CLUSTAL format seed alignment for MF_01527_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GCH4_BACSU       ------------------------------------------MNQHTLLPKKTERLQYFG
GCH4_BACLD       ------------------------------------------MERKLHLPAKPERHRRFG
GCH4_ALKHC       -------------------------------------------MKTKQWPSKTERHKRFG
GCH4_OCEIH       -------------------------------------------MPKKQLPPKEERHKLFG
GCH4_EXIS2       -----------------------------------------MSTYPVTLPTKEERHKLFG
GCH4_STAAB       -------------------------------------------MTEFDLSTREGRWKHFG
GCH4_STAAC       -------------------------------------------MTEFDLSTREGRWKHFG
GCH4_STAAS       -------------------------------------------MTEFDLSTREGRWKHFG
GCH4_STAAW       -------------------------------------------MTEFDLSTREGRWKHFG
GCH4_STAA8       -------------------------------------------MTEFDLSTREGRWKHFG
GCH4_STAAE       -------------------------------------------MTEFDLSTREGRWKHFG
GCH4_STAAT       -------------------------------------------MTEFDLSTREGRWKHFG
GCH4_STAA3       -------------------------------------------MTEFDLSTREGRWKHFG
GCH4_STAA2       -------------------------------------------MTEFDLSTREGRWKHFG
GCH4_STAAN       -------------------------------------------MTEFDLSTREGRWKHFG
GCH4_STAA9       -------------------------------------------MTEFDLSTREGRWKHFG
GCH4_STAA1       -------------------------------------------MTEFDLSTREGRWKHFG
GCH4_STAAM       -------------------------------------------MTEFDLSTREGRWKHFG
GCH4_STAAR       -------------------------------------------MTEFDLSTREGRWKHFG
GCH4_STAHJ       -------------------------------------------MTEFDLSTREGRWKHFG
GCH4_STAES       -------------------------------------------MTEFDLSTREGRWKHFG
GCH4_STAEQ       -------------------------------------------MTEFDLSTREGRWKHFG
GCH4_STAS1       -------------------------------------------MTEFDLSTREGRWKHFG
GCH4_BURM7       ------------------------------------------------------------
GCH4_BURM9       ------------------------------------------------------------
GCH4_BURMS       ------------------------------------------------------------
GCH4_BURPS       ------------------------------------------------------------
GCH4_BURP6       ------------------------------------------------------------
GCH4_BURP0       ------------------------------------------------------------
GCH4_BURMA       ------------------------------------------------------------
GCH4_BURP1       ------------------------------------------------------------
GCH4_BURTA       ------------------------------------------------------------
GCH4_BURCM       ------------------------------------------------------------
GCH4_BURA4       ------------------------------------------------------------
GCH42_BURCA      ------------------------------------------------------------
GCH41_BURCH      ------------------------------------------------------------
GCH41_BURCC      ------------------------------------------------------------
GCH42_BURL3      ------------------------------------------------------------
GCH4_BURVG       ------------------------------------------------------------
GCH4_BURM1       ------------------------------------------------------------
GCH4_PARXL       ------------------------------------------------------------
GCH4_PARP8       ------------------------------------------------------------
GCH4_CUPNH       ------------------------------------------------------------
GCH4_CUPPJ       ------------------------------------------------------------
GCH42_CUPMC      ------------------------------------------------------------
GCH4_RALSO       ------------------------------------------------------------
GCH4_HERAR       ------------------------------------------------------------
GCH4_JANMA       ------------------------------------------------------------
GCH4_NEIMB       -------------------------------MQLLKASDIISHLQIDGIFPGGNAIPCTH
GCH4_NEIMF       -------------------------------MQLLKASDIISHLQIDGIFPGGNAIPCTH
GCH4_NEIMA       -------------------------------MQLLKASDIISHLQIDGIFPGGNAIPCTH
GCH4_NEIM0       -------------------------------MQLLKASDIISHLQIDGIFPGGNAIPCTH
GCH4_NEIG1       ------------------------------------------------------------
GCH4_BORA1       ------------------------------------------------------------
GCH4_BORPD       ------------------------------------------------------------
GCH4_BORBR       ------------------------------------------------------------
GCH4_BORPA       ------------------------------------------------------------
GCH4_BORPE       ------------------------------------------------------------
GCH4_POLAQ       ------------------------------------------------------------
GCH4_METPP       ------------------------------------------------------------
GCH41_DECAR      ------------------------------------------------------------
GCH4_DICNV       ------------------------------------------------------------
GCH4_ALKEH       ------------------------------------------------------------
GCH4_HALHL       ------------------------------------------------------------
GCH4_NITOC       ------------------------------------------------------------
GCH4_METCA       ------------------------------------------------------------
GCH4_AZOSB       ------------------------------------------------------------
GCH4_AROAE       ------------------------------------------------------------
GCH4_METFK       ------------------------------------------------------------
GCH4_THIDA       ------------------------------------------------------------
GCH42_DECAR      ------------------------------------------------------------
GCH4_NITEU       ------------------------------------------------------------
GCH4_NITEC       ------------------------------------------------------------
GCH4_NITMU       ------------------------------------------------------------
GCH4_RUTMC       ------------------------------------------------------------
GCH4_VESOH       ------------------------------------------------------------
GCH4_GEOMG       ------------------------------------------------------------
GCH4_GEOSL       ------------------------------------------------------------
GCH4_GEOUR       ------------------------------------------------------------
GCH4_PELPD       ------------------------------------------------------------
GCH4_SYNC1       ------------------------------------------------------------
GCH4_SYNAS       ------------------------------------------------------------
GCH4_SYNFM       ------------------------------------------------------------
GCH4_DESOH       ------------------------------------------------------------
GCH4_MAGMM       ------------------------------------------------------------
GCH4_AKKM8       ------------------------------------------------------------
GCH4_THEMA       ------------------------------------------------------------
GCH4_THESQ       ------------------------------------------------------------
GCH4_THEP1       ------------------------------------------------------------
GCH4_CALS8       ------------------------------------------------------------
GCH4_THEM4       ------------------------------------------------------------
GCH4_FERNB       ------------------------------------------------------------
GCH4_PSELT       ------------------------------------------------------------
GCH4_DESVH       ------------------------------------------------------------
GCH4_DESVV       ------------------------------------------------------------
GCH4_OLEA2       ------------------------------------------------------------
GCH4_LAWIP       ------------------------------------------------------------
GCH4_DESPS       ------------------------------------------------------------
GCH41_BURCA      ------------------------------------------------------------
GCH42_BURCH      ------------------------------------------------------------
GCH42_BURCC      ------------------------------------------------------------
GCH41_BURL3      ------------------------------------------------------------
GCH4_DELAS       ------------------------------------------------------------
GCH41_CUPMC      ------------------------------------------------------------
GCH4_PSEP1       ------------------------------------------------------------
GCH4_PSEPK       ------------------------------------------------------------
GCH4_PSE14       ------------------------------------------------------------
GCH4_PSEU2       ------------------------------------------------------------
GCH4_PSESM       ------------------------------------------------------------
GCH4_XANAC       ------------------------------------------------------------
GCH4_XANC5       ------------------------------------------------------------
GCH4_XANOR       ------------------------------------------------------------
GCH4_XANOM       ------------------------------------------------------------
GCH4_XANOP       ------------------------------------------------------------
GCH4_XANCP       ------------------------------------------------------------
GCH4_XANC8       ------------------------------------------------------------
GCH4_XANCB       ------------------------------------------------------------
GCH4_XYLFT       ------------------------------------------------------------
GCH4_XYLF2       ------------------------------------------------------------
GCH4_XYLFM       ------------------------------------------------------------
GCH4_XYLFA       ------------------------------------------------------------
GCH4_ACIAD       ------------------------------------------------------------
GCH4_COLP3       ------------------------------------------------------------
GCH4_IDILO       ------------------------------------------------------------
GCH4_PSYIN       ------------------------------------------------------------
GCH4_PSET1       ------------------------------------------------------------
GCH4_HYDCU       ------------------------------------------------------------
GCH4_ALCBS       ------------------------------------------------------------
GCH4_PSEAE       ------------------------------------------------------------
GCH4_PSEAB       ------------------------------------------------------------
GCH4_PSEA7       ------------------------------------------------------------
GCH4_PSEF5       ------------------------------------------------------------
GCH4_PSEPF       ------------------------------------------------------------
GCH4_PSEMY       ------------------------------------------------------------
GCH4_PSEPG       ------------------------------------------------------------
GCH4_PSEPW       ------------------------------------------------------------
GCH4_PSEE4       ------------------------------------------------------------
GCH4_CHRSD       ------------------------------------------------------------
GCH4_CITK8       ------------------------------------------------------------
GCH4_KLEPN       ------------------------------------------------------------
GCH4_SERP5       ------------------------------------------------------------
GCH4_HAHCH       ------------------------------------------------------------
GCH4_PSEA6       ------------------------------------------------------------
GCH4_BDEBA       ------------------------------------------------------------
GCH4_ROSDO       MNIHTPGLELTPDRDEAQAALDVLRQWAKQATPAEISELDPSVARLVPGMDGVEYPALSR
GCH4_RUEPO       MNLHPRDIDETPDRDAAAAALAVLRRWASGATSTEISELDPSVARLLPDAALSNYPDLSR
GCH4_DINSH       MNVYTPDIDKLPNRDEAATALATLRAWAQTASAAEIETLDPSVARLLPG-DPSDYPSLAR
GCH4_CERS4       MNILTPVAERLPSREEAEEALAVLRRWATHTPASDVAALAPEAP-------ALVYPDLSR
GCH4_CERS1       MNILTPVAERLPSREEAEEALAVLRRWATHTPASDVAALAPEAP-------ALVYPDLSR
GCH4_CERS5       MNILTPVADRLPSREEAEEALAVLRRWAKHTPVSDVAGLAPDVP-------ALVYPEFSR
GCH4_RUEST       MNIHSRDVNETPDRSDAEQALAVLRRWAGEASETEVAQLDPAIARLLPGQELQNYPDLKR
GCH4_JANSC       MNVHVKTADQTPSTVQAQDALAILSAWASEASADQIDALDPGIAR---LVRVQAYPDLRA
GCH4_PARDP       ---------------------------MTEARP---------------VATERAYPALSR
GCH4_OPITP       --------------MSKKKKSMYLHESAS-GAA----------------------PKIQR
                                                                             

