALGC
RSMJ_YERPE      GGIYVDFVSGTQAHRRKFGGGRGEAVAKAVGIKK-GYLPRVVDATAGLGRDAFVLAALGC
RSMJ_SERP5      GAIYVDFVSGTMAHRRKFGGGRGEAVAKAVGIKG-NYRPDVVDATAGLGRDAFVLASLGC
RSMJ_EDWI9      GAIFVDFVGGTLAHRRRFGGGRGEAVAKAVGIKG-GYLPDVVDATAGLGRDAFVLASLGC
RSMJ_PHOLL      GGIYVDFVSGTMAHRRRFGGGRGEAVAKAIGIKK-DYLPTIVDATAGLGRDAFVLASLGC
RSMJ_PROMH      GGIYVDFVAGTMAHRRKFGGGRGEAVAKAVGIKK-DYLPDVVDATAGLGRDAFVLASIGC
RSMJ_ACTPJ      GAIAVNFVDGTMAHRRKFGGGRGEAVAKAVGIKG-DYLPTIIDATAGLGRDAFVLASVGC
RSMJ_HAEDU      GAIAVNFVDGTLAHRRKFGGGRGEAIAKAVGIKG-NYLPSVIDATAGLGRDAFVLAAIGC
RSMJ_HAEPS      GAVAVNFVDGKMSYRRKFGGGRNEAIVKAVGVKG-SYTPTIIDATAGLGQDAFVLASIGC
RSMJ_HAES1      GAVYVDFVTGTMAHRRKYGGGRGEAVAKAVGIKG-NYLPTVIDATAGLGRDAFVLAALGC
RSMJ_MANSM      GAVYVDFVAGTMAHRRKFGGGRGEAIAKAVGVKG-NELPSVIDATAGLGRDAFVLASIGC
RSMJ_PASMU      GAVFVDFVAGAMAHRRKFGGGRGEAVAKAVGIKS-GYLPTVIDATAGLGRDAFVLASIGC
RSMJ_ACTSZ      GAVFVDFAGGVMAHRRKFGGGRGEAVAKAIGVKG-EELPTVIDATAGLGRDAFVLASVGC
RSMJ_HAEIE      GAVYVDFVGGTMAHRRKFGGGRGEAVAKAVGIKG-SELPTVIDATAGLGRDAFVLASIGC
RSMJ_HAEIG      RAVYVDFIGGTMAHRRKFGGGRGEAVAKAVGIKG-SALPTVIDATAGLGRDAFVLAAIGC
RSMJ_HAEIN      GAVYVDFVGGTMAHRRKFGGGRGEAVAKAVGIKG-SALPTVIDATAGLGRDAFVLAAIGC
RSMJ_AERHH      GAVYVDFVEGAVAHRRKFGGGRGQSIAKAVGLKA-GAMPRVVDATAGLGRDAFVLASLGC
RSMJ_AERS4      GAVYVDFVEGAVAHRRKFGGGRGQSIAKAVGLKA-GAMPTVVDATAGLGRDAFVLASLGC
RSMJ_TOLAT      GPVFVDFVEGAVAHRRKFGGGRGQSIAKAVGLKA-GANPTVVDATAGLGRDAFVLASLGC
RSMJ_ALISL      GAIFVDLVSGAVAHRRKFGGGKGQSIAKAVGLNK-GATPLVLDGTAGLGRDAFVLASLGC
RSMJ_ALIF1      GAIFVDLVSGAVAHRRKFGGGKGQSIAKAVGLNK-GATPIVLDGTAGLGRDAFVLASLGC
RSMJ_VIBCB      GAIFVDLIGGAVGHRRKFGGGKGQAIAKAAGLNK-GATPTVLDGTAGLGRDAFVLASLGC
RSMJ_VIBPA      GAIFVDLIGGAVGHRRKFGGGKGQAIAKAAGLNK-GATPTVLDGTAGLGRDAFVLASLGC
RSMJ_VIBTL      GAIFVDLVGGAVGHRRKFGGGKGQAIAKAAGLNK-GATPTILDGTAGLGRDAFVLASLGC
RSMJ_VIBVU      GAIYVDLAGGAVAHRRKFGGGKGQAIAKAAGLNK-GATPTVLDGTAGLGRDAFVLASLGC
RSMJ_VIBCH      GAIYVDWVEGAVAHRRKFGGGKGQSIAKAAGLNK-GVTPVVLDATAGLGRDAFVLASLGC
RSMJ_PHOPR      GAVFVDLVSGAAAHRRKFGGGRGQAIAKAVGLKK-GVMPRVLDGTAGLGRDAFVLASLGC
RSMJ_SHEB8      DGIVVDFVTGAVAHRRKFGGGRGQSIAKAVGLKQ-GVMPSVVDGTAGLGRDAFVLASLGC
RSMJ_SHEPC      DGILVDFVTGAVAHRRKFGGGRGQSIAKAVGLKQ-GVTPSVVDGTAGLGRDAFVLASLGC
RSMJ_SHEON      DGIVVDFVTGAVAHRRKFGGGRGQSIAKAVGLKQ-GVTPKVVDGTAGLGRDAFVLASLGC
RSMJ_SHESA      DGIVVDFVTGAVAHRRKFGGGRGQSIAKAVGLKQ-GVTPKVVDGTAGLGRDAFVLASLGC
RSMJ_SHEDO      DGIVVDFISGAVAHRRKFGGGRGQSIAKAVGLKQ-GVTPTVVDGTAGLGRDAFVLASLGC
RSMJ_SHEFN      DGISVDFVSGAVAHRRKFGGGRGQSIAKAVGLKQ-GVTPTVVDGTAGLGRDAFVLASLGC
RSMJ_SHEPA      KGISVDFVSGAVAHRRKFGGGRGQSIAKAVGLKQ-GVMPTVVDGTAGLGRDAFVLASLGC
RSMJ_SHEWM      KGISVDFVSGAVAHRRKFGGGRGQSIAKAVGLKQ-GVNPSVVDGTAGLGRDAFVLASLGC
RSMJ_SHEHH      KGIFVDFVTGAVAHRRKFGGGRGQSIAKAVGLKQ-GVTPTVVDGTAGLGRDAFVLASLGC
RSMJ_SHEPW      KGISVDFVSGAVAHRRKFGGGRGQSIAKAVGLKQ-GVTPTVVDGTAGLGRDAFVLASLGC
RSMJ_SHELP      KGIFVDFVSGAVAHRRKFGGGRGQAIAKAVGLKQ-GVTPSVVDGTAGLGRDAFVLASLGC
RSMJ_SHESH      KGISVDFVSGAVAHRRKFGGGRGQSIAKAVGLKQ-GVNPSVVDGTAGLGRDAFVLASLGC
RSMJ_SHEAM      GGIMVDFVSGAVAHRRKFGGGRGQAIAKAVGLKA-GATPTVVDGTAGLGRDAFVLASLGC
RSMJ_PSEHT      GAISVDFVTGAAAHRRKFGGGKGQAIAKAVGLNK-GATPIVLDATAGLGRDGFVLASLGC
RSMJ_COLP3      GAIKVDFVEGAVAHRRKFGGGRGQDIAKAVGLKH-GFKPHVLDATAGLGRDAFVLASLGC
RSMJ_PSYIN      GLVFVDFVSGSVAHRRKFGGGKGQAIAKAIGLKP-GVQVDVIDATAGLGRDAFVLASLGC
RSMJ_ALTMD      LPVEVDFASPASLYRKQHGGGRKEPIVKAIGLKG-NEGWHVVDATPGLGRDAFVLVSVGC
RSMJ_PSEA6      GEVLVDFASDALTFRRLHGGGKKEAVAKAVGLKG-QSEWRVLDATAGLGRDAFVLASLGC
RSMJ_BUCAI      KPIKVDFTSKKNHYRCHHFRRKNEVLYRVSGIKN-SYFPTILDATAGLGNDAFIFSFLGC
RSMJ_BUCAP      KSIKVNFSSKKNNYRCLNFKKKNEILYKAIGIKK-NYFPSVLDATAGLGQDSFLISFLGC
RSMJ_IDILO      SPLVVDFHQGKAAYRAQNTQLKNEAIAKAVGVTG-QFKPSVVDGTAGLGRDAFVLAGLGC
RSMJ_AGRFC      ESFVVDFVGGAVGHRFRSGEGRGQALPKAAGFTK-GRTPKIVDATAGLGRDAFLLASLGA
RSMJ_OCHA4      SELVVDFVGGAVGHRFRSGEGRGQALAKAAGLTR-DATPEIVDATAGLGRDAFLLASLGA
RSMJ_RHOPS      SALAVDFVGGAVGYKLRSGAARSHALLKATGVSA-NRPLHVIDATAGLGRDSFLLASMGA
RSMJ_RHOP2      SALAIDFVGGAVGYKLRSGAARSHALLKATGMAP-GRALQVIDATAGLGRDAFLLASMGA
RSMJ_RHOPA      TAPAVDFVGGAVGYRFRSQAGRSHALLKATGLSP-TRSLHVIDATAGLGRDAFLLASMGA
RSMJ_ALKEH      GPIRVSLDEGRQGQRLRQASLKRETLARACGLRG-GRSLRIVDATAGLGRDAMVLAALGA
RSMJ_HALHL      GPVAIDFTDHQLQRRVAGSTLRRDPLARAVGLHR-RPQTAVVDATAGLGHDGWVLAALGA
RSMJ_THISH      GPIQVDFVTGRLGYRQARISLRSEPLARAVGIKD-SERPSVVDATAGLGRDGFVLASLGC
RSMJ_CHRVO      GAVYAEFVEGAARHRREQGGGRGQPVAKAVGLKGAKDLPHVADATAGLGRDSFVLATLGC
RSMJ_LARHH      GAVTADFVGGAARHRREFGGGAGQPVARAIGLKGSQR-PQVVDATAGLGRDAFVMASLGC
RSMJ_NEIGO      SNVIVDFTSGAAQYRRTKGG--GELIAKAVNHT---AHPTVWDATAGLGRDSFVLASLGL
RSMJ_NEIMA      SSVIVDFASGAAQYRRTKGG--GELIAKAVNHT---AHPTVWDATAGLGRDSFVLASLGL
