CLUSTAL format seed alignment for MF_01531

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

BTUB_YERPN            MTIKKYTLLTALSVTAFSGWAQGNNTT--------DNNDEMVVTANRFPQPKSSVLAPVD
BTUB_YERP3            MTIKKYTLLTALSVTAFSGWAQGNNTT--------DNNNEMVVTANRFPQPKSSVLAPVD
BTUB_PHOLL            MINKKRLLLSTVSIMVISGWNQASAAV--------ESQDSLVVTASRFKQPISSILAPYT
BTUB_ECOLI            -MIKKASLLTACSVTAFSAWAQDTS------------PDTLVVTANRFEQPRSTVLAPTT
BTUB_SHIDS            -MIKKASLLTACSVTAFSAWAQDTS------------PDTLVVTANRFEQPRSTVLAPTT
BTUB_SALTI            -MIKKATLLTAFSVTAFSAWAQDTS------------PDTLVVTANRFQQPRSAVLAPVT
BTUB_CITFR            -MIKKSLLCTALSVTAFSGWAQDTR------------PDTLVVTANRFQQPRSAVLAPIT
BTUB_ECOLX            -MIKKYWFLMVYSVTAFSVWAQDTP------------LDTLVVTANRFQEPLSTVLAPVT
BTUB_CROS8            -MIKKISLLTALSVTAFSGWAQDSG------------SDSLVVTANRFQQPVNTVLAPTS
BTUB_ENT38            -MIKKVSLMTALSVTAFSGWAQDS-------------ADSLVVTANRFEQPANTVLAPTS
BTUB_PECAS            -MIKKISLLTALSVTAFSGWAQETD------------NNAMVVTANRFQQPVNSVLAPTT
E0SGD8_DICD3          MFTKKTTMLAAMVATAFSGWAQGSDNTQQ------NSNDAMVVTANRFPQPISSVLAPTT
C5BC44_EDWI9          -MNKKHMVIALFPVTASVSAGVQ------------AAQSEMVVTASRFAQPVSTVLAPVD
D4F053_EDWTA          -MNNKYPVIAWLPLTVVAMPNVAL-----------AASSDMVVTASRFSQPVSTVLAPMD
B5XZ10_KLEP3          -MIKKASLMTALSVTAFSGWAQD------------SNSDTLVVTANRFQQPVNTVLAPTD
A0KEE6_AERHH          -MSKKLLAAALLPTAAFAQTTIPVN-------------PTLVITANRVEQPISSVLAPVV
K1IXA4_9GAMM          -MSKKFLAAALLPTAAFAQTTIPIN-------------PTLVITANRVEQPVSSVLAPVV
D0I392_GRIHO          -MSKKLLAASMLPWAVFAHAESTPPSV----------DDTLVVTASRFEQPVSSVLAPVS
Q1ZL48_PHOAS          --MKKTLLALAVTSVYFPSFSIIAAEDNT------QTDDVMVVTANRFEQPVTSVLAPFN
BTUB_VIBCM            --MQKSALAIALASLLTPISYLHANEAQP------Q--ETVVVTANRFEQKASSTLADVE
BTUB_VIBCB            --MRKTFLAITCASLLSPTFYSQAQEVSA------D--ETVVVTANRFKQIDGAVLAQTV
BTUB_VIBPA            --MKKSALAITLASLLSPVSYLQAQEISV------D--ETIVVTANRFKQIDGAVLAQTV
C4L9A8_TOLAT          --MSKRLTASVLSAL--AIAAPTHAEEST------G--LPITVTATRFAEPTASVLAPVN
BTUB_VIBVU            -MQKSLLAIAMASLLTPV----SYLHAQEV-----QTNDTVVVTANRFEQPLAEVIASTT