GCH4_BACSU       SVSPIKGEKPVEKEKMKDLQNIRKDYF----FDIQHVGVANVSHPVTITSAMMPAEQTTA
GCH4_BACLD       SVEAVKGIKPTDKEQMKDIQNTPNDYF----FDIDHVGVSNVSHPILIASSLKPFTQTTI
GCH4_ALKHC       SVPPVAGKKPIHKEEMADLQNMPNDFL----FALDSVGIHNVKHPCIIQSNLKPYEQTTV
GCH4_OCEIH       SVPPKERTKPIEKNKMADLQNTKRDFL----FKLDAVGISNVKYPVIIHSDLAPKEQTSI
GCH4_EXIS2       SVPPIKGTKPTEKDKMIDLQNTPKNFL----FALDAVGISNVKHPVVIQDG--ETTQATI
GCH4_STAAB       SVDPIEGTKPTTKNEMTDLQSTHKDFL----FEIEEVGIKNLVYPVLVDQY------QTA
GCH4_STAAC       SVDPIEGTKPTTKNEMTDLQSTHKDFL----FEIEEVGIKNLVYPVLVDQY------QTA
GCH4_STAAS       SVDPIEGTKPTTKNEMTDLQSTHKDFL----FEIEEVGIKNLVYPVLVDQY------QTA
GCH4_STAAW       SVDPIEGTKPTTKNEMTDLQSTHKDFL----FEIEEVGIKNLVYPVLVDQY------QTA
GCH4_STAA8       SVDPIEGTKPTTKNEMTDLQSTHKDFL----FEIEEVGIKNLVYPVLVDQY------QTA
GCH4_STAAE       SVDPIEGTKPTTKNEMTDLQSTHKDFL----FEIEEVGIKNLVYPVLVDQY------QTA
GCH4_STAAT       SVDPIEGTKPTTKNEMTDLQSTHKDFL----FEIEEVGIKNLVYPVLVDQY------QTA
GCH4_STAA3       SVDPIEGTKPTTKNEMTDLQSTHKDFL----FEIEEVGIKNLVYPVLVDQY------QTA
GCH4_STAA2       SVDPIEGTKPTTKNEMTDLQSTHKDFL----FEIEEVGIKNLVYPVLVDQY------QTA
GCH4_STAAN       SVDPIEGTKPTTKNEMTDLQSTHKDFL----FEIEEVGIKNLVYPVLVDQY------QTA
GCH4_STAA9       SVDPIEGTKPTTKNEMTDLQSTHKDFL----FEIEEVGIKNLVYPVLVDQY------QTA
GCH4_STAA1       SVDPIEGTKPTTKNEMTDLQSTHKDFL----FEIEEVGIKNLVYPVLVDQY------QTA
GCH4_STAAM       SVDPIEGTKPTTKNEMTDLQSTHKDFL----FEIEEVGIKNLVYPVLVDQY------QTA
GCH4_STAAR       SVDPIEGTKPTTKNEMTDLQSTHKDFL----FEIEEVGIKNLVYPVLVDQY------QTA
GCH4_STAHJ       SVDPIEGTKPTTKNEMTDLQSTHKNFL----FEIEEVGIKNLIYPVNIDRF------QTA
GCH4_STAES       SVDPVKGTKPTTKNEMTDLQSTHKNFL----FEIEEVGIKNLTYPVLIDQY------QTA
GCH4_STAEQ       SVDPVKGTKPTTKNEMTDLQSTHKNFL----FEIEEVGIKNLTYPVLIDQY------QTA
GCH4_STAS1       SVDPIEGTKPTIKEEMKDLQSTHKNFL----FEIEEVGIKNLVYPVLVDRF------QTA
GCH4_BURM7       ----MNL-MNP-EFAMPDVQSTVDTRQ----MPIQRVGVRAVRHPLTVRTAEGE-TQATV
GCH4_BURM9       ----MNL-MNP-EFAMPDVQSTVDTRQ----MPIQRVGVRAVRHPLTVRTAEGE-TQATV
GCH4_BURMS       ----MNL-MNP-EFAMPDVQSTVDTRQ----MPIQRVGVRAVRHPLTVRTAEGE-TQATV
GCH4_BURPS       ----MNL-MNP-EFAMPDVQSTVDTRQ----MPIQRVGVRAVRHPLTVRTAEGE-TQATV
GCH4_BURP6       ----MNL-MNP-EFAMPDVQSTVDTRQ----MPIQRVGVRAVRHPLTVRTAEGE-TQATV
GCH4_BURP0       ----MNL-MNP-EFAMPDVQSTVDTRQ----MPIQRVGVRAVRHPLTVRTAEGE-TQATV
GCH4_BURMA       --------MNP-EFAMPDVQSTVDTRQ----MPIQRVGVRAVRHPLTVRTAEGE-TQATV
GCH4_BURP1       --------MNP-EFAMPDVQSTVDTRQ----MPIQRVGVRAVRHPLTVRTAEGE-TQATV
GCH4_BURTA       ----MNL-MNP-EFVMPDVQSTVDTRQ----MPIQRVGVRAVRHPLTVRTAEGE-TQATV
GCH4_BURCM       ----MNQ-MNP-AFVMPDVQSTVDTRQ----IPIQRVGVKAVRHPLTVRTESGD-VQPTV
GCH4_BURA4       ----MNQ-MNP-AFVMPDVQSTVDTRQ----IPIQRVGVKAVRHPLTVRTESGD-VQPTV
GCH42_BURCA      ----MNQ-MNP-AFVMPDVQSTVDTRQ----IPIQRVGVKAVRHPLTVCTESGD-VQPTV
GCH41_BURCH      ----MNQ-MNP-AFVMPDVQSTVDTRQ----IPIQRVGVKAVRHPLTVCTESGD-VQPTV
GCH41_BURCC      ----MNQ-MNP-AFVMPDVQSTVDTRQ----IPIQRVGVKAVRHPLTVCTESGD-VQPTV
GCH42_BURL3      ----MNQ-MNP-AFVMPDVQSTVDTRQ----IPIQRVGVKAVRHPLTVCTESGD-VQPTV
GCH4_BURVG       ----MNQ-MNP-AFVMPDVQSTVDTRQ----IPIQRVGVKAVRHPLTVCTESGD-VQPSV
GCH4_BURM1       ----MNQ-MNP-AFVMPDVQSTVDTRQ----IPIQRVGVKAVRHPLTVLTESGD-VQPTV
GCH4_PARXL       ----MNQ-MNP-AFVMPDVQSTPDTRQ----IPIQRVGVKAVRHPLTVRTQGGE-VQPTV
GCH4_PARP8       ----MNQ-MNP-AFVMPDVQSTVDTRQ----IPIQRVGVKAVRHPLTVRTPDGS-AQPTV
GCH4_CUPNH       ----MND-INP-AFVMPDVQSSPDTRQ----IPIQRVGVKGVRYPVTLKTPAG--IMPSV
GCH4_CUPPJ       ----MND-INP-AFVMPDVQSSRDTRQ----IPIQRVGVKGVRYPVSLKTPAG--VVPSV
GCH42_CUPMC      ----MND-INP-AFVMPDVQSSVDTRQ----IVIQRVGVKGVRYPLTLKTPAG--AVGTV
GCH4_RALSO       ----MND-MNP-GFVMPDVQSSHDTRQ----IPIQRVGVRGVRYPMSLQTPSG--VLSTV
GCH4_HERAR       ------------MSAIPDVQSTPDTRN----IVIQRVGVKGVRYPITVKTSSG--VQPSV
GCH4_JANMA       ----MNT-RDPGLAAIPDVQATPDTRR----IAIQRVGVKGVRYPLTVKTLSG--VQPSV
GCH4_NEIMB       LNNYMNIKEKQLMNTIADVQSSRDLRN----LPINQVGIKDLRFPITLQTAEG--IQSTI
GCH4_NEIMF       LNNYMNIKEKQLMNTIADVQSSRDLRN----LPINQVGIKDLRFPITLQTAEG--IQSTI
GCH4_NEIMA       LNNYMNIKEKQLMNTIADVQSSRDLRN----LPINQVGIKDLRFPITLQTAEG--IQSTV
GCH4_NEIM0       LNNYMNIKEKQLMNTIADVQSSRDLRN----LPINQVGIKDLRFPITLQTAEG--IQSTI
GCH4_NEIG1       ------------MNAIADVQSSRDLRN----LPINQVGIKDLRFPITLKTAEG--TQSTV
GCH4_BORA1       ----MNS-PIDPAIVMPDVQSSADTRH----IQIQRVGIRGVRHPMLVVAGDGS-AQATV
GCH4_BORPD       ----MNS-PIDPALVMPDVQSSADTRH----IPIQRVGIRGVRHPMLVAGADGA-PQPTV
GCH4_BORBR       ----MNS-PIDPAIVMPDVQSSTDTRH----IPIQRVGIRGVRHPMLVLAGDGA-AQPTV
GCH4_BORPA       ----MNS-PIDPAIVMPDVQSSTDTRH----IPIQRVGIRGVRHPMLVLAGDGA-AQPTV
GCH4_BORPE       ----MNS-PIDPAIVMPDVQSSTDTRH----IPIQRVGIRGVRHPMLVLAGDGA-AQPTV
GCH4_POLAQ       ----MNP-AFLKASAMPDVQSSRDERA----LPIEQVGIRGVRHPLMIRSNTG--NFPSV
GCH4_METPP       ---MTHASALGLTQHIPDTQSERDERH----LAIQRVGVKEVRYPLTVRIGEQ--LSPTV
GCH41_DECAR      ----MNA---PENIFLPDVQAAADTRR----LAIQSVGVKGLRYPLQLENAAGE-LTSTV
GCH4_DICNV       ----MTE------TAIPDVQSSPDKRH----IAINRVGIRDLRLPLFIENAAGE-AMPTV
GCH4_ALKEH       ----MPEAEKLATVSIEDVQARQDSRR----IPINKVGIKDIRHPVRVGGRDGQ-EQHTV
GCH4_HALHL       ---------------MEDVQGRADTRQ----IEINKVGIKDIRHPVRVRDRTGR-DQHTV
GCH4_NITOC       ----MNPIVPAVERPIEDVQAKADERQ----IAINKVGIKDIRHPVRVSDRNGG-EQHTV
GCH4_METCA       --------MEEEGLAIDDVQGRADLRR----IDIDRVGIKGIRHPVRVRDRSLG-EQHTV
GCH4_AZOSB       ----MNS---PLAHAIPDVQNSEDSRQ----IAINKVGIKSIRHPVKVSDKNGG-VQHTV
GCH4_AROAE       ----MTS---QQAHAIPDVQNLNDSRK----LAIDKVGIKSIRHPVRVSDKNGG-VQHTI
GCH4_METFK       ----MNQ---PSIPPIEDVQNTPDTRQ----LAIDKVGIKSIRHPVKVKDKTGG-VQHTV
GCH4_THIDA       ----MNEIC-DTAVCMPDVQSSADTRQ----IAIDKVGIKSIRHPVRVADKADG-VQHTI
GCH42_DECAR      ----MST----PTSNIPDVQNSADTRH----IAINKVGIKSIRHPIKVQDKSAG-IQHTI
GCH4_NITEU       ----MNK---QIDLPIADVQGSLDTRH----IAIDRVGIKAIRHPVVVADKGGG-SQHTV
GCH4_NITEC       ----MKK---HTDQPIADVQGSPDTRH----IAIDRVGIKAIRHPVLVADKDGG-SQHTV
GCH4_NITMU       ----MNK------MLIADVQSVADTRR----IAIDKAGIRAIRHPVRIMDK-AG-VQHTV
GCH4_RUTMC       ----MSA------IHLPDTQNSADTRQ----IIIDKVGIKDITHPITYIDCDGN-KIPTI
GCH4_VESOH       ----MSA------THLPDTQNSADTRH----IIIDKVGIKDIIHPITYIDCDGN-KMPTI
GCH4_GEOMG       ------------MTTMPDMQKTSDTRK----IPINKVGVKDISYPIVVMDKNKK-FQQTV
GCH4_GEOSL       ---------------MPDMQTSRDTRK----IPISKVGVKDISYPIVVMDKNRK-FQQTV
GCH4_GEOUR       ---------------MSDVQKSRDTRN----IPISKVGVKDISYPIVIMDKNKS-IQHTV
GCH4_PELPD       ---------------MPDMQKRPDHRR----IPISKVGVKDISYPIVVMDKNRS-LQHTV
GCH4_SYNC1       ---------------MRDMQMERDTRN----IAIDKVGVKDIRYPIVVMDKNKD-QQHTV
GCH4_SYNAS       ---------------MIDIQNLEDHRK----INIQKVGVKGINYPIVVLDKAKG-TQHVN
GCH4_SYNFM       ---------------MIDVQSRFDSRN----IRVDKVGVKDIRYPITVMDKTNG-IQHTV
GCH4_DESOH       ---------------MKDIQKERDFRN----MPIDKVGIKNLKYPIRVLDRKNG-CQQTV
GCH4_MAGMM       --------MNNCQLPLSDVQSRQDHRR----LDIDKVGVKNIRYPIVVKDRSVG-SQSTT
GCH4_AKKM8       ------------MQELKDTQSEADTRN----ISIDRVGVKGLRFPIQIQDKLNR-IQSTV
GCH4_THEMA       ---------------MKDVQNEKDPRM----VPLKKVGIKDLHWPLKVILKEDG-YQSTV
GCH4_THESQ       ---------------MKDVQNEKDPRM----VPLKKVGIKDLHWPLKVILKEDG-YQSTV
GCH4_THEP1       ---------------MKDVQNEKDPRM----VPLKKVGIKDLHWPLKVILKEDG-YQSTV
GCH4_CALS8       ---------------MIDVQSQKDLRG----IAIQKVGIKDLNWPIVVMDRANK-TQTTI
GCH4_THEM4       ---------------MKDVQSEKDTRE----IPLKHVGIKKLKYPVQVLDRENK-VQNTV
GCH4_FERNB       --------------MLKDVQNERDNRN----IYLKRVGVKDLRYPIVVLDRTNV-TQNTI
GCH4_PSELT       ---------------MKDVQNQPDNRN----IYLQRVGIRNLQYPVTVMDRNNG-YQDTV
GCH4_DESVH       ---------------MEDVQNSPAQVA----MPIDRVGVKNLQLPLVVSDRAQG-RQHTV
GCH4_DESVV       ---------------MEDVQNSPAQVA----MPIDRVGVKNLQLPLVVSDRAQG-RQHTV
GCH4_OLEA2       ---------------MEDVQNSPSQVP----LAIDTVGVKSLHLPLIVSDRANG-HQHTV
GCH4_LAWIP       ---------------MKDIQSTPAQIA----FPIDRVGVKGLKFPIQIQTRDIG-MQHTV
GCH4_DESPS       ---------------------MSKKQS----TICQKVGIADLEIPIILGQKDGK-LQHSI
GCH41_BURCA      -MEKALHRISSMNAALPDISLTDAAPG---RRPLEWVGMQGIDLPVVVAEPG-C-RRDVH
GCH42_BURCH      -MEKALHRISSMNAALPDISLTDAAPG---RRPLEWVGMQGIDLPVVVAEPG-C-RRDVH
GCH42_BURCC      -MEKALHRISSMNAALPDISLTDAAPG---RRPLEWVGMQGIDLPVVVAEPG-C-RRDVH
GCH41_BURL3      -MEKALHRISSMNAPLPDISLTDAAPG---GRPLEWVGMQGIDLPVAVAEPG-C-RRDVH
GCH4_DELAS       -----------MLAPLPDVSLTDPAPS---LSPLQWVGMQGIDLPVTVAEPG-Y-WRELH
GCH41_CUPMC      -----------MSAALPDVSLTEASPT---FTPLEWVGMQGIDLPIRLVEPG-Y-RRQLH
GCH4_PSEP1       -----------MSSALPDVSVTDLTHS---LSPLQWVGMQGIDLPVRIEEPT-Y-QRELH
GCH4_PSEPK       -----------MSSALPDVSVTDLAPS---LSPLQWVGMQGIDLPVRIQEPT-Y-QRELH
GCH4_PSE14       -----------MNNPLPDVALTEVSSA---LVSLDWVGMQGVEVPVRLAEAG-V-RYPVH
GCH4_PSEU2       -----------MNKPLPDVALTEISPA---LVSLDWVGMQGVEVPIRLAEAS-I-RHPVH
GCH4_PSESM       -----------MNSPLPDVALTEVSSA---LIALDWVGMQGVEVPLTLGEQG-A-THPVH
GCH4_XANAC       -----------MSPTLPDVAVTEPSTL---SAPLRWVGMQDIAIPVQLETG--S-SQ-LA
GCH4_XANC5       -----------MSATLPDVAVTEPSTL---SAPLRWVGMQDIAIPVQLEAG--G-GQ-LA
GCH4_XANOR       -----------MSATLPDVAVTEAFTL---SAPLRWVGMQDIAIPVHLDAA--S-GSGLA
GCH4_XANOM       -----------MSATLPDVAVTEAFTL---SAPLRWVGMQDIAIPVHLDAA--S-GSGLA
GCH4_XANOP       -----------MSATLPDVAVTEAFTL---SAPLRWVGMQDIAIPVHLDAA--S-GSGLA
GCH4_XANCP       -----------MSTTLPDIAVTEPSAL---HAPLRWVGMQDIAIPVRLDEAE-P-SGTVA
GCH4_XANC8       -----------MSTTLPDIAVTEPSAL---HAPLRWVGMQDIAIPVRLDEAE-P-SGTVA
GCH4_XANCB       -----------MSATLPDIAVTEPSAL---HAPLRWVGMQDIAIPVRLDEAE-P-SGTVA
GCH4_XYLFT       -----------MSTSIPDVAVHDSPAI---AAPLRWVGMDGIVVPVQLTTAD-G-GQHVI
GCH4_XYLF2       -----------MSTSIPDVAVHDSPAI---AAPLRWVGMDGIVVPVQLTTAD-G-GQHVI
GCH4_XYLFM       -----------MSTSIPDVAVHDSPAI---AAPLRWVGMDGIVVPVQLTIAD-G-GQHVI
GCH4_XYLFA       -----------MSTSIPDVAVHDSPAV---AAPLRWVGMDGIVVPVQLTTAD-G-GQHVI
GCH4_ACIAD       -----------MNAQLPDVSVSQLPCN---LSPLNWVGMQHIDLPTVIDTA----NQTVN
GCH4_COLP3       -----------MTTSMPDIANHTTAQT---EGTLDWVGMSNIEMPIMVASKGES-ERMVS
GCH4_IDILO       -----------MPTVMPDVANQTQAQT---EGALDWVGMSNIEVPLMVAAAGVP-ERPVA
GCH4_PSYIN       ---------------MPDIANSAQAQT---EGKLDRVGMSNIELPLMVQTDDCP-PQQVS
GCH4_PSET1       ---------------MPDIANTAPALQ---TGTLDWVGMGEIELPFIFESHGIT-PVTVN
GCH4_HYDCU       ---------------MPDIACQPHQDP---QGKLNWVGMSGIELPIKIEQDS-Q-TLTLS
GCH4_ALCBS       ---------------MPDVASNSMVDHI--HTTLDWVGMSEIHLPARVSDTLAG-ERPVS
GCH4_PSEAE       ----------MNALTLPDIARQTTT-A---DLPLDWVGMQGIALPVQIGGQR------VA
GCH4_PSEAB       ----------MNALTLPDIARQTTT-A---DLPLDWVGMQGIALPVQIGGQR------VA
GCH4_PSEA7       ----------MNALTLPDIARQTTL-S---TLPLDWVGMQGIALPVQVAGQT------VA
GCH4_PSEF5       ----------MNALTLPDIAAQASR-Q---TLPLEWVGMCGIALPVVINNQP------SA
GCH4_PSEPF       ----------MNALTLPDVAAQAAR-Q---ALPLEWVGMCGIALPVFIEGQR------LA
GCH4_PSEMY       ----------MNEQLLPDIAAQATH-H---DLPLHWVGMAGIALPIQLAGQA------LN
GCH4_PSEPG       ----------MTQLKLPDIAAQTQA-Y---AVPLNWVGMCGIALPVQFEGRT------AA
GCH4_PSEPW       ----------MTSLTLPDIAAQKHQ-H---ATPLAWVGMCGIALPVHFDGRS------VA
GCH4_PSEE4       ----------MTSLTLPDIAAQSAQ-Q---PLPLDWVGMCGIAMPVQFEGRQ------LS
GCH4_CHRSD       ------MQEPKNSQTLHDVANGASD-L---EGPLAWVGMEDIALPFRLANSA------VN
GCH4_CITK8       --------------MLPDIQSTKGDGE---GESLSWVGMEQIDLPIDIAGRP------VS
GCH4_KLEPN       --------------MLPDIQSTKGDGE---GESLSWVGMEQIDLPIDIAGRP------VS
GCH4_SERP5       ----MNKVALPPTQPLPDAQAWQGAMS---DVGLDWVGMQGIALPLELAGKP------LM
GCH4_HAHCH       ---------MQIVRALPDIAKTRTEFE---TYTLQWVGMEDIAVPLTLNIGGGK-QQSLP
GCH4_PSEA6       -----------MGMTLPDITSSENVAS---AAPLKWVGMEGITVPIQVPMSGEV-PAYVN
GCH4_BDEBA       ----------MTKQSLPDVAKETHSER---FAPIDWVGMGAIELPVMLKQAD-G-VYRIP
GCH4_ROSDO       EYPSDFSLDDGYKETLPDLQNGPSSLIRGTKQQIQHVGISNFRLPIRFHTRSGG-DITLE
GCH4_RUEPO       QYPEDFTVDATYRAGLPDLQNGPSSLIRGAKQQIQHVGISNFRLPIRFHRKEGD-DLTLE
GCH4_DINSH       AYPEEFSVDAAYKDSLPDLQNGPSSLIRGAKAQIQHVGISNFRLPIRFHTRDNG-DVTLE
GCH4_CERS4       AYPRTFTVDEAYKASLPDLQNGPASLIVGAKAVIQHVGISNFRLPIRYHTRDNG-DLQLE
GCH4_CERS1       AYPRTFTVDEAYKASLPDLQNGPASLIVGAKAVIQHVGISNFRLPIRYHTRDNG-DLQLE
GCH4_CERS5       SYPRNFTVDEAYKASLPDLQNGPASLIVGAKAVIQHVGISNFRLPIRYHTRDNG-DLTLE
GCH4_RUEST       QYPDDFDANESYRATLPDLQNGPSSLIRGAKEQIQHVGISNFRLPIRFHTRDNG-DLTLE
GCH4_JANSC       EYPGDFTVDEAYRATLPDLQNGPASLIKGANRRIQHVGISNFRLPIRYAVQDGS-EVMLE
GCH4_PARDP       EYPADFRVDDSYKASLPDLQNGPASLIVGARAPIQHVGISNFRLPIRYQTQEGG-EIALE
GCH4_OPITP       RYDPAFEVDAAYRASLPDMMEAAYAAIQGAHVPIQQVGVSNFKLPLKFRTKKGE-ILTLE
                                                     .*:  .  *               