RSMJ_NITOC      APLFVDFVKGAMGYRRRQGEGRKQPLARAIGLKG-NVCPDVLDATAGLGRDAFVLAMLGC
RSMJ_PSEAE      GPVRVDFVEGASAHRRKFGGGSGQMIAKAVGVQPGIRP-RVLDATAGLGRDGFVLASLGC
RSMJ_PSEA7      GPVRVDFVEGASAHRRKFGGGSGQMIAKAVGIQPGVRP-RVLDATAGLGRDGFVLASLGC
RSMJ_PSEMY      GPVRVDFVEGAAAHRRQFGGGSGQMIAKAVGVQSGIRP-RILDATAGLGRDAFVLASLGC
RSMJ_PSEU5      GPVRVDFVEGAAAHRRQFGGGSGQMIAKAVGIQPGIRP-RVLDATAGLGRDAFVLATLGC
RSMJ_AZOVD      GPVRVDFVEGASAHRRLFGGGSGQMIAKAVGVQPGVRP-RVLDATAGLGRDAFVLACLGC
RSMJ_PSEP1      GPVRVDFVEGQAAHRRQFGGGNGQMIAKAVGIAQGIRP-QVLDATAGLGKDAFVLASLGC
RSMJ_PSEPW      GPVRVDFVDGQAAHRRQFGGGNGQMIAKAVGIAQGVRP-QVLDATAGLGKDAFVLASLGC
RSMJ_PSEPG      GPVRVDFVEGQAAHRRQFGGGNGQMIAKAVGIAQGVRP-QVLDATAGLGKDAFVLASLGC
RSMJ_PSEE4      GPVRVDFVEGQAAHRRLYGGGSGQMIAKAVGIAQGVRP-QVLDATAGLGKDAFVLASLGC
RSMJ_PSEPF      GPVRVDFVEGGAAHRRLYGGGSGQMIAKAVGIAQGVRP-RVLDATAGLGKDAFVLASLGC
RSMJ_PSEFS      GPVRVDFVEGGAAHRRLYGGGSGQMIAKAVGIAQGVRP-RVLDATAGLGKDAFVLASLGC
RSMJ_PSEF5      GPVRVDFVEGGAAHRRLYGGGSGQMIAKAVGVAQGVRP-RVLDATAGLGKDGFVLATLGC
RSMJ_PSE14      GAVRVDFVEGAVAHRRLFGGGTGQMIAKAVGIQPGVRP-SVLDATAGLGKDAFVLASLGC
RSMJ_PSEU2      GAVRVDFVEGAVAHRRLFGGGTGQMIAKAVGIQPGIRP-SVLDATAGLGKDAFVLASLGC
RSMJ_PSESM      GAVRVDFVEGAVAHRRLFGGGTGQMIAKAVGIQPGIRP-SVLDATAGLGKDAFVLASLGC
RSMJ_DECAR      GPLSVDFVRGPLAHRRLQGGGSGQMIAKAVGIQPGVRP-DVLDATAGLGRDAFVLAQLGC
RSMJ_CHRSD      APIRVDFTAGKAAHRRRFGGGRGQLVAKACGLARGVTP-SIVDATAGLGRDAFVLATLGA
RSMJ_MARHV      GPVRAEFVSGKMGYRREHGGGAGQLVARAVGMQKTRAPLQVLDATAGLGQDAFVLASLGC
RSMJ_MARMS      KPVYVDFTSGAVDHRRRFGGGKGQDIAKAVGLNKRANL-SVLDATAGLGRDAFVLACLGC
RSMJ_CELJU      GAVRAEFTEGAVDHRRKFGGGKGQMIAKAVGVKAGFSP-RVLDATAGLGRDAFVLATLGC
RSMJ_HAHCH      GPVFVDFVEGALAYRREHGGGRGEMVAKSVGLKGEVKCLNVLDATAGLGRDAYVLAALGC
RSMJ_SACD2      LTLMVDFVTGSRDHRRKFGGGAGQAVAKAVGVKGN-RTLHVLDATAGLGGDAFVLACLGS
RSMJ_COXBU      GPLYVDFLKGATAHRRLFGGGRSQLIVRAVGLKSHPHP-TILDLTAGLGRDAFVLANLGC
RSMJ_DESPS      KLLYIDFMGGKNGYRHANDCTTRQPIAKAVGIKPGFRP-TVFDATAGMGGDGFVLACLGC
RSMJ_MAGMM      HPITAQLQGGSIGLAGPDSWVRGQPLARAVGIKGQHTP-TVVDATAGLGGDGWLMARMGC
RSMJ_HYDCU      GPVCIDFVSGKKNHRRQFGGGKGQPLARAV--LAAEHP-TIIDATAGMGGDAFVFASLGC
RSMJ_BDEBA      -LLEIDFDKNHLDYERKGHRGKNELIAKALGVAK--GARRILDLSVGMGIDSVFLTQLGF
RSMJ_LEGPC      -LMFADFSTMTWSKRRG--EGKKQGLIRACKPTK--GIK-ILDATAGWGKDAAILATFGA
RSMJ_ALCBS      TPLTVSFCDGKQGYRLTPERVRHERLIKALGKPK-DDRIRVLDATAGLGRDAALMAQAGF
RSMJ_FRAP2      --LFIDFNSSEILNRINPSTKKCSVVQAVEGRSK--DKLNILDTTAGLGRDTFTLAARGH
RSMJ_FRATF      --LFIDFNDSEILNRINPKTKKCSVVQAIEGRSK--AKLTILDTTAGLGRDTFTLAARGH
RSMJ_DICNV      --KPIHIDFTDTLYRRGGKEYLPKAFKNMNGK-------RIFDATAGWGRDSWLLACRGF
RSMJ_ACIB5      NGMKMQPDWKAEIPRLKRASLKSEMIARACQLGE---KPVLVDATAGLGHDSLLMAYLGA
RSMJ_ACIAD      NGMKMQPDWQAEIPRLKRASLKSEMIARACQINE---QPSLIDATAGLGHDSLLMAYLGA
RSMJ_PSYA2      DGLSIAPEWDKLQRRVVSAGRKSELLLQATKMTA---DSKVIDATAGFGHDSLILASTGA
RSMJ_PSYCK      EGLSVAPEWDKLQRRVVSAGRKSELLLQAAKLTA---DSEVIDATAGFGHDSLILASTGA
                                         .              : * : * * *   :   * 

RSMJ_ECOLI      RVRMLERNPVVAALLDDGLARGY-----ADAEIG-----GWLQERLQLIHASSL----TA
RSMJ_SHIFL      RVRMLERNPVVAALLDDGLARGY-----ADAEIG-----GWLQERLQLIHASSL----TA
RSMJ_KLEP7      RVRMLERNPVVAALLDDGLARGY-----ADAEIG-----GWLQERLQLIHASSL----TA
RSMJ_CITK8      RVRMLERNPVVAALLDDGLARGY-----ADPEIG-----PWLQERLQLIHASSL----TA
RSMJ_SALA4      RVRMLERNPVVAALLDDGLTRGY-----ADADIG-----GWLQERLQLIHASSL----TA
RSMJ_SALAR      RVRMLERNPVVAALLDDGLARGY-----ADADIG-----PWLRQRLQLIHASSL----TA
RSMJ_ENT38      RVRMLERNPVVAALLDDGLARGY-----ADPEIG-----AWLQERLQLIHASSL----TA
RSMJ_CROS8      HVRMLERNPVVAALLDDGLARGY-----QDAEIG-----PWLRERLQLIHASSL----TA
RSMJ_ERWT9      RVRMLERNPVVAALLDDGLRRGY-----ADVEIG-----PWLRENLTLLHASSL----SA
RSMJ_PECAS      HVRMVERNPVVAALLDDGLKRGY-----QDAEIG-----PWLRERLTLLHASSM----TA
RSMJ_PECCP      RVRMVERNPVVAALLDDGLQRGY-----RDAEIG-----PWLQARLTLLHASSM----TA
RSMJ_YERE8      HVQMLERNPVVAALLDDGLRRGY-----QDAEIG-----PWLRERLTLLHASSL----TA
RSMJ_YERPE      QVQMLERNPVVAALLDDGLRRGY-----LDAEIG-----PWLRERLTLLHASSL----TA
RSMJ_SERP5      RVRMLERNPVVAALLDDGLQRGY-----QDAEIG-----PWLRERMTLLHASSL----TA
RSMJ_EDWI9      RVRMLERHPAVAALLDDGLQRGY-----ADAEIG-----PWLRERLTLLHASSI----EA
RSMJ_PHOLL      HVRMLERHPVVAALLDDGLQRGY-----QDEEIG-----GWLQQRMTLLHASSI----TA
RSMJ_PROMH      NVRMVERHPVVAALLEDGLKRAY-----LDADIG-----EWMQQRMKLIYASSA----QA
RSMJ_ACTPJ      KVLLVERNPIVAALLEDGLVRAY-----ADPEIG-----AFMQERMILADVRDI----SL
RSMJ_HAEDU      KVTLVERHPVIAALLEDGLTRAY-----LDAEIG-----EFMQQRMQLANVHNI----AQ
RSMJ_HAEPS      YVKLIERNPIVGALLEDGLQRAY-----KDLEIG-----HFMRERMVLLPHSSI----TG