F9S4Y9_9VIBR          -MNRSILAVTVGSLLSYA----PYSLAN-------TADETVVVTANRFEQPLNDVVASTT
C9P0V0_VIBME          -MNKSYLSLAMMSALSYC----SLTYAQSL-----PVDETMVITANRFEQKQVSVLAATT
B6ENT3_ALISL          -MKKTALATAIVSLLSHAYTSPAFAKDSVS-----ETDEVMVVTANRFEQSAKDVIAPMS
BTUB_PHOPR            -MKKTLLAVALAPLC--LPSQVFAADES--------SNDVMVVTANRFEQPIKNVIAPIS
D0Z0P4_PHODD          -MKKSFLAVSVATLCSSFAPLAFAADDVD-------SNDVMVVTANRFAQPLKTVIAPIS
C9QBP0_VIBOR          -MNRSILAMTVASLL--SHTSYSYAQEVS-------ADETMVVTANRFEQSIKDVISPIT
A0A0M0IFF1_9VIBR      -MNRSILAMTVASLL--SHASYSYAQEVS-------ADETMVVTANRFEQQVSDTIAPVE
B7VM87_VIBA3          -MNKSLLAVAVASLL--SPISNLHAQEAS-------ADETMVVTANRFEQSTQSTTLPVV
A0A0A1E845_9VIBR      -MNKTVLAAAVASLM--THIPTSFAQEAADSTPKSQTQETMVVTANRFEQPVGKVTATVE
A3UZS0_VIBS1          -MNKSLLAVAVASLLSP-ISNLHAQEVST--------DETMVVTANRFEQDIKSTLAPVS
BTUB_VIBVY            -MQKSLLAIAMASLLTP-ISYLHAQEVQT--------NDTVVVTANRFEQVESSVLASIS
U3AJI9_9VIBR          -MKKTILATAIISLYAPTIFAQDADATQA--------DETMVVTANRFEQPKASTLANIS
A0A0B8PD35_9VIBR      -MKKTVLATALVSLYAPSLFAQEADSTKV--------DETIVVTANRFEQTQSSALASVS
                          .                                   :.:**.*. :          

BTUB_YERPN            VVTRADIDRWQSTNINDVLRRLPGVDIAQDGGMGQRSSLFIRGTNSSHVLVLIDGVRLNQ
BTUB_YERP3            VVTRADIDRWQSTNINDVLRRLPGINIAQYGGPRQLSSLFIRGTNSSHVLVLVDGVRLNQ
BTUB_PHOLL            VVTRDEIDRWQSNSVADILRRLPGVDIARHGGIGQLSSLFIRGTHASHVLVLMDGIRLNQ
BTUB_ECOLI            VVTRQDIDRWQSTSVNDVLRRLPGVDITQNGGSGQLSSIFIRGTNASHVLVLIDGVRLNL
BTUB_SHIDS            VVTRQDIDRWQSTSVNDVLRRLPGVDITQNGGSGQLSSIFIRGTNASHVLVLIDGVRLNL
BTUB_SALTI            IVTRQDIERWQSTSVNDVLRRLPGVDIAQSGGTGQNSSIFIRGTNSSHVLVLIDGVRLNL
BTUB_CITFR            VVTRQDIDRWQSTSVNDVLRRLPGVDIAQYGGMGQNSSISIRGTNASHVLVLIDGVRLNL
BTUB_ECOLX            IVTREDIDRWQVSSVNDVLRRLPGVAISQHGGEGQLSTIFVRGTNSNHTLVLIDGVRLNL
BTUB_CROS8            VVTREDIERWQANTVIDVMRRLPGVDTAQSGGMGQLSSLFIRGTNSSHVLILVDGIRLNQ
BTUB_ENT38            VVTREDIERWQSTTVLDVMRRLPGVDTAQNGGMGQASSLFVRGTNSSHVLILVDGIRLNQ