GCH4_BACSU       ANFTMTCNLPRN---QKGINMSRLTELLQVYHQNGWILSFSSLQQFTKELAENMDTS---
GCH4_BACLD       GAFSFTTSLARD---RKGINMSRLTEQLQRYHEANWTVDFHTLKDFAKDLAGNMEQE---
GCH4_ALKHC       GTFSLTTGLEQM---SKGINMSRLTELLQEYHQTGFILSLKNMQAFTKDLAERMEQS---
GCH4_OCEIH       GTFEFSSSIPTM---SKGTNMSRFMELLQEYSSSGMNVSISELKRFTKELSGKLEQK---
GCH4_EXIS2       ATFELSTSLVQD---RKGINMSRLTEQLDQYHNEGWVVTNESLIQFARELAERMEQS---
GCH4_STAAB       GTFSFSTSLTKD---EKGINMSRIIESVEKHYDNGIELEFNTLYQVLRTLQTNMKQN---
GCH4_STAAC       GTFSFSTSLTKD---EKGINMSRIIESVEKHYDNGIELEFNTLYQVLRTLQTNMKQN---
GCH4_STAAS       GTFSFSTSLTKD---EKGINMSRIIESVEKHYDNGIELEFNTLYQVLRTLQTNMKQN---
GCH4_STAAW       GTFSFSTSLTKD---EKGINMSRIIESVEKHYDNGIELEFNTLYQVLRTLQTNMKQN---
GCH4_STAA8       GTFSFSTSLTKD---EKGINMSRIIESVEKHYDNGIELEFNTLYQVLRTLQTNMKQN---
GCH4_STAAE       GTFSFSTSLTKD---EKGINMSRIIESVEKHYDNGIELEFNTLYQVLRTLQTNMKQN---
GCH4_STAAT       GTFSFSTSLTKD---EKGINMSRIIESVEKHYDNGIELEFNTLYQVLRTLQTNMKQN---
GCH4_STAA3       GTFSFSTSLTKD---EKGINMSRIIESVEKHYDNGIELEFNTLYQVLRTLQTNMKQN---
GCH4_STAA2       GTFSFSTSLTKD---EKGINMSRIIESVEKHYDNGIELEFNTLYQVLRTLQTNMKQN---
GCH4_STAAN       GTFSFSTSLTKD---EKGINMSRIIESVEKHYDNGIELEFNTLYQVLRTLQTNMKQN---
GCH4_STAA9       GTFSFSTSLTKD---EKGINMSRIIESVEKHYDNGIELEFNTLYQVLRTLQTNMKQN---
GCH4_STAA1       GTFSFSTSLTKD---EKGINMSRIIESVEKHYDNGIELEFNTLYQVLRTLQTNMKQN---
GCH4_STAAM       GTFSFSTSLTKD---EKGINMSRIIESVEKHYDNGIELEFNTLYQVLRTLQTNMKQN---
GCH4_STAAR       GTFSFSTSLTKD---EKGINMSRIIESVEKHYDNGIELEFNTLYQVLCTLQTNMKQN---
GCH4_STAHJ       GRFSFSTSLNKD---EKGINMSRILESVEKHYNNGLELNFDTLYQVLRTLQTNMKQN---
GCH4_STAES       GLFSFSTSLNKN---EKGINMSRILESVEKHYDNGIELEFNTLHQLLRTLQDKMNQN---
GCH4_STAEQ       GLFSFSTSLNKN---EKGINMSRILESVEKHYDNGIELEFNTLHQLLRTLQDKMNQN---
GCH4_STAS1       GNFSFSTSLNLD---EKGINMSRILESVEKHYHNGIELDFDALYQLLRSLQERMNQN---
GCH4_BURM7       GTWNLDVHLPAD---QKGTHMSRFVALLEE---RGGPLTADAFRTMLATMLEKLEAR---
GCH4_BURM9       GTWNLDVHLPAD---QKGTHMSRFVALLEE---RGGPLTADAFRTMLATMLEKLEAR---
GCH4_BURMS       GTWNLDVHLPAD---QKGTHMSRFVALLEE---RGGPLTADAFRTMLATMLEKLEAR---
GCH4_BURPS       GTWNLDVHLPAD---QKGTHMSRFVALLEE---RGGPLTADAFRTMLATMLEKLEAR---
GCH4_BURP6       GTWNLDVHLPAD---QKGTHMSRFVALLEE---RGGPLTADAFRTMLATMLEKLEAR---
GCH4_BURP0       GTWNLDVHLPAD---QKGTHMSRFVALLEE---RGGPLTADAFRTMLATMLEKLEAR---
GCH4_BURMA       GTWNLDVHLPAD---QKGTHMSRFVALLEE---RGGPLTADAFRTMLATMLEKLEAR---
GCH4_BURP1       GTWNLDVHLPAD---QKGTHMSRFVALLEE---RGGPLTADAFRTMLATMLEKLEAR---
GCH4_BURTA       GTWNLDVHLPAD---QKGTHMSRFVALLEE---SGGPLTADAFRAMLATMLEKLEAQ---
GCH4_BURCM       GVWNLDVHLPAD---QKGTHMSRFVALLED---SREPLTVERFRAMLASMLVRLEAE---
GCH4_BURA4       GVWNLDVHLPAD---QKGTHMSRFVALLEE---SREPLTVERFRAMLASMLVRLEAE---
GCH42_BURCA      GVWNLDVRLPAD---QKGTHMSRFVALLEE---NRAPLTVERFRAMLASMLVKLEAE---
GCH41_BURCH      GVWNLDVRLPAD---QKGTHMSRFVALLEE---NRAPLTVERFRAMLASMLVKLEAE---
GCH41_BURCC      GVWNLDVRLPAD---QKGTHMSRFVALLEE---NRAPLTVERFRAMLASMLVKLEAE---
GCH42_BURL3      GVWNLDVRLPAD---QKGTHMSRFVALLEE---NRAPLTVERFRAMLASMLEKLEAE---
GCH4_BURVG       GVWNLDVRLPAD---QKGTHMSRFVALLEE---NRAPLTVERFRAMLASMLEKLEAQ---
GCH4_BURM1       GVWNLDVRLPAE---QKGTHMSRFVALLEE---NRAPLTIERFRAMIASMLEKLEAE---
GCH4_PARXL       GTWNLDVHLPAD---QKGTHMSRFVALLEE---NKAPLEPATFRTMLAAMLEKLEAE---
GCH4_PARP8       GTWNLDVHLPAE---VKGTHMSRFVALLEE---NKAPLDSSAFRALLTSMLEKLEAP---
GCH4_CUPNH       GTFNLDVHLPAD---QKGTHMSRFVALLEE---ERAPLELSSFRLMLDKMLEKLEAE---
GCH4_CUPPJ       GTFNLDVHLPAE---VKGTHMSRFVALLEE---ERAPLELASFRVLLDKMLEKLEAE---
GCH42_CUPMC      GTFNMDVRLPAD---QKGTHMSRFVALLEE---NRAPLDLAAFRALVDDMLVRLEAD---
GCH4_RALSO       GTFNLDVHLPAD---QKGTHMSRFVALLEE---EREPLNLAQFQLLLEKMLEKLEAD---
GCH4_HERAR       GSWNMYVRLTEE---QKGTHMSRFIALLEE---NNQPLDVAVFGALMRKMLVLLDAD---
GCH4_JANMA       GTWNMYVHLAEE---QKGTHMSRFIALLEE---NTQALDVNVFGGMIRKMLALLEAD---
GCH4_NEIMB       ARLTMTVYLPAE---QKGTHMSRFVALMEQ---HAEALDFAQLRKLTTEMVALLDSR---
GCH4_NEIMF       ARLTMTVYLPAE---QKGTHMSRFVALMEQ---HAEALDFAQLRKLTTEMVALLDSR---
GCH4_NEIMA       ARLTMTVYLPAE---QKGTHMSRFVALMEQ---HTEALDFAQLRRLTAEMVALLDSR---
GCH4_NEIM0       ARLTMTVYLPAE---QKGTHMSRFVALMEQ---YSEALDFAQLHRLTAEMVALLDSR---
GCH4_NEIG1       ARLTMTVYLPAE---QKGTHMSRFVALMEQ---HTEVLDFAQLHRLTAEMVALLDSR---
GCH4_BORA1       ANWTLTVALPAE---EKGTHMSRFVALLEKY--RATPMTPALFSQMAREMLPLLHAE---
GCH4_BORPD       ANWTLTVALPAE---EKGTHMSRFVALLEKY--RSVPMTPALFAAMARDMLPLLHAE---
GCH4_BORBR       ANWTLTVALPAE---EKGTHMSRFVALLEKY--RATPMTPALFAAMAREMLPLLHAE---
GCH4_BORPA       ANWTLTVALPAE---EKGTHMSRFVALLEKY--RATPMTPALFAAMAREMLPLLHAE---
GCH4_BORPE       ANWTLTVALPAE---EKGTHMSRFVALLEKY--RATPMTPALFAAMAREMLPLLHAE---
GCH4_POLAQ       GNFEMDVALPAH---VKGTHMSRFMALLQK---QDEAIDSTTVVALVRDMLPLLDAK---
GCH4_METPP       ASWSLDVALPAE---QKGTHMSRFVAWLDALSASGKPLDATALRDELAVMLDKLHAV---
GCH41_DECAR      ATFAMSVGLPPE---VKGTHMSRFVELLEA---RTGPLTQVGLLRMMADMLLRLDAS---
GCH4_DICNV       ARAALMVALPHT---QKGTHMSRFIRLLDL----KTPISVSALPTLHQKMLDTLHAE---
GCH4_ALKEH       ANFSMYVNLPQH---FKGTHMSRFVQILEG---HDTEITVQSFREMLHEVAERLEAE---
GCH4_HALHL       ATFSMYVNLPQH---FKGTHMSRFVSILEG---HDREVTVESFHEMLAEMTDRLEAH---
GCH4_NITOC       ANFNMYVDLPHH---FKGTHMSRFVEILNQ---HEHEITVRSFREMLREMNHRLQAE---
GCH4_METCA       ARFDMAVSLPHH---FKGTHMSRFVEIING---HDREIDIASFEAMLAEMMQRLNAE---
GCH4_AZOSB       ANFNMYVGLPHN---FKGTHMSRFIEILNS---NEREISVESFEPMLREMVKRLEAE---
GCH4_AROAE       AVFNMYVGLPHN---FKGTHMSRFIEIING---NEREISVESIEPMLREMVKRLEAE---
GCH4_METFK       ATFNMYVYLPHN---FKGTHMSRFVEILNN---NEREISVESFESILRAMVERLDAE---
GCH4_THIDA       ANFNMYVFLPHN---FKGTHMSRFIEILNT---REREISVENFEGMLRQMVERLEAE---
GCH42_DECAR      AMFNMYVGLPHN---FKGTHMSRFVEILNS---HEREISVENFPTMLRDMVVKLEAE---
GCH4_NITEU       AQFNMYVNLPHN---FKGTHMSRFVEILNS---HEREISVESFEEILRSMVSRLESD---
GCH4_NITEC       AQFNMYVNLPHN---FKGTHMSRFVEILNS---HEREISVESFEEILRSMVSRLESD---
GCH4_NITMU       AVFNMYVNLAHH---LKGVHMSRFVEMLNE---HDSVISVETFEKLLISMVKKLEAE---
GCH4_RUTMC       GIFTMTVSLSER---VKGTHMSRFIEILNE---GPCEFSAHNFDKIIDKVRKRLESD---
GCH4_VESOH       GMFTMTVSLPEH---VKGTHMSRFIEILNE---NSCEFSAHNFDQIIDKVKEKLESD---
GCH4_GEOMG       ARINMYVDLPHH---FKGTHMSRFVEILNA---YREDIALDKMEPILQKMKEKLGAS---
GCH4_GEOSL       ARVNMYVDLPHH---FKGTHMSRFIEILNA---YREDIALDKMEPILQEMKKKLGAS---
GCH4_GEOUR       ARINMYVDLPHH---FKGTHMSRFIEILNV---YREKIALDNMEAMLQRMKEKLGAG---
GCH4_PELPD       ARVNMYVDLPHQ---FKGTHMSRFVEILNR---HREQIALDKLETILEEMKARLGSA---
GCH4_SYNC1       ARINMYVDLPHH---FKGTHMSRFVEILNQ---YRGEITMRNMGELLQEMKNRLDAS---
GCH4_SYNAS       ASINMYVDLPHH---FKGTHMSRFIEVLNE---FRGEINIRTFHTILEKVRDKLKAE---
GCH4_SYNFM       ASVNMYVNLPRE---FKGTHMSRFIEILNE---FHGNLDIREFPSILQSVQEHLSAE---
GCH4_DESOH       GTINMYVDLPHE---SKGTHMSRFVEMLHI---LQPEISPKTFSVILDQMKKDLDAA---
GCH4_MAGMM       ARINMYVNLPHQ---FKGTHMSRFLEVLAE---NQRAISIENLPKLLKEVKQRLDAE---
GCH4_AKKM8       ATVSLAVDLPEE---FKGTHMSRFVEALHQ---HGPLLDVHTALAIPRELLRRLSAR---
GCH4_THEMA       AQISCSVDLHRE---KRGIHMSRFIEVLNK---LEV-ITPQIFEEILDDLIEIMEAK---
GCH4_THESQ       AQISCSVDLHRE---KRGIHMSRFIEVLNK---LEV-ITPQIFEEILDDLIEIMEAK---
GCH4_THEP1       AQISCSVDLHRE---KRGIHMSRFIEVLNK---LEV-ITPQIFEEILDDLIEIMEAK---
GCH4_CALS8       AKITAAAELKGD---MRGTHMSRFIEAIDE---LNV-VGPKEIERLLDRIKEKLDSQ---
GCH4_THEM4       ADINMYVDLPKD---FRGTHMSRFLEVFNK---FHLKIDPKTIKKILDDLKQTLKAQ---
GCH4_FERNB       ATLNMFVDLPKD---YRGTHMSRFIEVLNE---YHLEINPKRIKEILRSLKKVLNAK---
GCH4_PSELT       ATINMYVDLPVN---FRGTHMSRFVEVLNR---YRLGIDPKIIKNMLEELRNNLNAS---
GCH4_DESVH       ATVDIGVDLPAH---FKGTHMSRFVEALEN---WTEELDYASMKRLLEDVKTRLEAR---
GCH4_DESVV       ATVDIGVDLPAH---FKGTHMSRFVEALEN---WTEELDYASMKRLLEDVKTRLEAR---
GCH4_OLEA2       AVVDIGVELPAR---FKGTHMSRFVEALAH---WDEHLNYRTIKSLLEDVKTRLQAR---
GCH4_LAWIP       AIVDMGVDLSVS---SRGTHMSRFVEVLQD---WNEPLCCESLERLVKQTQKKLQSQ---
GCH4_DESPS       ASCKITATIKET---LKGDISGEVQRLLPS---FTKEIEPKSWHRLLEEFKENIGVE---
GCH41_BURCA      ARADVQVDLPAP--QVKGIHMSRLYGLLDGL-ADGEALSPAGLQRMLRAMVDSHRDCETR
GCH42_BURCH      ARADVQVDLPAP--QVKGIHMSRLYGLLDGL-ADGEALSPAGLQRMLRAMVDSHRDCETR
GCH42_BURCC      ARADVQVDLPAP--QVKGIHMSRLYGLLDGL-ADGEALSPAGLQRMLRAMVDSHRDCATR
GCH41_BURL3      ARADVQVDLPAP--HVKGIHMSRLYRLLDGL-GDGTALSPAGLQHVLHAMVDSHRDCDTR
GCH4_DELAS       ARADVQVDLPAA--HVKGIHMSRLYRQLDSL-AEESALSALALRHALQAMIDSHLDCQSR
GCH41_CUPMC      ARADIHVDLPAP--RVKGIHMSRLYALLDAL-DDGEGLSPIRIRQLLEAMVDSHRDCETG
GCH4_PSEP1       ARADVQVDLPAP--HVKGIHMSRLYCLLDAW-GQAAAVSPASLFALLQEMIDSHQDCGSR
GCH4_PSEPK       ARADVQVDLPAP--HVKGIHMSRLYRLLDAW-GQAAAVSPASLFALLQEMIDSHQDCESR
GCH4_PSE14       AHVDLQVDLADP--SVKGIHMSRLYRLLDRY-AEHQILSPDTLGALLEAMVESHLDCHSS
GCH4_PSEU2       AHVDLQVDLADP--SVKGIHMSRLYRLLDGY-AERQIVSPDTLAALLEAMVESHLDCHSS
GCH4_PSESM       AYADLQVDLTDP--SVKGIHMSRLYRLLDGF-AEHQVLTPETLSALLEAMVESHVDCHSS
GCH4_XANAC       ARASVQVDLPRA--ELKGIHMSRLYRLLDTH-LQ-QPLSPAMLSQLLQALIDSHADCASR
GCH4_XANC5       ARASVQVDLPRA--ELKGIHMSRLYRLLDTQ-LQ-QPVSPAMLSGLLQALIESHADCASR
GCH4_XANOR       ARASVQVDLPRA--ELKGIHMSRLYRLLDLH-LQ-RPLSPAMLPQLLQALIESHADCASR
GCH4_XANOM       ARASVQVDLPRA--ELKGIHMSRLYRLLDLH-LQ-RPLSPAMLPQLLQALIESHADCASR
GCH4_XANOP       ARASVQVDLPRA--ELKGIHMSRLYRLLDLH-LQ-RPLSPAMLPQLLQALIESHADCASR
GCH4_XANCP       ARAQVQVDLPRP--ELKGIHMSRLYRLLDRH-LE-QPLSPAMLSQLLQAMIDSHADCGSR
GCH4_XANC8       ARAQVQVDLPRP--ELKGIHMSRLYRLLDRH-LE-QPLSPAMLSQLLQAMIDSHADCGSR
GCH4_XANCB       ARAQVQVDLPRP--ELKGIHMSRLYRLLDRH-LE-QPLSPAMLSQLLQAMIDSHADCGSR
GCH4_XYLFT       GRARAQIDLPAM--GVKGIHMSRLYRLLDTY-AV-EPLTPVGICGLLSAMVNSHADCAST
GCH4_XYLF2       GRARAQIDLPAM--GVKGIHMSRLYRLLDTY-AV-EPLTPVGICGLLSAMVNSHADCAST
GCH4_XYLFM       GRARAQIDLPAM--EVKGIHMSRLYRLLDTH-AV-EPLTPVGICGLLSAMVNSHADCAST
GCH4_XYLFA       GRARAQIDLPAM--EVKGIHMSRLYRLLDTH-AV-EPLTPVGICGLLSAMVNSHADCAST
GCH4_ACIAD       TKVDVYVNLPKS--SVKGIHMSRLYHLINHL-SV---LNTMSIKSVLKQMIDSHQDCGTT
GCH4_COLP3       AHIDAFVNLKDA--QAKGIHMSRLYLLIDEL-STSNILNYQSLVSLLDGFISSHQEL-SD
GCH4_IDILO       AKVEAFVNLKNP--KTKGIHMSRLYLLLDKM-STEGELSHDTLKQLLNDFIESHKDI-SD
GCH4_PSYIN       ANAEVFVNLGDA--QAKGIHMSRLYLQLDEL-STESELNISTLTALLQGFITSHHEL-SQ
GCH4_PSET1       AKARAFVNLHKE--DAKGIHMSRLFLALDTL-STEQQVNPQTLAQALDFFISSHEGL-SD
GCH4_HYDCU       SQVQAYVSLDDP--LSKGIHMSRLYLILDEM-GSNAPLNPASIQTLLTAFIESHQGL-SQ
GCH4_ALCBS       TSIQAYVNLANA--DAKGIHMSRLFLMLEET-FGDHSVSAGSIEQLLRNFLQTHEGL-ST
GCH4_PSEAE       AEADAGVSLDDP--QARGIHMSRLYLALAEL-EQG-ELDLSCLRAVLQRFLDSHAGL-SR
GCH4_PSEAB       AEADAGVSLDDP--QARGIHMSRLYLALAEL-EQG-ELDLSRLRAVLQRFLDSHAGL-SR
GCH4_PSEA7       AEADAGVSLDDP--QARGIHMSRLYLALAGL-EDG-ELDLPRLRGVLQRFLDSHADL-SR
GCH4_PSEF5       AKADAGVSLDDG--EARGIHMSRLYLALEML-EQE-NLTPALLRRILQRFLDSHEGL-AH
GCH4_PSEPF       AKADAGVSLDDG--DARGIHMSRLYLGLEAM-EQQ-NLSPALLRQVLQRFLDSHEDL-SE
GCH4_PSEMY       ASVDIGVSLDDA--GARGIHMSRLYLALQGL-AGK-PLTLAALQHLLDDCLSSHHEL-SD
GCH4_PSEPG       AKVDAGVSLVDG--SSRGIHMSRLYLALGSL-EHQ-PLTPLAIRQLLEDFLSSHASL-SS
GCH4_PSEPW       AMADAGVSLEDG--SSRGIHMSRLYLSLERL-ERQ-SLTPLAIRQILADFLASHEGL-SH
GCH4_PSEE4       ALADAGVSLDDG--ASRGIHMSRLYLALEAL-ERD-TLTPRLIHQVLEQFLFSHEGL-SA
GCH4_CHRSD       GRASAGVSLDAT--SARGIHMSRLYLALEAL-EHE-EVTLSGLGAVLQRFLASHDGL-AR
GCH4_CITK8       AKVNAGINLLSSPEAEKGIHMSRLYLLLDEL-TQG-EITPALLQHVLKAFLVSHQGR-SD
GCH4_KLEPN       AKVNAGINLLSSPEAEKGIHMSRLYLLLDEL-TQG-EITPALLQHVLKAFLVSHQGR-SD
GCH4_SERP5       AKVNAGINLRASRHGARGIHMSRLYLTLDEL-TQG-ELTPQRIADSLRAFLASQPEH-SD
GCH4_HAHCH       AKANVYVSLDDA--AEKGIHMSRLHAILNQ--LASQVCDKEGLDLLLRNMVASQGKI-SR
GCH4_PSEA6       AKTDVYVSLDKS--DAKGIHMSRLFLKLNDI-LGTELLSSTSLTALLNELILSQQGL-SQ
GCH4_BDEBA       ARVDAKVSLDKK--PSRGIHMSRLYLLSQEL-LTKSELSLGLLGTVTSEFLRTHEDL-ST
GCH4_ROSDO       TSVTGSVSLEAD---KKGINMSRIMRSFYKH-AEE-TFSFEVIEAALDAYINDLESF---
GCH4_RUEPO       TSVTGTVSLEAG---KKGINMSRIMRSFYKH-AER-TFSFEVIEAALDDYMTDLDSF---
GCH4_DINSH       TSVTGSVSLEAE---KKGINMSRIMRTFYGH-ADE-TFSFEVIERTLDAYKSDLESF---
GCH4_CERS4       TSVTGTVSLEAE---KKGINMSRIMRSFYAH-AEQ-AFSFEVIERALEDYKRDLESF---
GCH4_CERS1       TSVTGTVSLEAE---KKGINMSRIMRSFYAH-AEQ-AFSFEVIERALEDYKRDLESF---
GCH4_CERS5       TSVTGTVSLEAE---KKGINMSRIMRSFYAH-AEQ-GFSFEVIERALEDYKRDLESF---
GCH4_RUEST       TSVTGTVSLDAE---KKGINMSRIMRSFYKH-AEK-VFSFDVMEAALEDYLSDLESG---
GCH4_JANSC       TSVTGTVSLEAD---QKGINMSRIMRSFYKH-ADA-SFGFDVIEAALDDYKADLGSF---
GCH4_PARDP       TSVTGTVSLEAD---RKGINMSRIMRSFYAH-AEK-QFSMGVLEAALEDYKSDLGSF---
GCH4_OPITP       ASITGTVSLEAD---LKGINMSRIVRSFYDH-KDE-VFTGEWMGKILCAYLRNVKSK---
                         :       :*   ...                                    