RSMJ_HAES1      KVRLVERHPIVHLLLQDGLKRAY-----ADVEIG-----TMMQANMQLLDIAHI----QE
RSMJ_MANSM      RVRLVERHPVVYLLLQDGLRRAY-----ADPEIG-----EMMQKNMQLLPVHHI----TE
RSMJ_PASMU      RVRLVERHPVVRLLLQDGLQRAY-----ADSEIG-----EMLQQNMQLLPVSHI----AQ
RSMJ_ACTSZ      RVRLVERHPVVRLLLQDGLRRAY-----DDSEIG-----ESMRRNMQLLTVNHI----AE
RSMJ_HAEIE      QVRLVERHPVVFLLLQDGLNRAY-----QDEEIG-----EMLQQNLCLLNVHHI----NE
RSMJ_HAEIG      QVRLVERHPVVFLLLQDGLNRAY-----QDEEIG-----EILQQNLRLLNVHHI----NE
RSMJ_HAEIN      QVRLVERHPVVFLLLQDGLNRAY-----QDEEIG-----EMLQQNLHLLNVQHI----NE
RSMJ_AERHH      KVTMIERSPVVAALLQDGLARAA-----LDPEIG-----PWVRERMQLRHGPAV----ET
RSMJ_AERS4      KVTLIERSPVVAALLQDGLMRAA-----QDPEIG-----PWVSERMRLLQGPAV----DN
RSMJ_TOLAT      QVTMLERHPVVAALLADGLQRAQ-----QDSEIG-----GWMRERMSLRSGPAL----EN
RSMJ_ALISL      KVQMVERHPVVAALLDDGLSRAK-----HDADIG-----GWVSQRMSLLHASSH----DA
RSMJ_ALIF1      KVQMVERHPVVAALLDDGLARAK-----QDAEIG-----VWVAERMSLLHASSH----DA
RSMJ_VIBCB      KVQMVERHPVVAALLDDGLARAK-----HDPEIG-----TWVSERMSLIHASSH----DA
RSMJ_VIBPA      KVQMVERHPVVAALLDDGLARAK-----QDPEIG-----TWVSERMSLIHASSH----DA
RSMJ_VIBTL      KVQMVERHPVVAALLDDGLQRAQ-----KDPDIG-----GWVSERMKLIHASSH----DA
RSMJ_VIBVU      KVQMVERNPVVAALLDDGLTRAK-----KDDEIG-----AWVSERMSLLHASSH----DA
RSMJ_VIBCH      RVQMVERHPVVAALLEDGLQRAK-----QDDEIG-----AWVSERISLLHASSH----DA
RSMJ_PHOPR      TVQMVERHPVVAALLDDGLARAK-----QDPEIG-----GWITERLSLLHASSQ----DA
RSMJ_SHEB8      TVTMVERHPVVAALLEDGLRRAY-----QDAEIG-----DWMRERMRLFHGSSL----EA
RSMJ_SHEPC      TVTMVERHPVVAALLEDGLRRAY-----QDAEIG-----DWMHERMQLFHGSSL----EA
RSMJ_SHEON      TVTMVERHPVVAALLEDGLRRAY-----QDAEIG-----DWMRERMQLFHGSSL----EA
RSMJ_SHESA      TVIMVERHPVVAALLEDGLRRAY-----QDAEIG-----DWMRERMQLFHGSSL----EA
RSMJ_SHEDO      KVIMVERHPVVAALLEDGLRRAY-----DDAEIG-----AWMTERMSLFPGSSL----EA
RSMJ_SHEFN      KVIMVERHPVVAALLEDGLRRAY-----EDAEIG-----EWMRDLMSLFHGSSI----SA
RSMJ_SHEPA      KVLMVERHPIVAALLEDGLRRAY-----EDAEIG-----GWMQQRMSLFHGSSI----DS
RSMJ_SHEWM      NVTMVERHPVVAALLEDGLRRAY-----EDAEIG-----DWMRERMKLFHGSSI----DS
RSMJ_SHEHH      KVIMVERHPIVAALLEDGLRRGY-----EDTEIG-----DWMRERMSLFHGSSI----DS
RSMJ_SHEPW      KVIMVERHPVVAALLEDGLRRAY-----EDSEIG-----EWMNARMSLFHGSSI----DT
RSMJ_SHELP      NVTMVERNPVVAALLEDGLRRAY-----EDADIG-----PWMQERMRLVHGSSL----TA
RSMJ_SHESH      NVTMVERNPVVAALLEDGLRRAY-----ESEEIG-----DWMRERMRLVHGSSL----ES
RSMJ_SHEAM      RVLLIERHPVVAALLEDGLRRAY-----LDGEIG-----PWMQQRMQLVHGSSL----EA
RSMJ_PSEHT      KVILHERHPVVAALLYDGLQRAY-----NDIEIG-----PWMQQNMSLIFGSSH----TL
RSMJ_COLP3      KLTLLERMPVVAALLDDGIERAK-----LNHEVA-----DIANNMQLI-HGSSL----EE
RSMJ_PSYIN      NVTMIERSAVAAALLEDGLERAY-----LNLEIG-----TWMKQRMRL-HFGSA----SE
RSMJ_ALTMD      KVTMIERSPIVAALLEDGIRRLA-----LSFPE--------LAAKMSLQHGNSA----EV
RSMJ_PSEA6      RVDMIERSPVVAALLADGLERAH-----HSAELS-----AWLPQRMRLHHGIAV----DL
RSMJ_BUCAI      KVIMIERHPIVAALLKDGLQRGY-----QDKKIG-----HWLQTRLHLIVNDSL----KM
RSMJ_BUCAP      YVIMMEYHPVIAALLTDGLERGY-----KDEKIG-----FWLKKRLHLIYDNSL----NI
RSMJ_IDILO      NVQLIERHPVVAALLDNGLHRAQ-----KEHDFI-----GDTCLRMQLIGTDNL----FT
RSMJ_AGRFC      EVTLIERSPGMHAHLADGISRA-------LEAGG---AYAEAASRMTLLQGDS----RQL
RSMJ_OCHA4      KVTLIERSEKMHALLAEGLARA-------AEEGG---RYAETVARMTLLLGDS----SLL
RSMJ_RHOPS      TVTLIERSPQVHALLAQGLEAA-------RAESD---EIAAIVARMTLIHGDA----RAL
RSMJ_RHOP2      SVTLIERSPQVHALLAQGLAAA-------QAESA---ELAGVVARMTLIQGDA----RDL
RSMJ_RHOPA      TVTLIERVPEVHALLAEALEAA-------RAESD---ELAAIIGRMTLLHGDA----RVL
RSMJ_ALKEH      RVTLIERHPVIAALLADGLRRA-------RRS------HPELAARLHLVEADS----LQW
RSMJ_HALHL      RMTWIERSPVLAALLDAALERA-------RANA----QHADTATRVRLHPGDL----CHL
RSMJ_THISH      EVTLLEREPVIAALLADGLERA-------ARDA----DLAQTIARMHLVTGNA----RDW
RSMJ_CHRVO      RVTMVERSPVAAALLADALERA-------QRDE----TTRDIAARMTLVHANS----RNW
RSMJ_LARHH      RVTLVERSPVAAALLDDALARA-------RLDP----ATHEIAARMQLVFADA----ADW
RSMJ_NEIGO      TVTAFEQHPAVACLLSDGIRRA-------LLNP----ETQDTAARINLHFGNA----AEQ
RSMJ_NEIMA      AVTAFEQHPAVACLLSDGIRRA-------LLNP----ETQDTAAHINLHFGNA----AEQ
RSMJ_NITOC      PVRLIEQSPVIGALLEDGLARA-------RKTP----ETAPIIAQMTLMQANA----VDW
RSMJ_PSEAE      EVTLVERQPLIAALLEDGLERA-----RRDPDVA------PIAARMRLLGGNS----ADL
RSMJ_PSEA7      EVTLVERQPLIAALLEDGLERA-----RRDPDVA------PIAARMRLLGGNA----ADL
RSMJ_PSEMY      EMTLIERQPLIAALLEDGLQRA-----ELDLEVA------PIAARMRLLTGNA----IDL
RSMJ_PSEU5      EVSLIERQPLIAALLDDGLSRA-----AADADVA------AIAARMRLLEGNA----IEL
RSMJ_AZOVD      EVTLIERQPPIAALLEDGLARA-----VRDPEVA------PIVARMRLLPGDA----IAR
RSMJ_PSEP1      QMTLIERQPLIAALLEDGLARA-----RADEEVG------PIVGRMRLLTGNA----IER
RSMJ_PSEPW      QMTLIERQPLIAALLEDGLTRA-----RSDDEVG------PIVGRMRLLTGNA----IER