BTUB_PECAS            VVTREEIDRWQAKSLTDVMRRLPGVDIGQNGGLGQKSSLFIRGTNSSHVLVLIDGIRLNQ
E0SGD8_DICD3          VVTRDDIDRWQSKSLTDVMRRLPGVDIGQNGGRGQLASVFIRGTESRHILVLIDGIRMAS
C5BC44_EDWI9          IVTRDDIDRWQSKSLDEVMRRLPGIDIVQNGGLGQSSSLYLRGTEARQALILVDGIPLAR
D4F053_EDWTA          VVTRDEIERWQSKSLDEVMRRLPGVDIAQNGGLGQNSTLYLRGSEARQALILLDGIPLAR
B5XZ10_KLEP3          IVTRDDIDRWQSKDLNDVMRRLPGVDIARNGGMGQSASLYVRGTEARHVLVLIDGVPMAR
A0KEE6_AERHH          VIDRAEIESRQVQSLPALLKTLPGVQITTLGGRGHMSSLFIRGTNSNHSLVLMNG-RPIA
K1IXA4_9GAMM          VIDRAEIESRQVQSLPALLKTLPGVQITTLGGRGHMSSLFIRGTNSNHSLVLMNG-RPIA
D0I392_GRIHO          VLTRSDIEELQANSLVDALKTLPGIEIGQNGGRGQTASIFLRGTNSNHVLVLVDGVRLPR
Q1ZL48_PHOAS          IVTRQDIDNIQAKTLTEVISLLPGVQVTQNGGRGQSSSIFVRGANSDQVLVLVDGIRMAR
BTUB_VIBCM            IITRQDIEQTQAKTLPELLRRLTGVQITQNGGRGQLASLFVRGTSSDQVLVLVDGIRFAR
BTUB_VIBCB            TVTKEDIKRLQANSLFDVFRTLPSVEVAQYGGRGQSASIYVRGGSSSQVLVLVDGVRMPR
BTUB_VIBPA            TVTKEDIRRQQADSLFDVFRTLPSIEVAQYGGRGQSASIFVRGGSATQVLVLVDGVRMPR
C4L9A8_TOLAT          IITRKDIEQLHARSLADVVKTLPGVEMVSNGGRGQQASVIVRGATSAETLVLMDGVRINS
BTUB_VIBVU            VISKQEIEETQAKSLLDVLKRVPGIEVSQSGGRGHSASVFIRGFNSNQVLFLVDGVRINS
F9S4Y9_9VIBR          IVSKQEIDQIQAKSLVDILKRVPGIEVSQSGGRGHSASVFMRGYNSDQILFLVDGVRIDS
C9P0V0_VIBME          VIERQEIEQYQARSLTEVLRRVPGIEIAQNGGRGHTASVFMRGTNSSHVLILVDGVRIDS
B6ENT3_ALISL          VVTKEDIVQIQAKTITDILRLQPGIEVASNGGIGQNASIFMRGTNSDHVLVLIDGFRMNS
BTUB_PHOPR            VVTKEEIDAIQAKSIAEVLRRLPGVQVVS-GGYGQATEVYVRGTTSRHLLVMINGVRIGS
D0Z0P4_PHODD          VVTKEEIDAIQAKSMAEVLRLLPGVQVVS-GGLGQNTEVYVRGTSSKHLLVMINGVRIGS
C9QBP0_VIBOR          IVTKEELELSQVKSLPEALRSLPGVQVNS-VGFGQYSSVYVRGSSSRHLLVLINGVRIGS
A0A0M0IFF1_9VIBR      VVTKQEIDAIQATSLSDVLRRLPGVQVTNQGGLAQGQELYIRGRSTKNTLVLINGVRVGS
B7VM87_VIBA3          VVTRAEIEAIQANDIYEVLRRLPGIQVASNGGYGQKQSVFVRGTNSDHILVLIDGVKTAS
A0A0A1E845_9VIBR      YVTKDQLENLQIKSLSEALALLPGVQVAQNGGRGQSSSVYIRGSASNHVVVLYNGVRIGS
A3UZS0_VIBS1          VITRQDIASLRAQSTFDVLKTLPGVEVNSLGSKSNETSIFIRGTASKHTLVLLDGVRLNS
BTUB_VIBVY            VVTKAEIEQLNVTTALDILKTLPGVEVNSQGGKGQISSIFLRGTSSKHTLVLVDGVKINS