GCH4_BACSU       SATVEVRFPWFFERKSPKLE-KAGLMHADIFMSVTYR----KDQPFKQRAGISAKVTTLC
GCH4_BACLD       SASVSVSFPWYFERISPETK-LSGLMHADIHMTVSYH----ENKGFSQTAGITAHATTLC
GCH4_ALKHC       SAHVHVTFPWFFERESPSLN-KIGLAHAEARLNVHFD----ETLGFTHEVGLTAAVTTLC
GCH4_OCEIH       DATIEVSFPWFFERKGPESQ-SAGMNHADAKLSVTYD----SNSGFSIDVSLSAWITTLC
GCH4_EXIS2       EGQLTIRYPWFFTRKAPATG-LSGLMNAEVWQTVSVNT---ETNEATLSVGLTINVTTLC
GCH4_STAAB       AAGVDVSGKWFFDRYSPTTN-IKAVGNADVTYGLAID----GDKVTRKELTIEATVTTLC
GCH4_STAAC       AAGVDVSGKWFFDRYSPTTN-IKAVGNADVTYGLAID----GDKVTRKELTIEATVTTLC
GCH4_STAAS       AAGVDVSGKWFFDRYSPTTN-IKAVGNADVTYGLAID----GDKVTRKELTIEATVTTLC
GCH4_STAAW       AAGVDVSGKWFFDRYSPTTN-IKAVGNADVTYGLAID----GDKVTRKELTIEATVTTLC
GCH4_STAA8       AAGVDVSGKWFFDRYSPTTN-IKAVGNADVTYGLAID----GDKVTRKELTIEATVTTLC
GCH4_STAAE       AAGVDVSGKWFFDRYSPTTN-IKAVGNADVTYGLAID----GDKVTRKELTIEATVTTLC
GCH4_STAAT       AAGVDVSGKWFFDRYSPTTN-IKAVGNADVTYGLAID----GDKVTRKELTIEATVTTLC
GCH4_STAA3       AAGVDVSGKWFFDRYSPTTN-IKAVGNADVTYGLAID----GDKVTRKELTIEATVTTLC
GCH4_STAA2       AAGVDVSGKWFFDRYSPTTN-IKAVGNADVTYGLAID----GDKVTRKELTIEATVTTLC
GCH4_STAAN       AAGVDVSGKWFFDRYSPTTN-IKAVGNADVTYGLAID----GDKVTRKELTIEATVTTLC
GCH4_STAA9       AAGVDVSGKWFFDRYSPTTN-IKAVGNADVTYGLAID----GDKVTRKELTIEATVTTLC
GCH4_STAA1       AAGVDVSGKWFFDRYSPTTN-IKAVGNADVTYGLAID----GDKVTRKELTIEATVTTLC
GCH4_STAAM       AAGVDVSGKWFFDRYSPTTN-IKAVGNADVTYGLAID----GDKVTRKELTIEATVTTLC
GCH4_STAAR       AAGVDVSGKWFFDRYSPTTN-IKAVGNADVTYGLAID----GDKVTRKELTIEATVTTLC
GCH4_STAHJ       SSGVDVSGKWFFDRFSPVTN-IKAVGNADVTYGLAIE----QDQITRKEITIEATVTTLC
GCH4_STAES       AAGVDVSGKWFFDRYSPVTN-IKAVGHADVTYGLAIE----NHTVTRKELTIQAKVTTLC
GCH4_STAEQ       AAGVDVSGKWFFDRYSPVTH-IKAVGHADVTYGLAIE----NHTVTRKELTIQAKVTTLC
GCH4_STAS1       AAGLDVSAKWFFDRFSPITQ-IKAVGHADVTYGLAID----KQNVTRKEITIEAAVTTLC
GCH4_BURM7       AGRIEVSFPYFVNKTAPVSG-VRSLLDYEVTLTGDVRDG-----LTRVFAKVLVPVTSLC
GCH4_BURM9       AGRIEVSFPYFVNKTAPVSG-VRSLLDYEVTLTGDVRDG-----LTRVFAKVLVPVTSLC
GCH4_BURMS       AGRIEVSFPYFVNKTAPVSG-VRSLLDYEVTLTGDVRDG-----LTRVFAKVLVPVTSLC
GCH4_BURPS       AGRIEVSFPYFVNKTAPVSG-VRSLLDYEVTLTGDVRDG-----LTRVFAKVLVPVTSLC
GCH4_BURP6       AGRIEVSFPYFVNKTAPVSG-VRSLLDYEVTLTGDVRDG-----LTRVFAKVLVPVTSLC
GCH4_BURP0       AGRIEVSFPYFVNKTAPVSG-VRSLLDYEVTLTGDVRDG-----LTRVFAKVLVPVTSLC
GCH4_BURMA       AGRIEVSFPYFVNKTAPVSG-VRSLLDYEVTLTGDVRDG-----LTRVFAKVLVPVTSLC
GCH4_BURP1       AGRIEVSFPYFVNKTAPVSG-VRSLLDYEVTLTGDVRDG-----LTRVFAKVLVPVTSLC
GCH4_BURTA       AGRIEVSFPYFVNKTAPVSG-VRSLLDYEVTLTGDVRDG-----LTRVFAKVLVPVTSLC
GCH4_BURCM       AGRIEVTFPYFVNKTAPVSG-VQSLLDYEVTLAGESRNG-----ETRLFLKVLVPVTSLC
GCH4_BURA4       AGRIEVTFPYFVNKTAPVSG-VQSLLDYEVTLAGESRNG-----ETRLFLKVLVPVTSLC
GCH42_BURCA      AGRIEVTFPYFVNKTAPVSG-VQSLLDYEVTLAGESRNG-----DTRLFLKVLVPVTSLC
GCH41_BURCH      AGRIEVTFPYFVNKTAPVSG-VQSLLDYEVTLAGESRNG-----DTRLFLKVLVPVTSLC
GCH41_BURCC      AGRIEVTFPYFVNKTAPVSG-VQSLLDYEVTLAGESRNG-----DTRLFLKVLVPVTSLC
GCH42_BURL3      AGRIEVTFPYFVNKTAPVSG-VQSLLDYEVTLAGESRNG-----DTRLFLKVLVPVTSLC
GCH4_BURVG       AGRIEVTFPYFVNKTAPVSG-VQSLLDYEVTLAGESRDG-----HTRVFLKVLVPVTSLC
GCH4_BURM1       AGRIEVTFPYFVNKTAPVSG-VQSLLDYEVTLAGESRNG-----DTRLFLKVLVPVTSLC
GCH4_PARXL       AGRIEVSFPYFVNKTAPVSG-VQSLLDYEVTLTGETRNG-----ATRLFLRVRVPVTSLC
GCH4_PARP8       AGRIEVSFPYFVNKTAPVSG-VQSLLDYEVSLMGDSRDG-----ATRLFLKVLVPVTSLC
GCH4_CUPNH       AGRIEVTFPYFISKTAPVSG-VESLLDYEVTLTGEVRDG-----AARVFLKALVPVTSLC
GCH4_CUPPJ       AGRIEVTFPYFISKIAPVSG-VESLMDYEVTLTGEIRNG-----VTRVFLKALVPVTSLC
GCH42_CUPMC      AGRIEVSFPYFITKTAPVSG-VQSLLDYEVTLVAEARDG-----QTRMFMTALVPVTSLC
GCH4_RALSO       AGRIEVSFPYFVSKTAPVSG-VQSLMDYEVTMIGEVRDG-----HTTVRVKALVPVTSLC
GCH4_HERAR       AGRIEVSFPYFINKTAPVSG-VQSLMDYEVGLTGEMKNG-----ELEVTLKVLVPVTSLC
GCH4_JANMA       AGRIEVSFPYFINKTAPVSG-VQSLMDYEVGFNGEIKNG-----KLEITLKVLVPVTSLC
GCH4_NEIMB       AGKISVSFPFFRKKTAPVSG-IRSLLDYDVCLTGEIKDG-----AYGHSMKVMIPVTSLC
GCH4_NEIMF       AGKISVSFPFFRKKTAPVSG-IRSLLDYDVCLTGEIKDG-----AYGHSMKVMIPVTSLC
GCH4_NEIMA       AGKISVSFPFFRKKTAPVSG-IRSLLDYDVSLTGEMKDG-----AYGHSMKVMIPVTSLC
GCH4_NEIM0       AGKISVSFPFFRKKTAPVSG-IQSLLDYDVCLTGEMKDG-----AYGHSMKVMIPVTSLC
GCH4_NEIG1       AGKISVSFPFFRKKTAPVSG-IRSLLDYDVSLTGEMKDG-----AYGHSMKVMIPVTSLC
GCH4_BORA1       RGDLTAAFPYFINKSAPVSG-VQSLLDYEVIWTARAAGD-----EVEFELRVQVPVTSLC
GCH4_BORPD       RGDITAAFPYFINKSAPVSG-VQSLLDYEVQWIARAAGD-----QVEFELVVQVPVTSLC
GCH4_BORBR       RGDITASFPYFINKSAPVSG-VQSLLDYEMQWIARAVGE-----QVEFELVAQVPVTSLC
GCH4_BORPA       RGDITASFPYFINKSAPVSG-VQSLLDYEMQWIARAVGE-----QVEFELVAQVPVTSLC
GCH4_BORPE       RGDITASFPYFINKSAPVSG-VQSLLDYEMQWIARAVGE-----QVEFELVAQVPVTSLC
GCH4_POLAQ       EGHVQFTYTHFVKKAAPVSG-VESLMDYEVTWMATAKQNDAGSVEVELGLRAQVPVMSLC
GCH4_METPP       EGRIEARFPFFIRKHAPVSG-VSSLLDYQGAWIAEHRAGS----GTTVWCEVVVPVKSLC
GCH41_DECAR      SGRIELAFPYFIRKMAPVSG-VESLLDYDATLIVDQRAWE----SATLTLRVVAPVTSLC
GCH4_DICNV       EGTISLSFPFFIEKSAPVSG-EKALLDYEVVLAVDGNRK-----HVEVSVEVTVPVTSLC
GCH4_ALKEH       SGHIEMAFPLFVRKTAPVTG-VQSLMDYQVAFIGEIHEG-----EPELAIRVVVPVTSLC
GCH4_HALHL       SGHIEMAFPYFVNKQAPVTG-VESLMDYEVTFIGEIHGG-----RHETWVRVAVPITTLC
GCH4_NITOC       SGHIEMVFPYFVTKQAPVSK-VQSLMDYQVTFIGEIKGD-----KPQITVKVVVPVTSLC
GCH4_METCA       AGRIEMRFPYFLEKRAPVTG-VRSLMDYEVALIGEVSVA-----TTTTWLGVTVPVTSLC
GCH4_AZOSB       TGHVEMTFPYFINKSAPVSG-VQSLMDYEVTFTGEIHEGG----RYEFTMKVVVPVTSLC
GCH4_AROAE       TGQIELTFPYFINKSAPISG-VQSLMDYEVTFTAEIREGG----AYTFTMKTVVPVTSLC
GCH4_METFK       SGHVEMTFPYFVNKTAPVSG-VQSLSDYEVTFIGEINKG-----KYDITVKVVVPVTSLC
GCH4_THIDA       SGYIEMTFPYFINKSAPVSG-VQSMLDYEVTFVGAIENG-----QYTHTTKVVVPVTSLC
GCH42_DECAR      TGHIEMNFPYFINKTAPVSG-VQSLMDYDVTFIGDICHG-----EIATSVKVVVPVTSLC
GCH4_NITEU       SGHIEMAFPYFINKSAPVSG-VKSLLDYEVTFIGEIKHGN----QYSFTMKVIVPVTSLC
GCH4_NITEC       SGHIEMTFPYFVNKSAPISG-VKSLLDYEVTFIGEIKHGD----QYGFTMKVIVPVTSLC
GCH4_NITMU       SGDIEMRFPYFIGKTAPVSG-IKSLMDYDVTFIGQTRNG-----ESRFTLKVVVPVTSLC
GCH4_RUTMC       IAHITLNFTFFRRKKAPSSG-VESMMDYQVTLYGTLNKD-----EVQVMMKVVVPVTSLC
GCH4_VESOH       TAHITLNFPFFRKKEAPSSG-VKSMMDYQVTLYGTLNKG-----EVQVMIKVVVPVTSLC
GCH4_GEOMG       SAHLEIEFPYFIEKRAPVSG-ARSLMEYTCTFCGSLGE------EFDFVLGVQIPVTSLC
GCH4_GEOSL       SAHLEIEFPYFIEKRAPVSG-ARSLMEYTCTFTGTLAE------TFDFVLGVQVPVTSLC
GCH4_GEOUR       SAHVEIEFPYFIEKKAPASG-AKSLMEYTCEFSASLSS------EFDFILGIKVPVTSLC
GCH4_PELPD       SAHLEIQFPYFIDKRAPVSG-ARSLMEYSCEFSASLTD------TLDFVLGVRVPLTSLC
GCH4_SYNC1       CAHLKMDFPYFIEKQAPVSK-ARSLMEYRCRLRGTLDK------QKDFVLGVEVPLTALC
GCH4_SYNAS       SAHMEITFPYFIEKTAPVSG-AKSLMDYICAFSGMNAEN-----KKDFLVGVVVPVTTVC
GCH4_SYNFM       SAHLELSFSYFIKKLSPVTG-CAGLMEYGCRVAGSLDSNR----GHDLVLEVNVPISTVC
GCH4_DESOH       SAHMEVTFPYFIEKAAPVSG-TPGFMEYTCKLMGTSRADG----RVDLVSEVVVPISSVC
GCH4_MAGMM       EAHIELDFPYFITKKAPVSG-VEALMDYQVHFSGVMRGN-----AYQLTLTVEVPVTSLC
GCH4_AKKM8       RSHVEMEFPFFRSKNAPVTG-IEGLMDYVVRFEMEAEANNK---LADFKLTVIVPVTTLC
GCH4_THEMA       RAHLEIHFPYFIWKESPVSR-KKSPLKVDCFVEAEK-EK-----NFSFKIGVRTPVHTLC
GCH4_THESQ       RAHLEIHFPYFIWKESPVSR-KKSPLKVDCFVEAEK-EK-----NFSFKIGVRTPVHTLC
GCH4_THEP1       RAHLEIHFPYFTWKESPVSR-KKSPLKVDCFVEAEK-EK-----NFSFKIGVRTPVHTLC
GCH4_CALS8       KAYVRFDFPYFINKRTPVTE-TLAPLKVDCYFEAEK-GE-----KFDLKVGVIVPVHTLC
GCH4_THEM4       SAKIEIMFPYFLKKKAPVTK-IESYMEYLCGFSAYDGPQ-----KCEFYTIVEVSVQTLC
GCH4_FERNB       RSVIEITFPFFLLKKAPVTG-SESYLEYTCSFEAEMNGD-----HLDFSTTVTAPIHTLC
GCH4_PSELT       VARVEIEFPYFILKKAPVSS-IESFLKYTCRIEGQKTEK-----LYEFTMSVGVPIMTLC
GCH4_DESVH       KAYVLFRFPYFIRKKAPATG-SPGLVCYQCRLTGELEEG-----RPSFLLEVEVPVMTVC
GCH4_DESVV       KAYVLFRFPYFIRKKAPATG-SPGLVCYQCRLTGELEEG-----RPSFLLEVEVPVMTVC
GCH4_OLEA2       KAHVHFRFPYFIAKKAPATG-SPGLVSYNCCLTGELADG-----RPAMMLDVEVPVMTVC
GCH4_LAWIP       HAYIAFFFPYFLHKRAPSTN-MLSLFSYDCKLSAKSINY-----NIEFILELTVPVMTVC
GCH4_DESPS       KITLSLSCPFFVSKKAPVSE-LRGLMEYNCTFSASTGES-------GITTSLYVPVTTLC
GCH41_BURCA      SARVRLRFDLLARRTALVTEGLAGWKAYPVRLDATLA-----GDAFALRAQVTVVYSSTC
GCH42_BURCH      SARVRLRFDLLARRTALVTEGLAGWKAYPVRLDATLA-----GDAFALRAQVTVVYSSTC
GCH42_BURCC      SARVRLRFDLLARRTALVTEGLAGWKAYPVRLDATLS-----GDAFALRAQVTVVYSSTC
GCH41_BURL3      SARLRLRFDLLARRAALVTDGLAGWKAYPVRIDATLS-----GARFELRAQVTVVYSSTC
GCH4_DELAS       SARMRLSLDLLAQRPALVTHDLSGWKSYPVRLDATLA-----QGVFQLRLQVGVGYSSTC
GCH41_CUPMC      SARLRLRFDLLVRRPALVTEGIAGWKSYPVRLDASLV-----GNVFALTARITAGYSSTC
GCH4_PSEP1       NARLRLDFDLLVRRPALVTEGLSGWKSYSVHVLATKV-----GGALNLSIEVRIGYSSTC
GCH4_PSEPK       SARVRLDFDLLVRRPALVTEGLSGWKSYPVHVLATKV-----GGALNLSIEVRIGYSSTC
GCH4_PSE14       RARLTLSFNLLCRRPALITEGLSGWKSYPVKLDATWH-----AGRLCLDVSADITYSSTC
GCH4_PSEU2       HARLTLSFNLLCRRPALITEGLSGWKSYPVKLDATWH-----AGRLCLDSSVDITYSSTC
GCH4_PSESM       GARITLTFNLLCRRPALVTEGLSGWKSYPVKLEAVWR-----AGRLCLDVSADITYSSTC
GCH4_XANAC       AARLTLSFELMLRTPALRSEGLSGWRAYPVHIAAQCR-----AGRTTIQLQIEVLYASTC
GCH4_XANC5       AARLTLSGELMLRTPALRSEGLSGWRAYPVHIAAQCS-----AGRTTIQLQAEVLYASTC
GCH4_XANOR       AARLTLSFALMLRMPALRSEGLSGWRAYPVRIAAQCR-----AGRTTIQLQVEVLYASTC
GCH4_XANOM       AARLTLSFALMLRMPALRSEGLSGWRAYPVRIAAQCR-----AGRTTIQLQVEVLYASTC
GCH4_XANOP       AARLTLSFALMLRMPALRSEGLSGWRAYPVRIAAQCR-----AGRTTIQLQVEVLYASTC
GCH4_XANCP       AARVSLAFEVMLRMPALRSEGLAGWRAYPVRIDAQSR-----AGRSEMRLQIDVLYASTC
GCH4_XANC8       AARVSLAFEVMLRMPALRSEGLAGWRAYPVRIDAQSR-----AGRSEMRLQIDVLYASTC
GCH4_XANCB       AARVSLAFEVMLRMPALRSEGLAGWRAYPVRIDAQSR-----AGRSEMRLQIDVLYASTC
GCH4_XYLFT       AARVDWYFDWLRRVPALVSNDLSGWRGYPVWLRAEYS-----AGHVQFWLCVEVAYSSTC
GCH4_XYLF2       AARVDWYFDWLRRVPALVSNDLSGWRGYPVWLRAEYS-----AGHVQFWLCVEVAYSSTC
GCH4_XYLFM       AARVDWYFDWLRRVPALVSNDLSGWRGYPVWLRAEYS-----AGHVQFWLCVEVGYSSTC
GCH4_XYLFA       AARVDWHFDWLRRVPALVSNDLSGWRGYPVSLRAEYS-----AVHVQFWLCVEVGYSSTC
GCH4_ACIAD       AAKIVFKFDLLLKRDAIVSTALSGWKSYPVIIEASII-----NELFNIEYKLDISYSSTC
GCH4_COLP3       QAKVQFCFDYHLRRKSLISG-KEGWKAYPVTLTGNLN-----QGKLTIELTIDVPYSSTC
GCH4_IDILO       QAFIKFDFDYHLRRKSLISK-KQGWKAYPVSLTGRYD-----AGQLKLELSVDVPYSSTC
GCH4_PSYIN       RAFVKFSFDYHLRRKSLISE-KRGWKAYPVIIIGRLS-----EGNFEVELQVNVPYSSTC
GCH4_PSET1       KALIEFKFELPLRRKSLLSD-KAGWKSYPVILTSTIE-----QGVINYELSVDVTYSSTC
GCH4_HYDCU       NAFVEFRFDYYERRRSLKSD-NSGWKHYPCTLRGEMR-----NGQFECEISISVPYSSTC
GCH4_ALCBS       RGFVQLDFEYSMRRAALKSS-YSGWKSYPVSIKGTLC-----EDGMRIELSVEVPYSSTC
GCH4_PSEAE       RAYLRLRLAPLLRRPALVSP-LSGWKRYPLVLDTRLE-----GDDFQAEVHLELTYSSTC
GCH4_PSEAB       RAYLRLRLAPLLRRPALVSP-LSGWKRYPLVLDTRLE-----GDDFQAEVHLELTYSSTC
GCH4_PSEA7       RAYLRLRLAPLLRRPALVSP-LSGWKRYPLVLDTRLE-----NGTFQADLHLELTYSSTC
GCH4_PSEF5       SAYLRIQLDLLLKRPALVSP-LAGWKSYPLSIEARLK-----NAMFHVELKIDVPYSSTC
GCH4_PSEPF       AAYLNIHIDLLLRRPALVSP-LAGWKNYPVTVSAQLK-----NKVFHVELKIDVAYSSTC
GCH4_PSEMY       SASLTVRGALPLQRPALVSQ-LSGWKHYPFEIHARQD-----GRGLHMELQVELDYSSTC
GCH4_PSEPG       AAYLRFSFEHLLNRPALISP-LAGWKSYAVTVDTRIE-----NEVFHVELSVSVPYSSTC
GCH4_PSEPW       AAYLRLTFDHLLKRPALVSP-LAGWKSYSITVDAKIE-----NGMFHVELSVRVPYSSTC
GCH4_PSEE4       SAHLRLQFDHLLKRPALVSP-LAGWKHYPVAIDARLK-----AEMFHVELSVEIPYSSTC