RSMJ_PSEPG      QMTLIERQPLIAALLEDGLARA-----RADEEVG------AIVGRMRLLTGNA----IER
RSMJ_PSEE4      QMTLIERQPLIAALLEDGLARA-----RGDLEVG------GIVERMRLLTGNA----IER
RSMJ_PSEPF      EMSLIERQPLIGALLEDGLARA-----AEDFDVA------PIVARMKLLKGNS----IEV
RSMJ_PSEFS      EMSLIERQPLIGALLEDGLARG-----ADDFEVA------PIVARMQLLKGNS----IDV
RSMJ_PSEF5      EMSLIERQPLIGALLEDGLARA-----AQDAEVG------PIVARMHLLKGNS----IEL
RSMJ_PSE14      ELSLIERQPIIAALLEDGLARG-----RDDRDVG------SIVARMHLLTGNS----IEI
RSMJ_PSEU2      DMSLIERQPIIAALLEDGLARG-----RGDRDVG------SIIARMRLLTGNS----IDL
RSMJ_PSESM      EMSLIERQPIIAALLEDGLARG-----RGDRDIG------PIIARMRLLTGNS----IEI
RSMJ_DECAR      NVRLIERHPVIAALLADGLQRA-----RLDPDVR------PIIERMHLQTGDA----IQL
RSMJ_CHRSD      EVLLIERVAAIYALLEDGLGRA-----SANAETA------EIAARMRVAQGDAA-RELAS
RSMJ_MARHV      QMTLFERNPIIHALLADGLYRA-----SLNEACA------PIVARMTLHSGNS----LDW
RSMJ_MARMS      SVSLCERVGFVRAMLEDGLYRA-----SFHHEVA------EIVANMSLLA-------IDI
RSMJ_CELJU      RLQMIERSPLVFALLRDGLARAHAFAHAQDRELL------QVVERMELAAQDS---KTYL
RSMJ_HAHCH      HVVMYERNPLVHALLADGLRRA-----LECADAA------SVVSRMTLHLGEAFNTFPDG
RSMJ_SACD2      RVTMIERSPVAYALLADGLKRG-----LLQAEEAGDDELLAILQRMTLVPNDGSDWMRDQ
RSMJ_COXBU      DVLMIERNPVIALLLRDGLERA------QSVEWF-------KSLKLELIEIDA-----QI
RSMJ_DESPS      RVTLCERSPIMYTLLQDGIERAR-----QDS------VMNKIMANLDLIHNNSK----QF
RSMJ_MAGMM      SMHWAERVPLMGLLLQEGLEQAH-----QDA------QRAEVARRVTLHQADAI----QL
RSMJ_HYDCU      QVTMIERSPIIAALLSDALNRAQ-----QTGVAE---DIQEIVKRLRLINDDAT----QY
RSMJ_BDEBA      SVIGVERSPVLYALLKEAFARTK-------------------KDSLKSYELHF----ADS
RSMJ_LEGPC      DVLMLERHPVMAALLADALSRRN-------------------EADIQKMCLSLI--ASDA
RSMJ_ALCBS      QVMLAERSPILHAMLADGLQRAP----------------ASLVANMQLLACADS-----K
RSMJ_FRAP2      RLVSLEKDCYIFVLLADTLNRAR-----QIPNLK------DIANQIELINIDAN----EY
RSMJ_FRATF      TLLTLEKDSYLYLLLKDALQRAQ-----QINYLK------EIANRITLINIDSN----EY
RSMJ_DICNV      QVTLCERQAYLYTLLAQAIELAK-----NTPETA------ATAAQLTLVYQDSC----QY
RSMJ_ACIB5      QIQLVERHPILFTLLEDSKAQAQ-----HDPFLS------QFMDRIQLIFADSA----SY
RSMJ_ACIAD      HVTLVERHPVLFTLLEDAKSKAE-----NDPFLS------KYMQRIHLIFQDAH----YY
RSMJ_PSYA2      QVTMLEQHPLMALLLLAEQQRMS-----TLPNWQ------KLMSRLHIINTDAL----SY
RSMJ_PSYCK      QVTMLEQQPLMALLLLVEQLRMS-----TLPNWQ------KLMSRLQIINTDAL----TY
                 :   *        *                                             

RSMJ_ECOLI      LTDITPR--------PQVVYLDPMFPHKQ-------KSALVKKEMRVFQSL--------V
RSMJ_SHIFL      LTDITPR--------PQVVYLDPMFPHKQ-------KSALVKKEMRVFQSL--------V
RSMJ_KLEP7      LTDITPR--------PQVVYLDPMFPHKQ-------KSALVKKEMRVFQSL--------V
RSMJ_CITK8      LTDITPR--------PQVVYLDPMFPHKQ-------KSALVKKEMRVFQSL--------V
RSMJ_SALA4      LTDITPR--------PQVVYLDPMFPHRQ-------KSALVKKEMRVFQSL--------V
RSMJ_SALAR      LTDITPR--------PQVVYLDPMFPHRQ-------KSALVKKEMRVFQSL--------V
RSMJ_ENT38      LTDITPR--------PQVVYLDPMFPHKQ-------KSALVKKEMRVFQSL--------V
RSMJ_CROS8      LEAITPR--------PDVVYLDPMFPHKQ-------KSALVKKEMRVFQSL--------V
RSMJ_ERWT9      LTDITPQ--------PDVVYLDPMYPHKQ-------KSALVKKEMRVFQSL--------V
RSMJ_PECAS      LRDITPP--------PDVVYLDPMFPHKQ-------KSALVKKEMRVFQSL--------V
RSMJ_PECCP      LRDITPP--------PDVVYLDPMFPHKQ-------KSALVKKEMRVFQSL--------V
RSMJ_YERE8      LAEIEPR--------PEVVYLDPMYPHRQ-------KSALVKKEMRVFQSL--------V
RSMJ_YERPE      LVAIEPR--------PEVVYLDPMYPHRQ-------KSALVKKEMRVFQSL--------V
RSMJ_SERP5      LGDIDPR--------PEVVYLDPMYPHKQ-------KSALVKKEMRVFQSL--------V
RSMJ_EDWI9      LATLTPR--------PEVVYLDPMFPHRQ-------KSALVKKDMRVFQAL--------V
RSMJ_PHOLL      LADITPQ--------PDVVYLDPMYPHKQ-------KSALVKKEMRVFQSL--------V
RSMJ_PROMH      LTQISPT--------PDVVYLDPMYPHKT-------KSALVKKEMRVFQSL--------V
RSMJ_ACTPJ      LDVAQQA--------ADVVYLDPMYPHKQ-------KSALVKKEMRVFQHL--------V
RSMJ_HAEDU      LDTTTQS--------ADVVYLDPMYPHKQ-------KSALVKKEMRVFQHL--------V
RSMJ_HAEPS      LNPDLDS--------VDVVYLDPMYPSKT-------KSALVKKEMQLFQQL--------V
RSMJ_HAES1      LNSSEEG--------ADVVYLDPMYPHKQ-------KSALVKKEMRIFQHL--------I
RSMJ_MANSM      LNPFEDF--------ADVVYLDPMYPHKQ-------KSALVKKEMRVFQYL--------V
RSMJ_PASMU      LNPALDC--------VDVVYLDPMYPHKP-------KSALVKKEMRVFQHL--------V
RSMJ_ACTSZ      LDPARDF--------ADAVYLDPMYPHKQ-------KSALVKKEMRVFQHL--------V
RSMJ_HAEIE      LDPNSDY--------ADVVYLDPMYPHKQ-------KSALVKKEMRVFQHL--------V
RSMJ_HAEIG      LDPNSDY--------ADVVYLDPMYPHKQ-------KSALVKKEMRVFQHL--------V
RSMJ_HAEIN      LDPNSDY--------ADVVYLDPMYPHKQ-------KSALVKKEMRVFQHL--------V
RSMJ_AERHH      LLGLTER--------PDVIYLDPMFPHKQ-------KSALVKKEMRVFQSL--------V