U3AJI9_9VIBR          VIEREDIQAIQADSALDVLKTLPGVEVTQLGTKGNTTSIYLRGTASAQTLILVDGVRINS
A0A0B8PD35_9VIBR      VVEREQIEQIQADSAYDVLKTLPGVEVRGQGTKASNNSVFIRGANSNQTLVMLDGVRLNT
                       : : ::   .       .   ..:             : :**  : . :.: :*     

BTUB_YERPN            AGITGASDLSQIPISLVQRIEYIRGPRSAVYGSDAIGGVINILTGRDKPG---TTLSAGL
BTUB_YERP3            AGISGSSDLSQIPISLVQRIEYIRGPRSAVYGSDAIGGVVNIITERETLG---STLTAGL
BTUB_PHOLL            AGISGSSDLSQIPVSLVQKIEYIRGPRSAVYGSDAIGGVINIITTREKLG---TSLNVGI
BTUB_ECOLI            AGVSGSADLSQFPIALVQRVEYIRGPRSAVYGSDAIGGVVNIITTRDEPG---TEISAGW
BTUB_SHIDS            AGVSGSADLSQFPIALVQSVEYIRGPRSAVYGSDAIGGVVNIITTRDEPG---TEISAGW
BTUB_SALTI            AGVSGSADLSQFPVSLVQRIEYIRGPRSAIYGSDAIGGVVNIITTRDNPG---TELTAGW
BTUB_CITFR            AGVSGAADLSQFPVSLVQRIEYIRGPRSAVYGSDAIGGVVNIITTREKPG---TELTAGV
BTUB_ECOLX            AGVSGAADLSQFPVALVQRIEYIRGPRSAIYGSDAIGGVINIITSRENTG---TEISAGW
BTUB_CROS8            AGVTGSSDLSQFPLALVQRIEYIRGPRSAVYGSDAIGGVVNIITTRAKDG---TTLNAGI
BTUB_ENT38            AGVTGSSDLSQFPISLVQRIEYIRGPRSAVYGSDAIGGVVNIITTRAKDG---TTLNAGV
BTUB_PECAS            AGISGSSDLSQIPLSLVQKVEYIRGSRSAVYGSDAIGGVVNIITTREKNG---TTLNAGV
E0SGD8_DICD3          PGVTGTTDFSQIPMSIIQRIEYIRGARSAVYGSEAIGGVINIITTRTQDG---GVLNAGY
C5BC44_EDWI9          PGITNVAALNQIPLAMVQRIEYIRGPRSAVYGSGAIGGVINIITLDAEPG---AQLSVGT
D4F053_EDWTA          PGISNVAALNKIPIAMVQRIEYIRGPRSAVYGSGAIGGVINIITLDAEPG---ARLGIGT
B5XZ10_KLEP3          PGISNGVDISQIPISLVQRVEYIRGPRSAVYGSGAIGGVVNIITMTDSDR---SQVNVGM
A0KEE6_AERHH          AMVAGTPDLSQIPLGNIERIEYIRGPRAAVYGSDAIGGVINLITKTSAKNGSETHLKGGV
K1IXA4_9GAMM          AMVAGTPDLSQIPLGNIERIEYIRGPRAAVYGSDAIGGVINLITKTSAKNGSETHLKGGA
D0I392_GRIHO          TML-GTIDFNMLPLNTVERIEVIRGSGATVYGSDAIGGVINIITRNDAEA---TRFSIGG
Q1ZL48_PHOAS          SVA-GNVDFNQIPLTQVERIEFTRGARAAIYGSEAIGGVINIITLTGTDTPSKTKLDLGV
BTUB_VIBCM            AAK-GAVDFNQIPLTYVDRIEYVRGARASLYGSEAIGGVINIITKARSQQQG-TTVSAGL
BTUB_VIBCB            AIM-GGIDFNQFPINSVERIDYIRGARASIYGSEAISGVINIITRAPINDDS-GRVSAGY
BTUB_VIBPA            AIM-GGIDFNQFPINSIERIDYIRGARASIYGSEAISGVINIITRASIDDDA-SRVSAGY