GCH4_CHRSD       TAFLDLSGDVLIKRPALISP-RAGWKAYPCALRCRQD-----TQGMQAVLEVTIGYSSTC
GCH4_CITK8       EASIEISGDLLLSRKSLNSN-HSGWKAYPLTLSAELR-----QS-FTVTLKVGIPYSSTC
GCH4_KLEPN       EASIEISGDLLLSRKSLNSN-HSGWKAYPLTLSAELR-----QS-FTVTLKVGIPYSSTC
GCH4_SERP5       SASLSISGELMLSRPALLSA-HRGWKAYPLKIDASLT-----TG-LTLSLTVGVPYSSTC
GCH4_HAHCH       SAKVELVFDLLLPKPSLLSN-ETGFQTYRIEIGGQCL-----SEKYDYSLKITVPYSSTC
GCH4_PSEA6       GAKVNLDFALTLRKKALLSN-EFGYQSYPIGISTQLV-----KGVARTVLSLTIAYSSTC
GCH4_BDEBA       KALVQVQFEAPLVRKALKSN-NQAWRSYPVITSAFNE-----EGQISYFVEVVVTYSSTC
GCH4_ROSDO       DARIQMRFSFPMKVDSLRSG-LSGYQYYDIALELVDQ-----GGVRKKIMHLDYVYSSTC
GCH4_RUEPO       DARIQMRFSYPERIESLRSG-LSGYQYYDIALELVEQ-----GGERLKIMHLDYVYSSTC
GCH4_DINSH       DARIQMRFSFPMKVESLRSG-LSGYQYYDIALEVVDV-----NGQRRKFMHLDYVYSSTC
GCH4_CERS4       DARIQMRFSFPVKVPSLRSG-LTGWQYYDIALELVDR-----GGVRKEIMHLDFVYSSTC
GCH4_CERS1       DARIQMRFSFPVKVPSLRSG-LTGWQYYDIALELVDR-----GGVRKEIMHLDFVYSSTC
GCH4_CERS5       DARIQMRFSFPVKVPSLRSG-LVGWQYYDIALELVDR-----GGVRKKIMHLDFVYSSTC
GCH4_RUEST       DARLQMRFSFPVKVQSLRSG-LSGYQYYDVALELVQM-----AGQRHRIVHLDYVYSSTC
GCH4_JANSC       DARIQMRLSYPMKVDSLRSG-LSGWQYYDIALELVER-----GGVRQRIVHLDYVYSSTC
GCH4_PARDP       DARIMMRLSYPMRVESLRSG-LSGWQYYDIALELSER-----AGQRLRIMHFDYVYSSTC
GCH4_OPITP       DARLKVSFSYPMLHRSLRSG-LEGYQFYNVAFEGVLTR----KGDYRRFIHFDFVYSSAC
                    :                   .                                 : *

GCH4_BACSU       PCSKEISEY----------------------------------SAHNQRGTVSIWADIH-
GCH4_BACLD       PCSKEISEY----------------------------------SAHNQRGIIKITAHIN-
GCH4_ALKHC       PCSKEISEY----------------------------------SAHNQRGYVTIKATFY-
GCH4_OCEIH       PCSKEISEY----------------------------------SAHNQRGNVTLEATLV-
GCH4_EXIS2       PCSKEISEY----------------------------------SAHNQRGYVTMEASLR-
GCH4_STAAB       PCSKEISEY----------------------------------SAHNQRGVVTVKTYIN-
GCH4_STAAC       PCSKEISEY----------------------------------SAHNQRGVVTVKTYIN-
GCH4_STAAS       PCSKEISEY----------------------------------SAHNQRGVVTVKTYIN-
GCH4_STAAW       PCSKEISEY----------------------------------SAHNQRGVVTVKTYIN-
GCH4_STAA8       PCSKEISEY----------------------------------SAHNQRGVVTVKTYIN-
GCH4_STAAE       PCSKEISEY----------------------------------SAHNQRGVVTVKTYIN-
GCH4_STAAT       PCSKEISEY----------------------------------SAHNQRGVVTVKTYIN-
GCH4_STAA3       PCSKEISEY----------------------------------SAHNQRGVVTVKTYIN-
GCH4_STAA2       PCSKEISEY----------------------------------SAHNQRGVVTVKTYIN-
GCH4_STAAN       PCSKEISEY----------------------------------SAHNQRGVVTVKTYIN-
GCH4_STAA9       PCSKEISEY----------------------------------SAHNQRGVVTVKTYIN-
GCH4_STAA1       PCSKEISEY----------------------------------SAHNQRGVVTVKTYIN-
GCH4_STAAM       PCSKEISEY----------------------------------SAHNQRGVVTVKTYIN-
GCH4_STAAR       PCSKEISEY----------------------------------SAHNQRGVVTVKTYIN-
GCH4_STAHJ       PCSKEISEY----------------------------------SAHNQRGVVTVKVYLD-
GCH4_STAES       PCSKEISEY----------------------------------SAHNQRGIVTVKAYLD-
GCH4_STAEQ       PCSKEISEY----------------------------------SAHNQRGIVTVKAYLD-
GCH4_STAS1       PCSKEISEY----------------------------------SAHNQRGIVTVKAYIN-
GCH4_BURM7       PCSKKISQY----------------------------------GAHNQRSHVTIDAELA-
GCH4_BURM9       PCSKKISQY----------------------------------GAHNQRSHVTIDAELA-
GCH4_BURMS       PCSKKISQY----------------------------------GAHNQRSHVTIDAELA-
GCH4_BURPS       PCSKKISQY----------------------------------GAHNQRSHVTIDAELA-
GCH4_BURP6       PCSKKISQY----------------------------------GAHNQRSHVTIDAELA-
GCH4_BURP0       PCSKKISQY----------------------------------GAHNQRSHVTIDAELA-
GCH4_BURMA       PCSKKISQY----------------------------------GAHNQRSHVTIDAELA-
GCH4_BURP1       PCSKKISQY----------------------------------GAHNQRSHVTIDAELA-
GCH4_BURTA       PCSKKISQY----------------------------------GAHNQRSHVTIDAELA-
GCH4_BURCM       PCSKKISQY----------------------------------GAHNQRSHVTIDAELA-
GCH4_BURA4       PCSKKISQY----------------------------------GAHNQRSHVTIDAELA-
GCH42_BURCA      PCSKKISQY----------------------------------GAHNQRSHVTIDAELA-
GCH41_BURCH      PCSKKISQY----------------------------------GAHNQRSHVTIDAELA-
GCH41_BURCC      PCSKKISQY----------------------------------GAHNQRSHVTIDAELA-
GCH42_BURL3      PCSKKISQY----------------------------------GAHNQRSHVTIDAELA-
GCH4_BURVG       PCSKKISQY----------------------------------GAHNQRSHVTIDAELA-
GCH4_BURM1       PCSKKISQY----------------------------------GAHNQRSHVTIDAELA-
GCH4_PARXL       PCSKKISQY----------------------------------GAHNQRSHVTINAELA-
GCH4_PARP8       PCSKKISQY----------------------------------GAHNQRSHVTINAELI-
GCH4_CUPNH       PCSKKISQY----------------------------------GAHNQRSHITMNVELA-
GCH4_CUPPJ       PCSKKISQY----------------------------------GAHNQRSHITMNVELA-
GCH42_CUPMC      PCSKKISQY----------------------------------GAHNQRSHITMRVELA-
GCH4_RALSO       PCSKKISQY----------------------------------GAHNQRSHITIDAELA-
GCH4_HERAR       PCSKKISAY----------------------------------GAHNQRSHITVHAVLN-
GCH4_JANMA       PCSKKISAY----------------------------------GAHNQRSHITVQALLA-
GCH4_NEIMB       PCSKEISQY----------------------------------GAHNQRSHVTVSLTAD-
GCH4_NEIMF       PCSKEISQY----------------------------------GAHNQRSHVTVSLTAD-
GCH4_NEIMA       PCSKEISQY----------------------------------GAHNQRSHVTVSLTAD-
GCH4_NEIM0       PCSKEISQY----------------------------------GAHNQRSHVTVSLTAD-
GCH4_NEIG1       PCSKEISQY----------------------------------GAHNQRSHVTVSLTSD-
GCH4_BORA1       PCSKAISEY----------------------------------GAHNQRSHVTVSAVME-
GCH4_BORPD       PCSKAISEY----------------------------------GAHNQRSHVTVSVVLN-
GCH4_BORBR       PCSKAISEY----------------------------------GAHNQRSHVTVSAIVD-
GCH4_BORPA       PCSKAISEY----------------------------------GAHNQRSHVTVSAIVD-
GCH4_BORPE       PCSKAISEY----------------------------------GAHNQRSHVTVSAIVD-
GCH4_POLAQ       PCSKEISEF----------------------------------GAHNQRSHVTMTVVLD-
GCH4_METPP       PCSKEISDY----------------------------------GAHNQRSHVTIRAELME
GCH41_DECAR      PCSKKISDY----------------------------------GAHNQRSHITLEARLR-
GCH4_DICNV       PCSKEISQY----------------------------------GAHNQRSHIVIYAQYN-
GCH4_ALKEH       PCSKEISRY----------------------------------GAHNQRSHVTVTAKTR-
GCH4_HALHL       PCSKEIAER----------------------------------GAHNQRSLVVVTALMD-
GCH4_NITOC       PCSKQISDY----------------------------------GAHNQRSHVTVAVRIE-
GCH4_METCA       PCSKAISER----------------------------------GAHNQRSHVTTAVRMR-
GCH4_AZOSB       PCSKKISAY----------------------------------GAHNQRSHVTVTATLN-
GCH4_AROAE       PCSKKISEY----------------------------------GAHNQRSHVTVTAQTN-
GCH4_METFK       PCSKKISDY----------------------------------GAHNQRSHVTVTALIN-
GCH4_THIDA       PCSKKISEY----------------------------------GAHNQRSHVTVTAKTR-
GCH42_DECAR      PCSKKISEY----------------------------------GAHNQRSHVTVTAKTN-
GCH4_NITEU       PCSKKISDY----------------------------------GAHNQRSHVTISVRTN-
GCH4_NITEC       PCSKKISDY----------------------------------GAHNQRSHVTISVHTN-
GCH4_NITMU       PCSKEVSDD----------------------------------GAHNQRSHISISIRAN-
GCH4_RUTMC       PCSKSISKY----------------------------------GAHNQRSHITIKAKAA-
GCH4_VESOH       PCSKSISKY----------------------------------GAHNQRSHITIKAKVS-
GCH4_GEOMG       PCSKELSRY----------------------------------GAHNQRSHITVRLRY--
GCH4_GEOSL       PCSKELSRY----------------------------------GAHNQRSHITVRVRY--
GCH4_GEOUR       PCSKELSHY----------------------------------GAHNQRSIMTVRVRY--
GCH4_PELPD       PCSRELAIH----------------------------------GAHNQRSIMTVRVRY--
GCH4_SYNC1       PCSREISER----------------------------------GAHNQRSAVKVEVRM--
GCH4_SYNAS       PCSKEISCM----------------------------------GAHNQRSHVTVKVRF--
GCH4_SYNFM       PCSKEISSY----------------------------------GAHNQRGMVRLAVRF--
GCH4_DESOH       PCSKEISDG----------------------------------GAHNQRGEVRLAIRS--
GCH4_MAGMM       PCSKEISAY----------------------------------GAHNQRSHVKVSVQF--
GCH4_AKKM8       PCSKAMSAY----------------------------------GAHNQRGLVTYSVRFA-
GCH4_THEMA       PCSKEISDY----------------------------------GAHNQRAFVEITVKTR-
GCH4_THESQ       PCSKEISDY----------------------------------GAHNQRAFVEITVKTR-
GCH4_THEP1       PCSKEISDY----------------------------------GAHNQRAFVEITVKTR-
GCH4_CALS8       PCSKEISEY----------------------------------GAHNQRAYVTIEVKMR-
GCH4_THEM4       PCSKEISKY----------------------------------NAHNQRANVRIEVETS-
GCH4_FERNB       PCSKEISEY----------------------------------GAHNQRAKCSVTFKSK-
GCH4_PSELT       PCSKEISER----------------------------------GAHNQRAMAWIHIKSK-
GCH4_DESVH       PCSKAISDE----------------------------------GAHSQRAVVRIAVRMT-
GCH4_DESVV       PCSKAISDE----------------------------------GAHSQRAVVRIAVRMT-
GCH4_OLEA2       PCSKAISDE----------------------------------GAHSQRALVRISLRMK-
GCH4_LAWIP       PCSKAISHE----------------------------------GAHSQRSEIYIQLRLE-
GCH4_DESPS       PCSKEISDG----------------------------------GAHNQRAEAIFRVEMK-
GCH41_BURCA      PCSAALSRHWIEQAFLTAFGHEA-RVEPTAVAAWLK-RHAMAATPHSQRSEAVVSVALPA
GCH42_BURCH      PCSAALSRHWIEQAFLTAFGHEA-RVEPTAVAAWLK-RHAMAATPHSQRSEAVVSVALPA
GCH42_BURCC      PCSAALSRHWIEQAFLTAFGHEA-RVEPTAVAAWLK-RHATAATPHSQRSEAVVSVALPA
GCH41_BURL3      PCSAALSRHWVEQAFLAAFGHDD-RVEPAAVAAWLK-RHATAATPHSQRSEAVVSVALPA
GCH4_DELAS       PCSAALSRQLLEQGFLQAFAGEP-LVEPDQVASWLR-RHGTLATAHSQRSEAQVSVDLAC
GCH41_CUPMC      PCSAALTRQLVEQGFAKAFAHER-RVDVARVSAWLR-QHGTLATPHSQRSEASITVDIAV
GCH4_PSEP1       PCSAALSRQLIEDGFLRTFKDQP-LLEASAVAQWLR-SNASLATPHSQRSEARVRVTVPS
GCH4_PSEPK       PCSAALSRQLIEDGFLRTFKDQP-LLEVSAVAQWLR-SNASLATPHSQRSEARVRVTVPA
GCH4_PSE14       PCSAALSRQLLEGAFTARFGRQS-FVDPMQVATWLR-ENASFATPHSQRSVATVQVRVAE
GCH4_PSEU2       PCSAALSRQLLEEAFAARFGRQS-FVDPMQVATWLR-ENASFATPHSQRSVATVQVRVAE
GCH4_PSESM       PCSAALSRQLLEEAFVARFGRQS-FVDPMQVAAWLR-ENASYATPHSQRSVATVQVRVAE
GCH4_XANAC       PCSAALSRQLLSDAFVQQHAGRD-TLPLRDVVQWLQ-DHGTYATPHSQRSVAQVRVELPA
GCH4_XANC5       PCSAALSRQLLSDAFVQQHAGRD-ALALDEVAQWLQ-DHGSYATPHSQRSVAQVRVELPA
GCH4_XANOR       PCSAALSRQLLSDAFVQQHAWCD-ALPLQDVAQWLQ-DHGSYATPHSQRSVAQVCVDLPA
GCH4_XANOM       PCSAALSRQLLSDAFVQQHAWCD-ALPLQDVAQWLQ-DHGSYATPHSQRSVAQVCVDLPA
GCH4_XANOP       PCSAALSRQLLSDAFVQQHAWCD-ALPLQDVAQWLQ-DHGSYATPHSQRSVAQVCVDLPA
GCH4_XANCP       PCSAALSRQLLSKAFAQQHAGQT-ALRVEDVAQWLQ-RNGSYATPHSQRSVAQVRVDLVA
GCH4_XANC8       PCSAALSRQLLSKAFAQQHAGQT-ALRVEDVAQWLQ-RNGSYATPHSQRSVAQVRVDLVA
GCH4_XANCB       PCSAALSRQLLSKAFAQQHAGQT-ALRVEDVAQWLQ-RNGSYATPHSQRSVAQVRVDLVA
GCH4_XYLFT       PCSAALARQMLADAFLQEHVEVS-ALSPETVADWLR-SNGSYATPHSQRSLARIEVALTE
GCH4_XYLF2       PCSAALARQMLADAFLQEHVEVS-ALSPETVADWLR-SNGSYATPHSQRSLARIEVALTE