RSMJ_AERS4      LLALPER--------PDVIYLDPMFPHKQ-------KSALVKKEMRVFQSL--------V
RSMJ_TOLAT      LQQLGFT--------PDVVYLDPMFPHRQ-------KSALVKKEMRVFQSL--------V
RSMJ_ALISL      LEQLMAQDDF---VQPDVVYLDPMYPHPENKK----KSALVKKEMRVFQSL--------V
RSMJ_ALIF1      LEQLMAQDDF---VQPDVVYLDPMYPHPVNKK----KSALVKKEMRVFQSL--------V
RSMJ_VIBCB      LEQLAQDKDF---LQPDVVYLDPMYPHPENKK----KSALVKKEMRVFQSL--------V
RSMJ_VIBPA      LDQLAQDREF---VKPDVVYLDPMYPHPENKK----KSALVKKEMRVFQSL--------V
RSMJ_VIBTL      LDKLSNDPNF---EQPDVVYLDPMYPHPENKK----KSALVKKEMRVFQSL--------V
RSMJ_VIBVU      LAALASDAEF---VRPDVVYLDPMYPHPENKK----KTALVKKEMRVFQSL--------V
RSMJ_VIBCH      LQQLASDPNF---TSPDVVYLDPMYPHPENKK----KTALVKKEMRVFQSL--------V
RSMJ_PHOPR      LVKLLEDPDF---IAPDVVYLDPMYPH---KK----KSALVKKEMRVFQTL--------V
RSMJ_SHEB8      LSKLAQE--------IDVVYLDPMYPHRD-------KSALVKKEMRVFQSL--------V
RSMJ_SHEPC      LSKLEQE--------VDVVYLDPMYPHRD-------KSALVKKEMRVFQSL--------V
RSMJ_SHEON      LAKLEQG--------VDVVYLDPMYPHRD-------KSALVKKEMRVFQTL--------V
RSMJ_SHESA      LAKLEQE--------VDVVYLDPMYPHRD-------KSALVKKEMRVFQTL--------V
RSMJ_SHEDO      LAKITDA--------VDVVYLDPMYPHRD-------KSALVKKEMRVFQSL--------V
RSMJ_SHEFN      LADAAQSSGT----EIDVVYLDPMYPHRE-------KSALVKKEMRVFQTL--------V
RSMJ_SHEPA      LADAAKASNT----EVDVVYLDPMYPHRE-------KSALVKKEMRVFQSL--------V
RSMJ_SHEWM      LADAAHSSNT----EVDVVYLDPMYPHRE-------KSALVKKEMRVFQSL--------V
RSMJ_SHEHH      LADAPQASNT----EVDVVYLDPMYPHRE-------KSALVKKEMRVFQSL--------V
RSMJ_SHEPW      LADAANAAGT----EIDVVYLDPMYPHRE-------KSALVKKEMRVFQSL--------V
RSMJ_SHELP      LAELGEQ--------VDVVYLDPMYPHRE-------KSALVKKEMRVFQSL--------V
RSMJ_SHESH      VAELGEE--------IDVVYLDPMYPHRE-------KSALVKKEMRVFQSL--------V
RSMJ_SHEAM      LDNLEDK--------PDVVYLDPMYPHRE-------KSALVKKEMRVFQSL--------V
RSMJ_PSEHT      LAQCESM--------PDVVYLDPMFPHRE-------KSALVKKEMRVFQDL--------V
RSMJ_COLP3      VDLAIEP---------DVVYLDPMYPHRE-------KSAAVKKEMRIFQSL--------V
RSMJ_PSYIN      YLQHHQT---------GVVYLDPMFPHKK-------KSALVKKEMRVFQGV--------V
RSMJ_ALTMD      MQYFTGENVN-------AIYLDPMFPHKK-------KSALVKKEMRLFQQL--------L
RSMJ_PSEA6      MANWCNEPAN---LAPDVVYLDPMFPHRK-------KSAAVKKEMRLFQQL--------L
RSMJ_BUCAI      LEIPILQ--------PDVIYLDPMYPFH---H----KKSLPKKDMQFFRQL--------I
RSMJ_BUCAP      LNIPISQ--------PDVIYLDPMYPIN---K----KKSLPKKNMQFLRKL--------A
RSMJ_IDILO      GSGYTQE--------PDVVYLDPMYPKTG--K----QKAQVKKDMQMFQQL--------V
RSMJ_AGRFC      LKEL----------SPEVVVIDPMHPPRHN-------TALVKKEMRVLREL--------V
RSMJ_OCHA4      LPDL----------KPQVVLVDPMHPPRGN-------SALVKKEMRQIREI--------V
RSMJ_RHOPS      LPTL----------QADVVTVDPMHPARTK-------TALVKQEMRLLREM--------V
RSMJ_RHOP2      LPTL----------QADVVTVDPMHPERTK-------TALVKQEMRLLRDL--------V
RSMJ_RHOPA      LPTL----------QADVITIDPMHPPRTK-------TALVKQEMRLLRDL--------V
RSMJ_ALKEH      LAELTPAE------RPEVICLDPMYPAGST-------RGAVRKDLQALRELPD----WPG
RSMJ_HALHL      LPELDATS------R-EVVYIDPMYPDGST-------RGAVGRPAQVLRAL------HAD
RSMJ_THISH      LTALDEAP------RPDVIYLDPMYPHRDK-------SALVKKEMRVFRTL--------V
RSMJ_CHRVO      LAGLTEAQR------PDVVFVDPMFPDTDKK------SAAAKKDMQAFQQV--------I
RSMJ_LARHH      LAQQPAGS-------VDVVYLDPMFPDTGK-------SAAAKKEMQAFQVV--------V
RSMJ_NEIGO      MPALVKTQG-----KPDIVYLDPMYPERRK-------SAAVKKEMAYFHRL--------V
RSMJ_NEIMA      MPALVQTQG-----KPDIVYLDPMYPERRK-------SAAVKKEMTYFHRL--------V
RSMJ_NITOC      MGTLNAQDF------PDVVYLDPMYPERTK-------SALVKKEMRLLRIL--------A
RSMJ_PSEAE      MRAWDGEA-------PQVVYLDPMFPHRDKS-------ALVKKEMRLFRPL--------V
RSMJ_PSEA7      MRAWEGEA-------PQVVYLDPMFPHRDKS-------ALVKKEMRLFRPL--------V
RSMJ_PSEMY      MQNWQGEA-------PQVIYLDPMFPHRDKS-------ALVKKEMRLFRPF--------V
RSMJ_PSEU5      MQHWRGEP-------PQVIYLDPMFPHRDKS-------ALVKKEMRLFRPF--------V
RSMJ_AZOVD      MRQWPDEP-------PQVIYLDPMFPHRDKS-------ALVKKEMRLFRPL--------V
RSMJ_PSEP1      MRAWEGEA-------PQVIYLDPMFPHRDKS-------ALVKKEMRVFRPL--------V
RSMJ_PSEPW      MRNWEGEA-------PQVIYLDPMFPHRDKS-------ALVKKEMRVFRPL--------V
RSMJ_PSEPG      MRAWEGEP-------PQVIYLDPMFPHRDKS-------ALVKKEMRVFRPL--------V
RSMJ_PSEE4      MRAWEGEA-------PQVIYLDPMFPHRDKS-------ALVKKEMRVFRPL--------V
RSMJ_PSEPF      MRNWEGEP-------PQVIYLDPMFPHREKT-------ALVKKEMRLFRPL--------V
RSMJ_PSEFS      MRNWEGEP-------PQVIYLDPMFPHREKT-------ALVKKEMRLFRPL--------V
RSMJ_PSEF5      MRNWQGEP-------PQVIYLDPMFPHREKS-------ALVKKEMRLFRPL--------V
RSMJ_PSE14      IRGWTAEP-------PQVIYLDPMFPHREKN-------ALVKKEMRLFRPL--------V
RSMJ_PSEU2      IRAWTGEP-------PQVIYLDPMFPHREKT-------ALVKKEMRLFRPL--------V
RSMJ_PSESM      IRSWVEEP-------PQVIYLDPMFPHREKT-------ALVKKEMRLFRPL--------V
RSMJ_DECAR      MNAWEGDP-------PQVIYVDPMFPHREKS-------SLVKKEMSMLRPL--------V
RSMJ_CHRSD      LVARHDIA-------PQVVHLDPMFPHRDKS-------ALVKKEMRVFRDL--------A
RSMJ_MARHV      MNQAGPEA-------VDVVYLDPMFPHRDKS-------ALVKKEMQVFRQV--------V
RSMJ_MARMS      IDIDEQDR-------FDVVYLDPMYPHTDKS------SAAAKKEMAFFRDL--------V
RSMJ_CELJU      QGLAPEQF-------PDVIYLDPMFPERQKS-------ADVKKEMRAFHSI--------V
RSMJ_HAHCH      I---------------DVVYLDPMFPERRKS-------SAVKKEMQAFKDI--------V
RSMJ_SACD2      LASSDSEQ-------PDVVYLDPMFPEKSKK-------ALAKKEMQIFQEV--------V
RSMJ_COXBU      YLSTLKKQ-------FDVIYMDPMYPIRKKS-------ALVKKEMRILRRL--------V
RSMJ_DESPS      LENHGTN--------YHTIYMDPMYPHKKK-------SALNKKEMRVIRDL--------V
RSMJ_MAGMM      LQNMQEP--------PQVVYLDPMFPHEGK-------GSLPRKAMVQLRQL--------A
RSMJ_HYDCU      LTTQAPI--------CDVIYLDPMYPEKKK-------TAATKKEMQALQHL--------V
RSMJ_BDEBA      LQFLKQNKGL---LEVDAIYFDPMYPHKKK-------SALPKQEMVVFRDL--------V
RSMJ_LEGPC      ISFLHSLQEK---DYPDIIYIDPMHPERNK-------SALVKKEMQVLQQL--------I
RSMJ_ALCBS      IAEPSAL---------HAVYLDPMFPAREK-------SAAVKKDLQWLQRL------CPY
RSMJ_FRAP2      INTASISF--------DCIYIDPMFPQRNK-------SAKVKQGMQVLHDIA-----FND
RSMJ_FRATF      ILTTDKSF--------DCVYVDPMFPPRKK-------SAKVKQGMQILHQVG-----FND
RSMJ_DICNV      LRTTSTQF--------DAIYLDPMYPPRQK-------SAKVKKEMAILHILL-----DDE
RSMJ_ACIB5      LQQLDQ-----EEKTVDVVYLDPMFPQRDQNQQAIKKQAQVKKQMQLLHLLLP------E
RSMJ_ACIAD      LQQCNQ-----DDRKVDVIYLDPMFPQRDQHHQVIKKQAQVKKQMQLLHLLLP------E
RSMJ_PSYA2      FARFNNYLEADNEQAVDVVYLDPMFPEDSYQDSKTGKGAKVGKHMQALHQLVCPPTLDEE
RSMJ_PSYCK      FARFNNYLGNGNEQAIDVIYLDPMFPEDSYQDSKTGKGAKVGKHMQALHQLAHPPTLDEE
                                  : .***.*            .   :    :: .         

RSMJ_ECOLI      GPDLDADGLLEPARLLATKRVVVKRPDYA-PPLANV-ATPNAVVTKGHRFDIYAGTPV--
RSMJ_SHIFL      GPDLDADGLLEPARLLATKRVVVKRPDYA-PPLANV-ATPNAVVTKGHRFDIYAGTPV--
RSMJ_KLEP7      GPDLDADGLLAPARQLATKRVVVKRPDYA-PPLADV-ATPNAVVTKGHRFDIYAGTPA--
RSMJ_CITK8      GPDLDADGLLAPARQLATKRVVVKRPDYA-PPLADI-ATPNAVVTKGHRFDIYTGTALVE
RSMJ_SALA4      GPDLDADGLLEPARQLATKRVVVKRPDYA-PPLADV-ATPNAIVTKGHRFDIYAGTPLTE
RSMJ_SALAR      GPDLDADGLLEPARQLATKRVVVKRPDYA-PPLADI-ATPNAIVTKGHRFDIYAGTA---
RSMJ_ENT38      GPDLDADGLLEPARLLATKRVVVKRPDYA-PPLADV-ATTNAVTTKGHRFDIYSGTAEVS
RSMJ_CROS8      GPDLDADGLLAPARRLAIKRVVVKRPDYA-PPLGDV-ATPNAVVTKGHRFDIYTGTPA--
RSMJ_ERWT9      GADEDADGLLQPARTLAKKRVVVKRPDYA-PPLAGL-TTPNAVNTKSHRFDIYAPLTR--
RSMJ_PECAS      GADDDADALLEPARALAKKRVVVKRPDYA-PPLAGV-PAQSMLETKSHRFDFYLPV----
RSMJ_PECCP      GADDDADALLEPARALAKKRVVVKRPDYA-PPLAGV-PAQSMLETKSHRFDFYLPA----
RSMJ_YERE8      GADEDADGLLAPARALATKRVVVKRPDYA-EPLAGI-AAQAAVTTKSHRFDLYMPLL---
RSMJ_YERPE      GADNDADGLLAPARALATKRVVVKRPDYA-EPLAGV-AAQAAVVTKSHRFDIYPSSVTPP
RSMJ_SERP5      GSDDDADGLLEPARRLATKRVVVKRPDYA-PPLANV-QAHAASTTKSHRFDIYMPV----
RSMJ_EDWI9      GADDDADALLAPARRLATKRVVVKRPDYA-PPLAGV-ATPNATLTKSHRFDIYAPLA---
RSMJ_PHOLL      GADEDADSLLSPARVLAKRRVVVKRPDYA-EPLAGV-AASAAITTKNHRFDIYPC-----
RSMJ_PROMH      GADEDADALLAPAMALAKKRVVVKRPDYA-EPLNNQ-PAHASVTTKNHRFDIYPCI----
RSMJ_ACTPJ      GADLDSDNFFVPAKALARKRVVVKRPDYA-PFLAEQ-KPDFSQTTKNHRFDVYLSHLKSA
RSMJ_HAEDU      GADLDADQFLLPAKALATKRVVVKRPDYA-PPLAEQ-HPSFSQKTKNHRFDIYLSPLQKR
RSMJ_HAEPS      GCDLDSDDLLFPAQQLARKRVVVKRPNYA-LFLANK-KPDFCKETKKHRFDIYLSH----
RSMJ_HAES1      GADLDADMLLEPALLLAQKRAVVKRPDYA-DFLAKK-TPHFSHQTKNHRFDIYLKT----
RSMJ_MANSM      GADSDSNLLLEPALKLAKKRVVVKRPDYA-EFLAEK-APQFSRETKNHRFDIYSVNV---
RSMJ_PASMU      GADLDADNLLEPALALANKRVVVKRPDYA-PFLAQQ-SPHFSRETKNHRFDIYLTG----
RSMJ_ACTSZ      GTDSDADALLEPARKLARKRVVVKRPDYA-GFLAQT-PPHFSRETKNHRFDIYLPLI---
RSMJ_HAEIE      GADLDADELLLPALQLAKKRVVVKRPDYA-EFLCGK-QPHFSRETKNHRFDIYMGASQC-
RSMJ_HAEIG      GADLDADELLLPALQLAKKRVVVKRPDYA-EFLCGK-QPHFSRETKNHRFDIYMGASQC-
RSMJ_HAEIN      GADLDADELLLPALQLAKKRVVVKRPDYA-EFLCGK-QPHFSHETKNHRFDIYMGASQC-
RSMJ_AERHH      GPDLDADALLPAALAMADKRVVVKRPDYA-GWLNEH-KPSMAIETKSNRFDVYVMAALAG
RSMJ_AERS4      GPDLDADALLPAALQMADKRVVVKRPDYA-GWLNEH-KPSMAIETKSNRFDVYVMAALAA
RSMJ_TOLAT      GADLDADALLPAALAVAGKRVVVKRPDYA-GYLNEM-KPGMSIETKSNRFDVYVISR---
RSMJ_ALISL      GADNDADALLAPALLMATKRVVVKRPDYA-EWLDNQ-KPSMAIETKKNRFDVYVNAGMKS
RSMJ_ALIF1      GADNDADALLAPALSMATKRVVVKRPDYA-EWLDNQ-KPSMAIETKKNRFDVYVNAAMA-
RSMJ_VIBCB      GADLDADGLLAPAMALASKRVVVKRPDYA-DWLDEQ-KPSMAIETKKNRFDVYVKASMA-
RSMJ_VIBPA      GADLDADGLLEPALALATKRVVVKRPDYA-NWLNEQ-KPSMAIETKKNRFDVYVKASMA-
RSMJ_VIBTL      GADLDADGLFEPAMKLATKRVVVKRPDYA-AWLDEQ-KPSMAIETKKNRFDVYVKASMT-
RSMJ_VIBVU      GADTDADALLTPALALATKRVVVKRPDYA-EWLDGV-KPSMAIETKKNRFDVYVNASMS-
RSMJ_VIBCH      GADNDADALLEPALQLAQKRVVVKRPDYA-PWLGNR-KPSMAMETKKNRFDVYVIAAMSG