GCH4_XYLFM       PCSAALARQMLADAFLQEHVEVS-ALSPETVADWLR-SNGSYATPHSQRSLARIEVALTE
GCH4_XYLFA       PCSAALARQMLADAFLQEHVEVS-ALSPETVADWLR-SNGSYATPHSQRSVARIEVALTE
GCH4_ACIAD       PCSAALSRQIIKNGFKADFSSQN-LIPSADIEAWLE-QYATLATPHSQRSIATVVVQPFD
GCH4_COLP3       PCSAALARQLIQKAFQDKFAQQSE-LALTDVHDWLGTTEGIVATPHSQRSVAEVKVKLNS
GCH4_IDILO       PCSAALARQLIQDAFSEKFAGQEQ-VDASIMHEWLGSTEGIVATPHSQRSVAEVKVALSD
GCH4_PSYIN       PCSAALARQLIQQAFSQKYDQQTE-VNKEEIFAWLGSTKGIVATPHSQRSIVEVKVKLNS
GCH4_PSET1       PCSAALARQLIQNAFAEKFSQET--LSQKEALEWLGTTQGIVATPHSQRSIANVKVKLDS
GCH4_HYDCU       PCSAALSRQLIQEAFEQQFNGQD--LDYNQVLEWLGTPEGICATPHSQRSYAQVKLKVNA
GCH4_ALCBS       PCSAALSRQLIQEQFRKDFEESK--VDTDAVLEWLGTEEGILATPHSQRSIAQVRVLLDH
GCH4_PSEAE       PCSAALARQLIQERFDQDFAGQP--LDHASVLAWLGSSAGIVATPHSQRSSAHLRIGLAE
GCH4_PSEAB       PCSAALARQLIQERFDQDFAGQP--LDHASVLAWLGSSAGIVATPHSQRSSAHLRIGLAE
GCH4_PSEA7       PCSAALARQLIQERFAQDFAGQQ--PDHATILAWLGSSDGIVATPHSQRSSAQLRIGLAE
GCH4_PSEF5       PCSAALARQLIQQQFIEDFANRP--LQHADVLAWLGSPQGVVATPHSQRSNAALHLRLDD
GCH4_PSEPF       PCSAALARQLIQQQFVDDFANKP--LQHADVLAWLGSTQGIVATPHSQRSTAQLHLHLDE
GCH4_PSEMY       PCSAALARQLIQQRFAESFAQQP--LNYLDVLDWLGSTQGIVATPHSQRSTATLQLRLAA
GCH4_PSEPG       PCSAALARQLIQQQFQTHFSEQK--IEKAAVLQWLGSAEGIVATPHSQRSTAQVQVRLNS
GCH4_PSEPW       PCSAALARQLIQQQFQADFSGQA--INREAVLEWLGSSHGIVATPHSQRSLAEVNVRLGD
GCH4_PSEE4       PCSAALARQLIQERFDQDFTGQA--VDRQGVRAWLGSSSGIVATPHSQRSMAKLQVRLVG
GCH4_CHRSD       PCSAALARQSIQQAFDEDFTDMP--ISHEAVRTWLGSEQGILATPHSQRSQAHLSLRLAD
GCH4_CITK8       PASAALSRHVAGLQFSKDFGNRIDRLPAAEIADWLV-EKGMPATPHSQRSWAWVSIRLNP
GCH4_KLEPN       PASAALSRHVAGLQFSKDFGNRIDRLPAAEIADWLV-EKGMPATPHSQRSWAWVDIRLNP
GCH4_SERP5       PSSAALSRQLAQQQFQFDFEQAPDKVSQQQVIDWLG-EQGMPGTPHSQRSWAWVTVTLNE
GCH4_HAHCH       PCSAALSRQLFSDAIDNEFSTSR--IDKQELLSW--ALTSTVATPHSQRSYAYLNLLLGN
GCH4_PSEA6       PCSSALAQQALSDAISQRFDDEM--ISKSELTQWITSKTGAVATPHSQRSYAYIKLTLDG
GCH4_BDEBA       PASAALSRQLIQDGFKQNFSTDK-PLDFDVVHSWLGTPQGIVATPHAQRSFARVKAEVGA
GCH4_ROSDO       PCSLELSEHARAT-------------------------RGQLATPHSQRSVARISVEVE-
GCH4_RUEPO       PCSLELSEHARSS-------------------------RGQLATPHSQRSVARLSVVVD-
GCH4_DINSH       PCSLELSEHARQF-------------------------RGQLATPHSQRSVARVSVELTC
GCH4_CERS4       PCSLELSEHARRE-------------------------RGQLATPHSQRSVARISVEVR-
GCH4_CERS1       PCSLELSEHARRE-------------------------RGQLATPHSQRSVARISVEVR-
GCH4_CERS5       PCSLELSEHARRE-------------------------RGQLATPHSQRSVARISVEVR-
GCH4_RUEST       PCSLELSEHARQA-------------------------RGQLATPHSQRSVARISVQME-
GCH4_JANSC       PCSLELSEHARAT-------------------------RGQLATPHSQRSVARISVELQ-
GCH4_PARDP       PCSLELAEHARQM-------------------------RGQLATPHSQRSIARISVVMQ-
GCH4_OPITP       PCSAELAEHARDQ-------------------------RGVYSVPHSQRSKARIVVEET-
                 *.*  ::                                     .* **.          

GCH4_BACSU       ------------------------PAASLPS-DVKADLLHAAESNASARLHPVLKRPDEK
GCH4_BACLD       ------------------------EQAEMPD-DFKAELLAAAETNASAKLHPVLKRPDEK
GCH4_ALKHC       ------------------------EPTEGSD-DWKVTLLEAAESNASSILYPVLKRPDEK
GCH4_OCEIH       ------------------------EDFDEAKIDWKLALLEAAESNASARLHPVLKRTDEK
GCH4_EXIS2       ------------------------DEADDFN--WKQELLDAAESNASAPLHPVLKRPDEK
GCH4_STAAB       ------------------------KDQDIVD-DYKNKILDAMEANASSILYPILKRPDEK
GCH4_STAAC       ------------------------KDQDIVD-DYKNKILDAMEANASSILYPILKRPDEK
GCH4_STAAS       ------------------------KDQDIVD-DYKNKILDAMEANASSILYPILKRPDEK
GCH4_STAAW       ------------------------KDQDIVD-DYKNKILDAMEANASSILYPILKRPDEK
GCH4_STAA8       ------------------------KDQDIVD-DYKNKILDAMEANASSILYPILKRPDEK
GCH4_STAAE       ------------------------KDQDIVD-DYKNKILDAMEANASSILYPILKRPDEK
GCH4_STAAT       ------------------------KDQDIVD-DYKNKILDAMEANASSILYPILKRPDEK
GCH4_STAA3       ------------------------KDQDIVD-DYKNKILDAMEANASSILYPILKRPDEK
GCH4_STAA2       ------------------------KDQNIVD-DYKNKILDAMEANASSILYPILKRPDEK
GCH4_STAAN       ------------------------KDQNIVD-DYKNKILDAMEANASSILYPILKRPDEK
GCH4_STAA9       ------------------------KDQNIVD-DYKNKILDAMEANASSILYPILKRPDEK
GCH4_STAA1       ------------------------KDQNIVD-DYKNKILDAMEANASSILYPILKRPDEK
GCH4_STAAM       ------------------------KDQNIVD-DYKNKILDAMEANASSILYPILKRPDEK
GCH4_STAAR       ------------------------KDQDIVD-DYKNKILDAMEANASSILYPILKRPDEK
GCH4_STAHJ       ------------------------KNNQVVD-DYKDKILDAMEANASSILYPILKRPDEK
GCH4_STAES       ------------------------KNNDVID-DYKDKILDAMEANASSILYPILKRPDEK
GCH4_STAEQ       ------------------------KNNDVID-DYKNKILDAMEANASSILYPILKRPDEK
GCH4_STAS1       ------------------------KDIELID-NYKDVILDAMEANASSILYPILKRPDEK
GCH4_BURM7       ------------------------ADVPV------EDLIRIAEEEASCELWGLLKRPDEK
GCH4_BURM9       ------------------------ADVPV------EDLIRIAEEEASCELWGLLKRPDEK
GCH4_BURMS       ------------------------ADVPV------EDLIRIAEEEASCELWGLLKRPDEK
GCH4_BURPS       ------------------------ADVPV------EDLIRIAEEEASCELWGLLKRPDEK
GCH4_BURP6       ------------------------ADVPV------EDLIRIAEEEASCELWGLLKRPDEK
GCH4_BURP0       ------------------------ADVPV------EDLIRIAEEEASCELWGLLKRPDEK
GCH4_BURMA       ------------------------ADVPV------EDLIRIAEEEASCELWGLLKRPDEK
GCH4_BURP1       ------------------------ADVPV------EDLIRIAEEEASCELWGLLKRPDEK
GCH4_BURTA       ------------------------ADVPV------EDLIRIAEEEASCELWGLLKRPDEK
GCH4_BURCM       ------------------------ADLPV------EALIRIAEEEASCELWGLLKRPDEK
GCH4_BURA4       ------------------------ADLPV------EALIRIAEEEASCELWGLLKRPDEK
GCH42_BURCA      ------------------------ADLPV------EALIRIAEEEASCELWGLLKRPDEK
GCH41_BURCH      ------------------------ADLPV------EALIRIAEEEASCELWGLLKRPDEK
GCH41_BURCC      ------------------------ADLPV------EALIRIAEEEASCELWGLLKRPDEK
GCH42_BURL3      ------------------------ADLPV------EALIRIAEEEASCELWGLLKRPDEK
GCH4_BURVG       ------------------------GDLPV------EALIRIAEEEASCELWGLLKRPDEK
GCH4_BURM1       ------------------------ADVPV------EALIRIAEEEASCELWGLLKRPDEK
GCH4_PARXL       ------------------------GDVAV------EELIRIAEEEASCELWGLLKRPDEK
GCH4_PARP8       ------------------------DDVPV------EDLIRIAEEEASCELWGLLKRPDEK
GCH4_CUPNH       ------------------------GELPV------EALVRMAEEEASCELWGLLKRPDEK
GCH4_CUPPJ       ------------------------GELPV------EALVRMAEEEASCELWGLLKRPDEK
GCH42_CUPMC      ------------------------GDLDV------EALVRMAEEEASCELWGLLKRPDEK
GCH4_RALSO       ------------------------ADTPV------EALIRMAEEEASCELWGLLKRPDEK
GCH4_HERAR       ------------------------GDLVV------EELIAKIEEQASCELYGLLKRPDEK
GCH4_JANMA       ------------------------DDLVV------EELIAQIEAQASCELFGLLKRPDEK
GCH4_NEIMB       ------------------------AEVGI------EEVIDYVEAQASCQLYGLLKRPDEK
GCH4_NEIMF       ------------------------AEVGI------EEVIDYVEAQASCQLYGLLKRPDEK
GCH4_NEIMA       ------------------------AEVGI------EEVIDYVEAQASCQLYGLLKRPDEK
GCH4_NEIM0       ------------------------AEVGI------EEVIDYVEAQASCQLYGLLKRPDEK
GCH4_NEIG1       ------------------------AEVGI------EEVIDYVETQASCQLYGLLKRPDEK
GCH4_BORA1       ------------------------GDVAM------DAIIRLVEDEGSCELWGLLKRPDEK
GCH4_BORPD       ------------------------GDLAM------DRIIRLVEDEGSCELWGLLKRPDEK
GCH4_BORBR       ------------------------GDFRM------DELIRLVEDEASCELWGLLKRPDEK
GCH4_BORPA       ------------------------GDFRM------DELIRLVEDEASCELWGLLKRPDEK
GCH4_BORPE       ------------------------GDFRM------DELIRLVEDEASCELWGLLKRPDEK
GCH4_POLAQ       ------------------------TQTKMTV----EDLVSAAEREASSELWGLLKRPDEK
GCH4_METPP       PPGDRRRPPPPGGGESTRERPVVDSAVELGF----EALVRFAEASASSEIWGLLKRPDEK
GCH41_DECAR      ------------------------SPMSI------EDLVRIAEEEASCEVFGLLKRPDEK
GCH4_DICNV       ------------------------PNQPFSI----EDLIHIAEEGASCPIWSLLKRPDEK
GCH4_ALKEH       ------------------------DLLWV------EDLIDLVEEEASCELYGLLKRPDEK
GCH4_HALHL       ------------------------GFVWL------EELIDLVEREGSCELYGLLKRPDEK
GCH4_NITOC       ------------------------GFIWL------EDIIDLVEEEASCEIYGLLKRPDEK
GCH4_METCA       ------------------------DFVWI------EELIEWVEAEASSPIYGLLKRPDEK
GCH4_AZOSB       ------------------------DHLWI------EDVVQLVEGQASCEVYGLLKRPDEK
GCH4_AROAE       ------------------------SFLWI------EELVQLVESQASCQLYGLLKRPDEK
GCH4_METFK       ------------------------DFIWV------EDIIRMVEDQASCEVYGLLKRPDEK
GCH4_THIDA       ------------------------GFLWI------EDLVRKVEDQASCELFGLLKRPDEK
GCH42_DECAR      ------------------------DFMWI------EEIVQLVEQEASCELFGLLKRPDEK
GCH4_NITEU       ------------------------SFIWI------EDIIRIAEEQASCELYGLLKRPDEK
GCH4_NITEC       ------------------------SFVWI------EDVIRIAEEQASCELFGLLKRPDEK
GCH4_NITMU       ------------------------HFVWI------EDLIRIAEDQASCELYGLLKRSDEK
GCH4_RUTMC       ------------------------KDKTLHI----EDLIDLAERKASCELYAILKRDDEK
GCH4_VESOH       ------------------------KGRTLHI----EDLIDLAERKASCELYALLKRDDEK
GCH4_GEOMG       -----------------------TDFIWI------EDLVAMIEECGSSPVWSLLKRVDEQ
GCH4_GEOSL       -----------------------AGFVWI------EELVELIEGCGSSPVWSLLKRADEK
GCH4_GEOUR       -----------------------REFVWI------EDLIEIVEGCGSSPVYSLLKREDEK
GCH4_PELPD       -----------------------RDFIWI------EDLVELIEQCGSSPLYSLLKRVDEK
GCH4_SYNC1       -----------------------SKFIWI------EDLISWIEECGSAPVYALLKREDEK
GCH4_SYNAS       -----------------------KKFFWL------EDIIRLVETSASGEVYSLLKRVDEK
GCH4_SYNFM       -----------------------KKFVWI------EDLVRLVECAASSEVYSVLKRPDEK
GCH4_DESOH       -----------------------KKFVWI------EDLIQLVEAAASCELYSVLKRVDEK
GCH4_MAGMM       -----------------------SQFVWI------EEVVDLVERNASCELFTILKRPDEK
GCH4_AKKM8       -----------------------SRPVWI------EDLIDLVESCASCSLFSVLKRPDEK
GCH4_THEMA       ------------------------KFIWF------EDLVEIAEKNASSPLYTLLKRPDEK
GCH4_THESQ       ------------------------KFIWF------EDLVEIAEKNASSPLYTLLKRPDEK
GCH4_THEP1       ------------------------KFIWF------EDLVEIAEKNASSPLYTLLKRPDEK
GCH4_CALS8       ------------------------RFMWI------EELVEIAESSASCPLYSILKRPDEK
GCH4_THEM4       ------------------------ELVWF------EELIEIAEDSASVPLFSLLKRPDEK
GCH4_FERNB       ------------------------EMVWI------EDIIEIIEESASAPIFTLLKRADEK
GCH4_PSELT       ------------------------KMIWF------EELIDAAEQAASSPVFTILKRVDEK
GCH4_DESVH       ------------------------RFSWL------EEFIDLAEVSGSSPVYTLLKREDEK
GCH4_DESVV       ------------------------RFSWL------EEFIDLAEVSGSSPVYTLLKREDEK
GCH4_OLEA2       ------------------------EFCWL------EEFIELAERSASSPVYTLLKREDEK
GCH4_LAWIP       ------------------------QFRFI------EDFIVLAESSASSPLYSLLKRADEK
GCH4_DESPS       ------------------------EHLWL------EDLIQLVEESASCQVYSVLKRPDEK
GCH41_BURCA      DG----------------------------TTLGLLDLIDRVEQALGTPVQTAVKRADEQ
GCH42_BURCH      DG----------------------------TTLGLLDLIDRVEQALGTPVQTAVKRADEQ
GCH42_BURCC      DG----------------------------TTLGLLDLIDRVEQALGTPVQTAVKRADEQ