RSMJ_PHOPR      GADNDADSLFAPAMALATKRVVVKRPDYA-EFLANA-KPSTAIETKKNRFDVYVKAAMT-
RSMJ_SHEB8      GADLDADGLLAPALALATKRVVVKRPDYA-EDLDGV-KPNTVIETKKNRFDVYVKAAMK-
RSMJ_SHEPC      GADLDADGLLAPALALATKRVVVKRPDYA-EDLDGV-KPSMVIDTKKNRFDVYVKAAMK-
RSMJ_SHEON      GADLDADGLLAPAMALASKRVVVKRPDYA-EDLAGV-KPSMVIETKKNRFDVYVKSAMK-
RSMJ_SHESA      GADLDADGLLAPAMALASKRVVVKRPDYA-EDLAGV-KPSMVIETKKNRFDVYVKSAMK-
RSMJ_SHEDO      GADLDADGLLTPAMTLATKRVVVKRPDYA-EDLDGI-KPSMVIATKKNRFDVYIKAAMK-
RSMJ_SHEFN      GADLDADGLLAPAMALATKRVVVKRPDYA-EDLDGV-KPSMVIATKKNRFDVYVKSAMK-
RSMJ_SHEPA      GADLDADGLLAPAMALATKRVVVKRPDYA-DDLDGV-KPSMVIATKKNRFDVYVKAAMTA
RSMJ_SHEWM      GADLDADGLLAPAMALASKRVVVKRPDYA-EDLDGV-KPSMVIATKKNRFDVYVRAAMTA
RSMJ_SHEHH      GADLDADGLLAPAMALASKRVVVKRPDYA-DDLDGV-KPSMVIATKKNRFDVYVKAAMTA
RSMJ_SHEPW      GADLDADGLLKPAMELASKRVVVKRPDYA-EDLDGV-KPSTVIATKKNRFDVYVKAAMIS
RSMJ_SHELP      GADLDADGLLAPAMALASKRVVVKRPDYA-EDLDGV-KPNTRIETKKNRFDVYVKAAMKS
RSMJ_SHESH      GADLDADGLLAPATALATKRVVVKRPDYA-EDLDGV-KPSMVISTKKNRFDVYVKAAMKA
RSMJ_SHEAM      GADTDADGLLAPALRLAQKRVVVKRPDYA-EDLDGV-RPSTRIETKKNRFDVYVKAAMG-
RSMJ_PSEHT      GADTDADDLLEFAYPLASKRVVVKRPDYA-PFLNDK-TPSMQIKTKKNRFDVYVKAAMKK
RSMJ_COLP3      GEDLDADDLLEPALALAKYRVVVKRPSYA-PPLANK-KPSMSINMKKNRFDVYVKQAIPK
RSMJ_PSYIN      GEDLDADSLLEAALNAARYRVVVKRPDYA-PFLNDK-KPTMSIKTKKNRFDVYVKQAMPQ
RSMJ_ALTMD      GHDPDADALLPPALKLATHRVVVKRPNSA-DVLAGE-KPSMAIESKKHRFDVYLCQKP--
RSMJ_PSEA6      GPDEDADGLLAPALALAKKRVVVKRPAGA-PFLAQQ-KPHIEMQGKANRFDVYLIN----
RSMJ_BUCAI      GHNYDSKKLLEVSRKLAKNRIIVKRPYYA-KPLSED-KVNHIVTTRNHRFDIYQPF----
RSMJ_BUCAP      NKDDQSKNLLKVARKFAKKRVVVKRPSYA-NPISDE-KVDFIISNKYHRFDIYLPFKKK-
RSMJ_IDILO      GSDEDADTLLEPAIALAKYRVVVKRPNSA-PFLAGR-EPNSQIKSKKHRFDVYIKRGFHE
RSMJ_AGRFC      GSDPDQVELMEVALAHATKRVVLKWPLRA-DPMPGIRKPSHQIIGKNTRYDVFMIFGNSL
RSMJ_OCHA4      GTDPDAERLMQVALEAAQNRVVLKWPLRA-DPMVGLRKPSHQILGKSTRYDVFVKAKLS-
RSMJ_RHOPS      GADPDVADLMQAALVARCGRVVLKWPLRA-EPLAGIRKPSYQIAGKTVRYDVFVNPRAPA
RSMJ_RHOP2      GADPDVCELMQAALSARCGRVVLKWPLRA-EPLAGVRKPSYQIAGKTVRYDVFVLPRGAA
RSMJ_RHOPA      GADPDVGELLAAALSADCGRVVLKWPLRA-AAPPAARKPSHQIAGKTVRYDVYVRPRTT-
RSMJ_ALKEH      LAPVDEVALLALARASATARVVVKRPGRA-APLAGK-APDWQLPGRSTRFDVYRGLAGD-
RSMJ_HALHL      ARGPDEDQLLAAALGHATRRVVVKRPQRA-APVAGP-PPSRSVAGRAVRFDVYEVNG---
RSMJ_THISH      GDDQDAPETLEAALAVAKRRVVVKRPARA-EPLSGR-KPSHQIPGKTTRFDVYVTG----
RSMJ_CHRVO      GDDMDSAELLAAAIAAARVRVVVKRPRLG-AAIAGV-KPSAVLDGKSTRFDLYVIKALAS
RSMJ_LARHH      GDDLDAGRLLLVARQVAGKRVVVKRPRLG-ALLTGE-KPAGQQVGKSTRFDLYAPLPPAS
RSMJ_NEIGO      GEAQDEVVLLHTARQTAKKRVVVKRPRLG-EHLAGQ-APAYQYTGKSTRFDVYLPYGADK
RSMJ_NEIMA      GEAQDEAALLHTARQTAKKRVVVKRPRLG-EHLAGQ-APAYQYTGKSTRFDVYLPYGTDK
RSMJ_NITOC      GKDENAPLLLEVALECARQRVVVKRPRPG-VFLAGV-KPDFSIESKTTRFDIYLTH----
RSMJ_PSEAE      GDDLDAPALLQAALALASHRVVVKRPRKA-PIIEGP-KPGYSLEGKSSRYDIYPKKALGK
RSMJ_PSEA7      GDDLDAPALLEAALALASHRVVVKRPRKA-PVIDGA-KPGYSLDGKSSRYDIYPKKALNK
RSMJ_PSEMY      GDDLDAPALLAAALALASHRVVVKRPRKA-PAIEGT-KPGYVLEGKSSRYDVYPKKKLEG
RSMJ_PSEU5      GDDLDAPALLSAALELASHRVVVKRPRKA-PAIDGS-KPGYSLEGKSSRYDIYPKKKLQA
RSMJ_AZOVD      GDDPDAPALLEAALALASHRVVVKRPRKA-PSVAGP-RPGYSLEGKSSRYDIYARQSLKG
RSMJ_PSEP1      GDDLDAPALLEAALALASHRVVVKRPRKA-PIIDGP-KPSHSLEGKSSRYDIYPKKALKA
RSMJ_PSEPW      GDDLDAPALLEAALALASHRVVVKRPRKA-PIIDGP-KPSHSLEGKSSRYDIYPKKALKA
RSMJ_PSEPG      GDDLDAPALLEAALALASHRVVVKRPRKA-PIIDGP-KPSHSLEGKSSRYDIYPKKALKA
RSMJ_PSEE4      GDDLDAPALLEAALALASHRVVVKRPRKA-PIIEGV-KPSHSLEGKSSRYDIYPKKALKG
RSMJ_PSEPF      GDDPDAPALLEAALALATHRVVVKRPRKA-PCIEGP-KPSHALDGKSSRYDIYPKKALKA
RSMJ_PSEFS      GDDPDAPALLAAALALASHRVVVKRPRKA-PCIDGP-KPSHALDGKSSRYDIYPKKALKP
RSMJ_PSEF5      GDDNDAPALLAAALALASHRVVVKRPRKA-PCIEGP-KPSHGLEGKSSRYDIYPKKALKA
RSMJ_PSE14      GDDMDAPALLEAALALATHRVVVKRPRKA-PCIDGP-KPGYALDGKSSRYDIYPKKALKP
RSMJ_PSEU2      GDDMDAPALLEAALALATHRVVVKRPRKA-PCIDGL-KPGYALDGKSSRYDIYPKKALKP
RSMJ_PSESM      GDDMDAPALLAAALALATHRVVVKRPRKA-PCIDGP-KPGYALDGKSSRYDIYPRKALKP
RSMJ_DECAR      GDDLDASSLLEAALKLATHRVVVKRPRKA-PSVLGP-KVGYVLEGKSSRFDIYPKRSLKP
RSMJ_CHRSD      GDDDDAPRLLEAALDVASHRVVVKRPRRA-PPIEGP-APHHMLEGKTSRYDLYVHRSLKP
RSMJ_MARHV      GDDDDASQLLEAALGCARYRVVVKRPRKA-PAIAGP-EPAARVEGKSSRYDIYPIRALPA
RSMJ_MARMS      GKDLDADSLLAYALRLAEYRVVVKRPKGA-PFLDNS-EPTYQLEGKSGRFDIYVLKSLDS
RSMJ_CELJU      GTDEDADVLLPLALEHVRFRVVVKRPRKA-PFLNNQ-IPSYQLEGKSSRYDIYTRKKLPD
RSMJ_HAHCH      GADPDADELLAAALRQEVKRIVVKRPKGA-PCLLGR-EPSFTVTGKSGRFDVYALRKLTG
RSMJ_SACD2      GGDEDADKLFEPAFALAKYRVVVKRPKIA-PLLNGQ-EPSVQLVGKSSRFDVYAKKKLPE
RSMJ_COXBU      GADDDAPQLLALALKKAKHRVVIKRPRLS-NPLPGP-APDVVYEGKSSRFDVYLLKPSS-
RSMJ_DESPS      GDDNDSDNLLETALTVAGNRVVVKRPKGA-PYIEER-KPHHEITMKNSRFDVYLTSYL--
RSMJ_MAGMM      GEDQDLPQLFELAMATAEQRVVLKRPLKA-PLLTRA-KPNFQLKGRSTRFDVYATG----
RSMJ_HYDCU      GPDIDSETLLAAALHVAQKRVVVKRPKNA-PALTGI-QPNASIQSPNTRYDIYAIKALKA
RSMJ_BDEBA      GHDDDASLVLQEALTWPVKRVVVKRPMQAEELLPGV---RHSYEGKVVRYDTYVVG----
RSMJ_LEGPC      GTDYDAMELIKLSLSHVKSRVVVKWPQKVKPLLPP----DASIDGKTVRFDIYMPQFSSN
RSMJ_ALCBS      PDEVEEQQLLDWARALGASRVVVKRPVKA-GFLAGV-TPSFSQKGKAVRFDIYTCP----
RSMJ_FRAP2      D-ESNSNLLKNIIISKKTKKAVVKRPINA-DFLYGK-KPTSQLKGKTNRFDVYSL-----
RSMJ_FRATF      E-VSNSNLLDNIIQTQISPKAVVKRPINA-EFLSNK-KPSSQLKGKTNRFDIYSL-----
RSMJ_DICNV      AGDTAENLLLLQTARARCARVVVKRPHTA-PPLGNQ-VPRYCIDAPNTRFDVYLH-----
RSMJ_ACIB5      DGEMDLGDHLLELAKKVAKRVIVKRPRHA-IFLANQ-EPAHQWQGDACRFDAYFQ-----
RSMJ_ACIAD      DGEMDLGDQLLPLAQQIASRVVVKRPKHA-VFLNEQ-QPDHQWQGDACRFDAYFQISM--
RSMJ_PSYA2      QKLLQSAQTFVSQQAQKQGRVIVKRPQFA-PLLAHL-EPSESWSNEAVRFDGYFV-----
RSMJ_PSYCK      QQLLQSAQAVVSQNGQKQGRVIVKRPQFA-PSLADQ-QPSESWNNEAVRFDGYFV-----
                                   : ::* *                                  

RSMJ_ECOLI      ---------------
RSMJ_SHIFL      ---------------
RSMJ_KLEP7      ---------------
RSMJ_CITK8      ---------------
RSMJ_SALA4      ---------------
RSMJ_SALAR      ---------------
RSMJ_ENT38      AV-------------
RSMJ_CROS8      ---------------
RSMJ_ERWT9      ---------------
RSMJ_PECAS      ---------------
RSMJ_PECCP      ---------------
RSMJ_YERE8      ---------------
RSMJ_YERPE      R--------------
RSMJ_SERP5      ---------------
RSMJ_EDWI9      ---------------
RSMJ_PHOLL      ---------------
RSMJ_PROMH      ---------------
RSMJ_ACTPJ      ---------------
RSMJ_HAEDU      ---------------
RSMJ_HAEPS      ---------------
RSMJ_HAES1      ---------------
RSMJ_MANSM      ---------------
RSMJ_PASMU      ---------------
RSMJ_ACTSZ      ---------------
RSMJ_HAEIE      ---------------
RSMJ_HAEIG      ---------------
RSMJ_HAEIN      ---------------
RSMJ_AERHH      ---------------
RSMJ_AERS4      G--------------
RSMJ_TOLAT      ---------------
RSMJ_ALISL      ---------------
RSMJ_ALIF1      ---------------
RSMJ_VIBCB      ---------------
RSMJ_VIBPA      ---------------
RSMJ_VIBTL      ---------------
RSMJ_VIBVU      ---------------
RSMJ_VIBCH      E--------------
RSMJ_PHOPR      ---------------
RSMJ_SHEB8      ---------------
RSMJ_SHEPC      ---------------
RSMJ_SHEON      ---------------
RSMJ_SHESA      ---------------
RSMJ_SHEDO      ---------------
RSMJ_SHEFN      ---------------
RSMJ_SHEPA      ---------------
RSMJ_SHEWM      ---------------
RSMJ_SHEHH      ---------------
RSMJ_SHEPW      ---------------
RSMJ_SHELP      E--------------
RSMJ_SHESH      ---------------
RSMJ_SHEAM      ---------------
RSMJ_PSEHT      ---------------
RSMJ_COLP3      PIT------------
RSMJ_PSYIN      NKS------------
RSMJ_ALTMD      ---------------
RSMJ_PSEA6      ---------------
RSMJ_BUCAI      ---------------
RSMJ_BUCAP      ---------------
RSMJ_IDILO      SAN------------
RSMJ_AGRFC      DQQE-----------
RSMJ_OCHA4      ---------------
RSMJ_RHOPS      EEALPRADDLALFRF
RSMJ_RHOP2      EERAPGADAALNP--
RSMJ_RHOPA      ---------------
RSMJ_ALKEH      ---------------
RSMJ_HALHL      ---------------
RSMJ_THISH      ---------------
RSMJ_CHRVO      G--------------
RSMJ_LARHH      A--------------
RSMJ_NEIGO      G--------------
RSMJ_NEIMA      G--------------
RSMJ_NITOC      ---------------
RSMJ_PSEAE      G--------------
RSMJ_PSEA7      A--------------
RSMJ_PSEMY      A--------------
RSMJ_PSEU5      ---------------
RSMJ_AZOVD      ---------------
RSMJ_PSEP1      ---------------
RSMJ_PSEPW      ---------------
RSMJ_PSEPG      ---------------
RSMJ_PSEE4      ---------------
RSMJ_PSEPF      ---------------
RSMJ_PSEFS      ---------------
RSMJ_PSEF5      ---------------
RSMJ_PSE14      KAVTDDSGA------
RSMJ_PSEU2      KAATDESGA------
RSMJ_PSESM      KAVEPAPDL------
RSMJ_DECAR      ---------------
RSMJ_CHRSD      E--------------
RSMJ_MARHV      ---------------
RSMJ_MARMS      LSA------------
RSMJ_CELJU      ---------------
RSMJ_HAHCH      G--------------
RSMJ_SACD2      ---------------
RSMJ_COXBU      ---------------
RSMJ_DESPS      ---------------
RSMJ_MAGMM      ---------------
RSMJ_HYDCU      AGKL-----------
RSMJ_BDEBA      ---------------
RSMJ_LEGPC      ---------------
RSMJ_ALCBS      ---------------
RSMJ_FRAP2      ---------------
RSMJ_FRATF      ---------------
RSMJ_DICNV      ---------------
RSMJ_ACIB5      ---------------
RSMJ_ACIAD      ---------------
RSMJ_PSYA2      ---------------
RSMJ_PSYCK      ---------------