GCH41_BURL3      DG----------------------------ATLGLIDLIDRIEHALGTPVQTAVKRADEQ
GCH4_DELAS       DA----------------------------PDLGILPLIARVEQALGTPVQTAVKRADEQ
GCH41_CUPMC      DL----------------------------PNLGLLDLVDHIERALGTPVQTAVKRADEQ
GCH4_PSEP1       DA----------------------------PDLGLLALIDQVEGALRTPVQTAVKRADEQ
GCH4_PSEPK       DA----------------------------PDLGLLALIDHVEGALRTPVQTAVKRADEQ
GCH4_PSE14       QA----------------------------TELGLMTLIDAVEQALGTPVQTAVKRADEQ
GCH4_PSEU2       QA----------------------------AELGLMTLIDLVEQALGTPVQTAVKRADEQ
GCH4_PSESM       QA----------------------------TEMGLMALIDTVEQALGTPVQTAVKRADEQ
GCH4_XANAC       DA----------------------------QRLAIQQLVGLCEQALATPVQAAVRRPDEQ
GCH4_XANC5       DA----------------------------QRLAIRQLVGLCEQALATPVQAAVRRPDEQ
GCH4_XANOR       DT----------------------------QGFAIQELIGLCEQALATPVQAAVRRPDEQ
GCH4_XANOM       DT----------------------------QGFAIQELIGLCEQALATPVQAAVRRPDEQ
GCH4_XANOP       DT----------------------------QGFAIQELIGLCEQALATPVQAAVRRPDEQ
GCH4_XANCP       RV----------------------------QSFDIRALVLLCESALATPVQAAVRRIDEQ
GCH4_XANC8       RV----------------------------QSFDIRALVLLCESALATPVQAAVRRIDEQ
GCH4_XANCB       RV----------------------------QSFDIRALVLLCESALATPVQAAVRRIDEQ
GCH4_XYLFT       QA----------------------------VELGLPALVDCAERILSTPVQAAVRRVDEQ
GCH4_XYLF2       QA----------------------------VELGLPALVDCAERILSTPVQAAVRRVDEQ
GCH4_XYLFM       QA----------------------------VELGLPALVDCAERILSTPVQAAVRRVDEQ
GCH4_XYLFA       QA----------------------------VELGLPALVDCAERILSTPVQAAVRRVDEQ
GCH4_ACIAD       YA----------------------------HDINFVDLIDSIENTLKTPTQTAVKRADEQ
GCH4_COLP3       SI----------------------------NDFPITEIVDLVENSLKTPVQAAVKREDEQ
GCH4_IDILO       SV----------------------------NDFPIVELIDAIEGALKTPVQAAVKREDEQ
GCH4_PSYIN       LN----------------------------QSFPIIELIDLIEKTLKTPVQAAVKREDEQ
GCH4_PSET1       NI----------------------------TQFDVVNLINTIEDELKTPVQAAVKREDEQ
GCH4_HYDCU       E-----------------------------HPLNLSNVINQIEDAVKTPVQSTVKREDEQ
GCH4_ALCBS       NVG---------------------------DAFPITALIDSIEGALKTPVQTAVKRVDEQ
GCH4_PSEAE       DC----------------------------IGLPLEELADLGESALGTAVQTAVKRADEQ
GCH4_PSEAB       DC----------------------------IGLPLEELADLGESALGTAVQTAVKRADEQ
GCH4_PSEA7       DC----------------------------AGLPLEELADLGECALGTAVQTAVKRADEQ
GCH4_PSEF5       FI----------------------------DELPLIALINDAENALGTAVQTAVKRADEQ
GCH4_PSEPF       FV----------------------------DELPLTSIINDAEAALGTAVQTAVKRADEQ
GCH4_PSEMY       DC----------------------------IDLPLLALLEAAERALGTPVQTAVKRADEQ
GCH4_PSEPG       NQ----------------------------QVLPITELIDRIEASLGTAVQTAVKRADEQ
GCH4_PSEPW       RL----------------------------EVLPVTELIDRIEASLGTAVQTAVKRADEQ
GCH4_PSEE4       DE------------------------------LPVTVLIDKAEAALGTAVQTAVKRADEQ
GCH4_CHRSD       DL----------------------------ETLPVTALIDTVEDALGTALQTAVKRVDEQ
GCH4_CITK8       EA----------------------------KSLPVIELIDYAEVALGTAVQTVVKRSDEQ
GCH4_KLEPN       EA----------------------------KSLPVLELIDYAEVALGTAVQTVVKRSDEQ
GCH4_SERP5       GE----------------------------AELPVVNLIDRIEHALGTPLQTLVKRQDEQ
GCH4_HAHCH       HG-----------------------------WPSLSSFIMQIEEAIGTPVQTMVKRTDEQ
GCH4_PSEA6       DA-----------------------------LPNLPELITLLETTIGTPVQTAVKRQDEQ
GCH4_BDEBA       NY-------------------------------NYGDLIDIVEEALQTAVQGAVKREDEQ
GCH4_ROSDO       NDG---------------------------QCLWFEDLIEACRRAVPTETQVMVKREDEQ
GCH4_RUEPO       GDA---------------------------SCLWFEDLIALCRRAVPTETQVMVKREDEQ
GCH4_DINSH       GAD---------------------------DCLWFEDLVELCREAIPTETQVMVKREDEQ
GCH4_CERS4       -QG---------------------------KCLWFEDLLDLVRSAVPTETQVMVKREDEQ
GCH4_CERS1       -QG---------------------------KCLWFEDLLDLVRSAVPTETQVMVKREDEQ
GCH4_CERS5       -PG---------------------------KCLWFEDLIELARAAVPTETQVMVKREDEQ
GCH4_RUEST       QDG---------------------------GCLWFEDLIDHCRRAVPTETQVMVKREDEQ
GCH4_JANSC       --G---------------------------QGVWFEDLIEMARSGVPTETQVMVKREDEQ
GCH4_PARDP       --G---------------------------DTLWFEDMVTLCRRAVATETQVMVKREDEQ
GCH4_OPITP       -QG---------------------------KKIWIEDVHAHCLRALQTETQVMVKREDEQ
                                                      .               ::* **:

GCH4_BACSU       AVTETAYENPRFVEDLARLIAADLFELEWVSAFEIECRNEESIHLHDAYAKLCFSKEVDK
GCH4_BACLD       RVTEQAYENPRFVEDVLRLTAADLYEMDWISAFEIECRNEESIHLHDAVARLSFSKC---
GCH4_ALKHC       AVTEKAYENPRFVEDMVRLTAADLYENETIKAFTVECRNEESIHQHDAIATLSYSKK---
GCH4_OCEIH       MVTEQAYENPRFVEDMVRLIAADLYEMPFVSKFHVSCRNEESIHMHDAIASITYDKSSE-
GCH4_EXIS2       RVTEMAYENPRFVEDMVRLIAADLYEMDPIASFFVECRNEETIHQHDAIARITFDKDAQ-
GCH4_STAAB       RVTERAYENPRFVEDLIRLIAADLVEFDWLDGFDIECRNEESIHQHDAFAKLKYRK----
GCH4_STAAC       RVTERAYENPRFVEDLIRLIAADLVEFDWLDGFDIECRNEESIHQHDAFAKLKYRK----
GCH4_STAAS       RVTERAYENPRFVEDLIRLIAADLVEFDWLDGFDIECRNEESIHQHDAFAKLKYRK----
GCH4_STAAW       RVTERAYENPRFVEDLIRLIAADLVEFDWLDGFDIECRNEESIHQHDAFAKLKYRK----
GCH4_STAA8       RVTERAYENPRFVEDLIRLIAADLVEFDWLDGFDIECRNEESIHQHDAFAKLKYRK----
GCH4_STAAE       RVTERAYENPRFVEDLIRLIAADLVEFDWLDGFDIECRNEESIHQHDAFAKLKYRK----
GCH4_STAAT       RVTERAYENPRFVEDLIRLIAADLVEFDWLDGFDIECRNEESIHQHDAFAKLKYRK----
GCH4_STAA3       RVTERAYENPRFVEDLIRLIAADLVEFDWLDGFDIECRNEESIHQHDAFAKLKYRK----
GCH4_STAA2       RVTERAYENPRFVEDLIRLIAADLVEFDWLDGFDIECRNEESIHQHDAFAKLKYRK----
GCH4_STAAN       RVTERAYENPRFVEDLIRLIAADLVEFDWLDGFDIECRNEESIHQHDAFAKLKYRK----
GCH4_STAA9       RVTERAYENPRFVEDLIRLIAADLVEFDWLDGFDIECRNEESIHQHDAFAKLKYRK----
GCH4_STAA1       RVTERAYENPRFVEDLIRLIAADLVEFDWLDGFDIECRNEESIHQHDAFAKLKYRK----
GCH4_STAAM       RVTERAYENPRFVEDLIRLIAADLVEFDWLDGFDIECRNEESIHQHDAFAKLKYRK----
GCH4_STAAR       RVTERAYENPRFVEDLIRLIAADLVEFDWLEGFDIECRNEESIHQHDAFAKLKYRK----
GCH4_STAHJ       RVTERAYENPRFVEDLIRLIAADLVEFDWIDGFDIECRNEESIHQHDAFAKLKYRK----
GCH4_STAES       RVTERAYENPRFVEDLIRLIAADLVEFDWIEGFDIECRNEESIHQHDAFARLKYRK----
GCH4_STAEQ       RVTERAYENPRFVEDLIRLIAADLVEFDWIEGFDIECRNEESIHQHDAFARLKYRK----
GCH4_STAS1       SVTERAYENPRFVEDLIRLIAADLVDFDWLDGFDIECRNEESIHQHDAFAKLKYRK----
GCH4_BURM7       FVTERAYENPKFVEDLVRDVARRLDADERIVAYVLEAENFESIHNHSAYALIERDKRRGA
GCH4_BURM9       FVTERAYENPKFVEDLVRDVARRLDADERIVAYVLEAENFESIHNHSAYALIERDKRRGA
GCH4_BURMS       FVTERAYENPKFVEDLVRDVARRLDADERIVAYVLEAENFESIHNHSAYALIERDKRRGA
GCH4_BURPS       FVTERAYENPKFVEDLVRDVARRLDADERIVAYVLEAENFESIHNHSAYALIERDKRRGA
GCH4_BURP6       FVTERAYENPKFVEDLVRDVARRLDADERIVAYVLEAENFESIHNHSAYALIERDKRRGA
GCH4_BURP0       FVTERAYENPKFVEDLVRDVARRLDADERIVAYVLEAENFESIHNHSAYALIERDKRRGA
GCH4_BURMA       FVTERAYENPKFVEDLVRDVARRLDADERIVAYVLEAENFESIHNHSAYALIERDKRRGA
GCH4_BURP1       FVTERAYENPKFVEDLVRDVARRLDADERIVAYVLEAENFESIHNHSAYALIERDKRRGA
GCH4_BURTA       FVTERAYENPKFVEDLVRDVARRLDADERIVAYVLEAENFESIHNHSAYALIERDKRRRA
GCH4_BURCM       FVTERAYENPKFVEDLVRDVAQRLDADERVVAYVLEAENFESIHNHSAYALIERDKRHAA
GCH4_BURA4       FVTERAYENPKFVEDLVRDVAQRLDADERVVAYVLEAENFESIHNHSAYALIERDKRHAA
GCH42_BURCA      FVTERAYENPKFVEDLVRDVAQRLDADERVVAYVLEAENFESIHNHSAYALIERDKRQAA
GCH41_BURCH      FVTERAYENPKFVEDLVRDVAQRLDADERVVAYVLEAENFESIHNHSAYALIERDKRQAA
GCH41_BURCC      FVTERAYENPKFVEDLVRDVAQRLDADERVVAYVLEAENFESIHNHSAYALIERDKRQAA
GCH42_BURL3      FVTERAYENPKFVEDLVRDVAQRLDADERVAAYVLEAENFESIHNHSAYALIERDKRQAA
GCH4_BURVG       FVTERAYENPKFVEDLVRDVAQRLDADERVIAYVLEAENFESIHNHSAYALIERDKRLAA
GCH4_BURM1       FVTERAYENPKFVEDLVRDVAARLDADARIVAYVLEAENFESIHNHSAYALIERDKRHAA
GCH4_PARXL       FVTERAYENPKFVEDLVRDVAQRLNADERIVAYVLEAENFESIHNHSAYAVIERDKRAG-
GCH4_PARP8       FVTERAYENPKFVEDLVRDVAQRLNDDHRIVAYVLEAENFESIHNHSAYAVIESDKRLR-
GCH4_CUPNH       FVTERAYENPKFVEDLVRDIAMRLNADDRIVAYVLEAENFESIHNHSAYAVIERDKRVD-
GCH4_CUPPJ       FVTERAYENPKFVEDLVRDIAMRLNADERIVAYVLEAENFESIHNHSAYAVIERDKRLEP
GCH42_CUPMC      FVTERAYENPKFVEDLVRDIAMRLNADDRIVAYTLEAENFESIHNHSAYAVIEHDKRHQ-
GCH4_RALSO       FVTERAYENPKFVEDLVRDIAMRLNEDDRIVAYTLEAENFESIHNHSAYALIERDKRRAG
GCH4_HERAR       YVTERAYDNPKFVEDLVRDVAGMLNKDERVLAYTLEAENFESIHNHSAYALIERDKRLS-
GCH4_JANMA       YVTERAYDNPKFVEDLVRDVAVMLNNEARVLAYTLEAENFESIHNHSAYALIELDKRLA-
GCH4_NEIMB       YVTEKAYENPKFVEDMVRDVATSLIADKRIKSFVVESENFESIHNHSAYAYIAYP-----
GCH4_NEIMF       YVTEKAYENPKFVEDMVRDVATSLIADKRIKSFVVESENFESIHNHSAYAYIAYP-----
GCH4_NEIMA       YVTEKAYENPKFVEDMVRDVATSLIADKRIKSFVVESENFESIHNHSAYAYIAYP-----
GCH4_NEIM0       YVTEKAYENPKFVEDMVRDVATSLIADKRIKSFVVESENFESIHNHSAYAYIAYP-----
GCH4_NEIG1       YVTEKAYENPKFVEDMVRDVATSLIADKRIKSFVVESENFESIHNHSAYAYIAYP-----
GCH4_BORA1       YVTERAYDNPKFVEDLVRDVAARLKAHPSVARFCVEAENFESIHNHSAYAVVEG------
GCH4_BORPD       FVTERAYDNPKFVEDLVRDVAARLAAHPGVARYRVEAENFESIHNHSAYAVVEG------
GCH4_BORBR       YVTERAYDNPKFVEDLVRDVAARLKAHPGIGRFRVEAENFESIHNHSAYAVVEG------
GCH4_BORPA       YVTERAYDNPKFVEDLVRDVAARLKAHPGIGRFRVEAENFESIHNHSAYAVVEG------
GCH4_BORPE       YVTERAYDNPKFVEDLVRDVAARLKAHPGIGRFRVEAENFESIHNHSAYAVVEG------
GCH4_POLAQ       WVTERSYSNPKFVEDLVRDVAGRLKADTRIQSFVVDAENFESIHNHSAFARISHKK----
GCH4_METPP       WITERAYENPKFVEDLVRDVALRLNADARIGRYRVEVENFESIHNHSAFAVIERE-----
GCH41_DECAR      WVTERAYDNPKFVEDLVRDIALRLMNEPRIAEWKVASENFESIHNHSAYAELYGCNE---
GCH4_DICNV       YITERAYEHPKFVEDIVRDIAMVLNDDPRISFYRISSENFESIHNHSAFALIEHQK----
GCH4_ALKEH       YVTERAYENPKFVEDLVRDVAIRLNDEDRVLAYNVTAENFESIHNHSAFAEIEHDKTGEP
GCH4_HALHL       HVTERAYDNPKFVEDVVRDIAGRLNDDGRIAAYSVTSENYESIHNHSAFALIEQDKRGR-
GCH4_NITOC       YVTERAYDNPKFVEDMVRDVAARLNQDDRVSAYRVESENFESIHNHSAYAMIEREK----
GCH4_METCA       YVTEYAYDHPRFVEDLVRGVAARLDTEPRIAAYAVEVENFESIHNHSAYALIERDKRTAD
GCH4_AZOSB       YVTERAYDNPKFVEDMVRDVAGLLNKEVRIDAYAVESENFESIHNHSAYALIERDKRIEA
GCH4_AROAE       YVTEHAYDNPKFVEDMVRDVAGLLNAEARIDCYRVESENFESIHNHSAYALIECDKRLVV
GCH4_METFK       YVTERAYDNPKFVEDIVRDVAAQLNIETRIVSYTVESENFESIHNHSAYALIEKDKRK--
GCH4_THIDA       YVTERAYDNPKFVEDIVRDVAAAMNAEPLIDAYVVEAENFESIHNHSAYALIEHDKRKK-
GCH42_DECAR      YVTERAYDNPKFVEDMVRDVAARLNAEARVDAYVVESENFESIHNHSAYALIENDKKNPL
GCH4_NITEU       YVTERAYNNPKFVEDIVRDVAEVLNHDDRIDAYIVESENFESIHNHSAYALIERDKRIR-
GCH4_NITEC       YVTEKAYNNPKFVEDIVRDVAEILNHDDRIDAYVVESENFESIHNHSAYALIERDKRK--
GCH4_NITMU       YVTEKAYGNPKFVEDAVRDIASVLDRDERIDAYTVEAENFESIHNHSAYALIECDKLKN-
GCH4_RUTMC       VVTERAYDNPAFVEDLVRDIAVDLNADDKISYYRLESENFESIHNHSAYALIENQKC---
GCH4_VESOH       MVTERAYDNPAFVEDLVRDIAVDLNADDKISYYCLESENFESIHNHSAYALIENLKC---
GCH4_GEOMG       YVTERAYENPKFVEDIVREVTQKLLAHDAITWFSVEAENFESIHKHSAYAAIERDKKMT-
GCH4_GEOSL       FVTERAYENPKFVEDIVREATLALAAHEAITWFSVEAENFESIHKHSAYAAIEQDKRKA-
GCH4_GEOUR       FVTEKAYENPKFVEDMVREATQKLLAMEKITWFSVEAENFESIHNHSAYAAIERDKREKG
GCH4_PELPD       YVTEQAYENPRFVEDMVREAYSRLAGMENITWFSVETENFESIHNHSAYAAVELDRRG--
GCH4_SYNC1       AVTEQAYDNPMFVEDIVRAVTLKLKSAPEITWFRVECENFESIHNHSAYAMVEFPPRTED
GCH4_SYNAS       YVTEQGYANPMFVEDVVRNVAERLNENSNLTWYSVEAENFESIHNHNAYAYVEKE-----
GCH4_SYNFM       FVTESAFDNPKFVEDVVRDIAKELKADQNISWFLVDVENFESIHNHSAYACIERSK----
GCH4_DESOH       WVTEKGYQNPKFVEDIVRDVAVALKNDTNITWFNISVENFESIHNHSAYATITCGRINP-
GCH4_MAGMM       FVTEKAYDNPKFVEDMVRDLADELTHDPRISWFAVESENFESIHNHSAYAFIEGGQRS--
GCH4_AKKM8       WVTEKAYENPVFVEDLVRNVALKTQSHSAFSWYRVEAENFESIHNHQAYAVIERDLRS--
GCH4_THEMA       FVTEKAYENPRFVEDVARDVALELEKDPRITWYRVYVESMESIHNHNAFACVEKGDFVLE
GCH4_THESQ       FVTEKAYENPRFVEDVARDVALELEKDPRITWYRVYVESMESIHNHNAFACVEKGDFVLE
GCH4_THEP1       FVTEKAYENPRFVEDVARDVALKLEKDPRITWYRVYVESMESIHNHNAFACVEKGDFVLE
GCH4_CALS8       WVTERAYQNPRFVEDLLREVVVKISGDKRIKWYKVFVESIESIHNHNAFAYIE-GENTK-
GCH4_THEM4       FVTEKAYENPKFVEDVARDIAIRLKDNPKINWFKVEVESYESIHNHNAFACVDSTIMEV-
GCH4_FERNB       YVTEHAYDNPKFVEDVARDVALRLKKYDKIEWYKVEVESFESIHAHNAYACLTSDEIEKI
GCH4_PSELT       FVTEHAYDNPRFVEDVAREIAVRLNRDERISWYRVEVESFESIHDHSAYACVMKDKED--
GCH4_DESVH       YVTEDAFAHPTFVEDVVRAAAQRLERHPQISWFRVEVESFESIHCHNAFASIERTITPET
GCH4_DESVV       FVTEDAFAHPTFVEDVVRAAAQRLERHPQISWFRVEVESFESIHCHNAFASIERTITPET
GCH4_OLEA2       FVTEDAFAHPTFVEDVVRAAAQQLEAHPSVSWFRVEVESIESIHNHSAFARIEKHK----
GCH4_LAWIP       YVTEDAFAHPKFVEDVVRNISSKLITVTDVLGFRVEVESFESIHAHNAFAYIEHEFIC--
GCH4_DESPS       YVTEKAFDNPMFVEDVVRKIAVRAGEHPLIHAFSISVESFESIHKHNAYAYVNSEDLNL-
GCH41_BURCA      AFAVLNGGNLMFVEDAARRVQAALEDR--HASPRVRVRHLESLHPHDAVAWAAPLREGAD
GCH42_BURCH      AFAVLNGGNLMFVEDAARRVQAALEDR--HASPRVRVRHLESLHPHDAVAWAAPLREGAD
GCH42_BURCC      AFAVLNGGNLMFVEDAARRVQAALEDR--HASPRVRVRHLESLHPHDAVAWAAPLREGAD
GCH41_BURL3      AFAVLNGGNLMFVEDAARRVQAALDGH--HANPRVHVRHLESLHPHDAVAWAAPVREGAD
GCH4_DELAS       AFAALNGRNLMFVEDAARRIQAALEGI--YARPRVHVRHMESLHPHDAVAWA--------
GCH41_CUPMC      AFAALNGQNLMFVEDAARRIQVALDGR--FANPRVHVRHLESLHPHDAVAWAAPLQMKHS
GCH4_PSEP1       AFAALNGQNLMFVEDAARRIQASLRG---YRDSQVHVRHLESLHPHDASAWSAPQASAPD
GCH4_PSEPK       AFAALNGQNLMFVEDAARRIQASLHG---YRDSQVHVRHLESLHPHDASAWSAPQAAAPD
GCH4_PSE14       AFARLNGQNLMYVEDAARKVQQALEGR--YAASSVSVRHFESLHPHDAAAQTSNYLS---
GCH4_PSEU2       AFARLNGQNLMYVEDAARKVQQALEGR--YAASSVSVRHFESLHPHDAAAQTSNYLS---
GCH4_PSESM       AFARLNGQNLMYVEDAARKIQQALEGR--YPASSVSVRHFESLHPHDAAAQTSSYLS---
GCH4_XANAC       AFARLNGANLMCVEDAARRLRKPLAEH--YAAFHVAVRHLESLHAHDAVAETGSDDAVLG
GCH4_XANC5       AFARLNGANLMYVEDAARRLRQQLAEH--YAAFHVAVRHLESLHAHDAVAETDSDDAVLG
GCH4_XANOR       AFARLNGANLMYVEDAARRLRKQLAEH--YATFHVAVRHLESLHAHDAVAETGSDDETFF
GCH4_XANOM       AFARLNGANLMYVEDAARRLRKQLAEH--YATFHVAVRHLESLHAHDAVAETGSDDETFF
GCH4_XANOP       AFARLNGANLMYVEDAARRLRKQLAEH--YATFHVAVRHLESLHAHDAVAETGSDDETFF
GCH4_XANCP       AFARLNGANLMYVEDAARRLRKELAER--YASFHVAVRHFESLHAHDAVAETGSDADVFH
GCH4_XANC8       AFARLNGANLMYVEDAARRLRKELAER--YASFHVAVRHFESLHAHDAVAETGSDADVFH
GCH4_XANCB       AFARLNGANLMYVEDAARRLRKELAER--YASFHVAVRHFESLHAHDAVAETGSDADVFH
GCH4_XYLFT       AFARLNGANLMYVEDATRRLQHGLAIH--YSAFRVHVRHLESLHPNDAVASTADE-----
GCH4_XYLF2       AFARLNGANLMYVEDATRRLQHGLAIH--YSAFRVHVRHLESLHPNDAVASTADE-----
GCH4_XYLFM       AFARLNGANLMYVEDATRRLQHGLAIH--YSAFRVHVRHLESLHPHDAVASTADE-----
GCH4_XYLFA       AFARLNGANLMYVEDATRRLQHGLAIH--YSAFRVHVRHLESLHPHDAVASTVDE-----
GCH4_ACIAD       AFAKLNGENLMFVEDAARRLKMLLDQK--YKFWSAQVVHQESLHPHDAIAVAISS-----
GCH4_COLP3       EFARLNGQNLMFCEDAARRLQHSLNQTDQFDDFWLRINHLESLHAHDAVSVTTKGIKDGY
GCH4_IDILO       EFARLNGQNLMFCEDASRRLQHQLNQMSNFRDFWLRVNHYESLHAHDAVSVTTKGVPGGY
GCH4_PSYIN       EFALLNGQNLMFCEDAARHLQHSLHQETKFDDFWLRVNHYESLHAHDAVAMTTKGIEGGY
GCH4_PSET1       EFARLNGQNLMFCEDAARKIK-ALLETQQYSDYWLQINHYESLHAHDALAIAVKGVAGGY
GCH4_HYDCU       EFARLNATNLMFCEDAARRLQAKLESCPEYKDYWVRVNHLESLHPHDAVAIVTKNVPGGY
GCH4_ALCBS       EFALLNGQNLMFCEDAARRLKTALNPQSCYKDFWLRVNHLESLHAHNAVAIVTKEVEGGY
GCH4_PSEAE       AFALANGQNLMFCEDAVRRLHRALQGYPQASRFSIRVVHAESLHAHDAVAESHWQRGAA-
GCH4_PSEAB       AFALANGQNLMFCEDAVRRLHRALQGYPQASRFSIRVVHAESLHAHDAVAESHWQRGAA-
GCH4_PSEA7       AFALANGQNLMFCEDAVRRLHRALRGYPQAREFSVRVVHAESLHAHDAVAESHWQRGAA-
GCH4_PSEF5       AFALANGQNLMFCEDAARRLNLALRRSPGINAFQLRVVHAESLHAHDAVAESRWNWEA--
GCH4_PSEPF       AFALANGQNLMFCEDAARRLNLALRGSPGISQFHVRVIHAESLHAHDAVAESHWRREQP-
GCH4_PSEMY       AFALANGQNLMFCEDAARRLHRALRQLPQASAFRVRVVHAESLHAHDAVAESRWNWS---
GCH4_PSEPG       AFALANGQNLMFCEDAARRLHQALRQIEWSKAFKLRVEHAESLHAHDAVATSQWQWDVSC
GCH4_PSEPW       AFALANGQNLMFCEDAARRLHQALQQMDWAKAFKLRVEHAESLHAHDAVAASQWQW----
GCH4_PSEE4       AFALANGQNLMFCEDAARRLNLALRQLDWVAGFTVRVEHAESLHAHDAVAVSRFQR----
GCH4_CHRSD       AFALANGQNLMFCEDAARRVRHALQARDEVQGFRVRIVHAESLHAHDAVAHAEWNWTPNS
GCH4_CITK8       AFAVANGQNLMFCEDAARRLNNVFRCAPFCEAFDIRVEHQESLHPHNAVARIHWKGSKNV
GCH4_KLEPN       AFAVANGQNLMFCEDAARRLNNVFRCASFCEAFDIRVEHQESLHPHNAVARIHWKGSKNV
GCH4_SERP5       AFALANGQNLMFCEDAARRLYRMLRSQCHHRAFSLRVEHQESLHAHNAVAELSWQEAGNA
GCH4_HAHCH       EFARLNADNLMFCEDAARNVKTLLEQSSWIEDYWFKVEHQESLHAHNAVVIDQKYSKGAM
GCH4_PSEA6       AFAKLNAENLMFCEDAARRLKRALERKENVLDYWFKVEHQESLHAHNAVAIDFKDNADED
GCH4_BDEBA       EFALRNGQNLMFCEDAARRVKEALDAKADVLDYVAEFSHVESLHPHNAVSHISKGLKLRS
GCH4_ROSDO       AFAELNAANPIFVEDAARLFCEQLHSDTRIGDFRVIASHQESLHSHDAVSVLMEGETFKS
GCH4_RUEPO       AFAELNAANPIFVEDAARLFCAELLADHRIGDFRVVASHQESLHSHDAVSVLTEGATFAT
GCH4_DINSH       AFAELNAANPIFVEDAARSFCLALQRDDRIGDFRVVASHQESLHSHDAVSVLTEGPTFAS
GCH4_CERS4       AFAELNAANPIFVEDAARSFCQALQSDPRIGDFRVVASHQESLHSHDAVSVLTEGPTFAA
GCH4_CERS1       AFAELNAANPIFVEDAARSFCQALQSDPRIGDFRVVASHQESLHSHDAVSVLTEGPTFAA
GCH4_CERS5       AFAELNAANPIFVEDAARSFCQALQADPRIGDFRVVASHQESLHSHDAVSVLTEGPTFAA
GCH4_RUEST       AFAELNAANPIFVEDAARLFCEALQSDARVGDFRVVASHQESLHSHDAVSVLTQGTMFAA
GCH4_JANSC       AFAELNAANPIFVEDAARLFAEQLQAHSGVGDFRVMASHQESLHSHDAVSLLTEGDTFAE
GCH4_PARDP       AFAELNAANPIFVEDAVRAFAAELMAEPRIGDFRVVASHQESLHSHDAVSVLTQGETFAH
GCH4_OPITP       AFAELNGAHLKFVEDAARLLYREFDADEKIADFRIACSHLESLHSHDAVSVICKGVKGGF
                  .:     :    **  *                      *::* :.*            

GCH4_BACSU       I--------------
GCH4_BACLD       ---------------
GCH4_ALKHC       ---------------
GCH4_OCEIH       ---------------
GCH4_EXIS2       ---------------
GCH4_STAAB       ---------------
GCH4_STAAC       ---------------
GCH4_STAAS       ---------------
GCH4_STAAW       ---------------
GCH4_STAA8       ---------------
GCH4_STAAE       ---------------
GCH4_STAAT       ---------------
GCH4_STAA3       ---------------
GCH4_STAA2       ---------------
GCH4_STAAN       ---------------
GCH4_STAA9       ---------------
GCH4_STAA1       ---------------
GCH4_STAAM       ---------------
GCH4_STAAR       ---------------
GCH4_STAHJ       ---------------
GCH4_STAES       ---------------
GCH4_STAEQ       ---------------
GCH4_STAS1       ---------------
GCH4_BURM7       ---------------
GCH4_BURM9       ---------------
GCH4_BURMS       ---------------
GCH4_BURPS       ---------------
GCH4_BURP6       ---------------
GCH4_BURP0       ---------------
GCH4_BURMA       ---------------
GCH4_BURP1       ---------------
GCH4_BURTA       ---------------
GCH4_BURCM       ---------------
GCH4_BURA4       ---------------
GCH42_BURCA      ---------------
GCH41_BURCH      ---------------
GCH41_BURCC      ---------------
GCH42_BURL3      ---------------
GCH4_BURVG       ---------------
GCH4_BURM1       ---------------
GCH4_PARXL       ---------------
GCH4_PARP8       ---------------
GCH4_CUPNH       ---------------
GCH4_CUPPJ       TA-------------
GCH42_CUPMC      ---------------
GCH4_RALSO       ---------------
GCH4_HERAR       ---------------
GCH4_JANMA       ---------------
GCH4_NEIMB       ---------------
GCH4_NEIMF       ---------------
GCH4_NEIMA       ---------------
GCH4_NEIM0       ---------------
GCH4_NEIG1       ---------------
GCH4_BORA1       ---------------
GCH4_BORPD       ---------------
GCH4_BORBR       ---------------
GCH4_BORPA       ---------------
GCH4_BORPE       ---------------
GCH4_POLAQ       ---------------
GCH4_METPP       ---------------
GCH41_DECAR      ---------------
GCH4_DICNV       ---------------
GCH4_ALKEH       RR-------------
GCH4_HALHL       ---------------
GCH4_NITOC       ---------------
GCH4_METCA       A--------------
GCH4_AZOSB       ---------------
GCH4_AROAE       GAN------------
GCH4_METFK       ---------------
GCH4_THIDA       ---------------
GCH42_DECAR      AHA------------
GCH4_NITEU       ---------------
GCH4_NITEC       ---------------
GCH4_NITMU       ---------------
GCH4_RUTMC       ---------------
GCH4_VESOH       ---------------
GCH4_GEOMG       ---------------
GCH4_GEOSL       ---------------
GCH4_GEOUR       VDNPVDKPGNCG---
GCH4_PELPD       ---------------
GCH4_SYNC1       AEPAPAP--------
GCH4_SYNAS       ---------------
GCH4_SYNFM       ---------------
GCH4_DESOH       ---------------
GCH4_MAGMM       ---------------
GCH4_AKKM8       ---------------
GCH4_THEMA       G--------------
GCH4_THESQ       G--------------
GCH4_THEP1       G--------------
GCH4_CALS8       ---------------
GCH4_THEM4       ---------------
GCH4_FERNB       ---------------
GCH4_PSELT       ---------------
GCH4_DESVH       QPGS-----------
GCH4_DESVV       QPGS-----------
GCH4_OLEA2       ---------------
GCH4_LAWIP       ---------------
GCH4_DESPS       ---------------
GCH41_BURCA      AC-------------
GCH42_BURCH      AC-------------
GCH42_BURCC      AC-------------
GCH41_BURL3      AC-------------
GCH4_DELAS       ---------------
GCH41_CUPMC      REVAA----------
GCH4_PSEP1       QQESFATGNER----
GCH4_PSEPK       QQESFATGNER----
GCH4_PSE14       ---------------
GCH4_PSEU2       ---------------
GCH4_PSESM       ---------------
GCH4_XANAC       PTTM-----------
GCH4_XANC5       PTTM-----------
GCH4_XANOR       PAAL-----------
GCH4_XANOM       PAAL-----------
GCH4_XANOP       PAAL-----------
GCH4_XANCP       MIAESHGQ-------
GCH4_XANC8       MIAESHGQ-------
GCH4_XANCB       MIAESHGQ-------
GCH4_XYLFT       ---------------
GCH4_XYLF2       ---------------
GCH4_XYLFM       ---------------
GCH4_XYLFA       ---------------
GCH4_ACIAD       ---------------
GCH4_COLP3       QP-------------
GCH4_IDILO       SA-------------
GCH4_PSYIN       LA-------------
GCH4_PSET1       RA-------------
GCH4_HYDCU       SDEPNFMERFQN---
GCH4_ALCBS       LPIP-----------
GCH4_PSEAE       ---------------
GCH4_PSEAB       ---------------
GCH4_PSEA7       ---------------
GCH4_PSEF5       ---------------
GCH4_PSEPF       ---------------
GCH4_PSEMY       ---------------
GCH4_PSEPG       AV-------------
GCH4_PSEPW       ---------------
GCH4_PSEE4       ---------------
GCH4_CHRSD       P--------------
GCH4_CITK8       T--------------
GCH4_KLEPN       T--------------
GCH4_SERP5       A--------------
GCH4_HAHCH       L--------------
GCH4_PSEA6       TM-------------
GCH4_BDEBA       F--------------
GCH4_ROSDO       ESLDPKLFNTLFHVG
GCH4_RUEPO       ASLDPRLFATLFHVG
GCH4_DINSH       DSLDPRLFQTLFHVG
GCH4_CERS4       ESLDPRLFSSLYHVG
GCH4_CERS1       ESLDPRLFSSLYHVG
GCH4_CERS5       ESLDPRLFASLYHTG
GCH4_RUEST       PSLDPQLFSTLIHRG
GCH4_JANSC       VSLDPKLFPSLIHVG
GCH4_PARDP       ASLDPAIFAGLRA--
GCH4_OPITP       -TADFMDFQSLVC--