C4L9A8_TOLAT          ATN-GATDFSSIPLNQVERVEFVRGARASVYGSDAIGGVINIITRGTAGQTK-HTLNGSA
BTUB_VIBVU            A-AGGIS-FNHIPVGIIERVEVIKGPGGALYGSDAIAGVINVITTSSESSEG-SVVSLGA
F9S4Y9_9VIBR          A-AGGIK-FNHIPVGIIERVEVIRGPGGALYGSDAVAGVINVITESGNDSDA-TYLSLGA
C9P0V0_VIBME          A-AGGVA-INRFPIGLVERLEVIRGSGAAMYGSDAIGGVINIITRSHRGNNL-KQVTLGV
B6ENT3_ALISL          SIKSGMN-INKIPVNQIERIEIIRGSGAVMYGSDAVGGVINIITRTATNDLS-KSATIGA
BTUB_PHOPR            ATLGS-ADFSQIPLTGIERIELIRGSRAALYGSDAIGGVLNIITAYQPGESV-AEVTAGG
D0Z0P4_PHODD          ATLGS-ADFSQIPLTGIERIELIRGSRAALYGSDAIGGVLNIITAYQPGEQQ-VQATVSG
C9QBP0_VIBOR          STAGE-ANFSQIPLTGVERIEFIRGARAALYGSDAISGVINIVTNYQ-GESI-AEVTGGM
A0A0M0IFF1_9VIBR      ATLGY-ANLAAVPLNGVERIEVLRGARAAVYGSDAVSGVVNIITTKGASNS--GNVKAGA
B7VM87_VIBA3          ATSGG-ANFAAIPLVGVQRIEFVRGPRAAIYGADAIGGVINIITDTS--SSE-AKVSVGF
A0A0A1E845_9VIBR      ATTGS-ANFTAIPLAGVERIELVKGARAAVYGADAIGGVINIITSSGASENT-AIIKAGL
A3UZS0_VIBS1          ATAGG-ASIGLIPVSAIEKIEVVRGPRAAVYGSDAVGGVISISTVPTSGSV--HEATLAT
BTUB_VIBVY            ATAGG-ASLGLIPAFAIEQIEVVRGPRAAIYGSDAIGGVIHIKTIPANRQTK-HDANLGY
U3AJI9_9VIBR          PTSGG-GSIGLIPAFAIEKIEVLRGPKASIYGADAVGGVISITTISK-DNV--NQASLTG
A0A0B8PD35_9VIBR      AAGGTVNTLGLIPAFAIERIEVIRGPRAAVYGADAIGGVISIITKPQSDSV--HELTLNG
                      .       :  .*   :: ::  :*. . :**: *:.**: : *                

BTUB_YERPN            GSNGYQTYDGSTQQKLGEDTTVTLAGNYTYSKG-----YDVVAGMPGAGGPRQPDRDGFM
BTUB_YERP3            GSNGYQNYNGSTQQKLGDDTTITLAGNYDYSKG-----YDVVA-KGNTGMASQPDRDGYL
BTUB_PHOLL            GSHGYQTYDGATQQTLAENTVLTAAANYTYTKG-----YDVVA-DGNTGGFRQPDRDGFM
BTUB_ECOLI            GSNSYQNYDVSTQQQLGDKTRVTLLGDYAHTHG-----YDVVA-YGNTGTQAQTDNDGFL
BTUB_SHIDS            GSNSYQNYDVSTQQQLGDKTRVTLLGDYAHTHG-----YDVVA-YGNTGTQAQPDNDGFL
BTUB_SALTI            GSNSYQNYDLSTQQQLGENTRATLIGDYEYTKG-----FDVVA-KGGTGMQAQPDRDGFL
BTUB_CITFR            GSNGYQNYDVSTQQQLGENTRVTLMGDYAYTKG-----FDVVA-YGSTGSQAQPDKDGFL
BTUB_ECOLX            GSNSYQHYDISTHQQLGENTRVTLLGDYTYTRG-----FDAVA-YGSTGMQPQSDRDGFL
BTUB_CROS8            GSHSYQNYGGSTQQTLGDNTRVTLAGDYTYTRG-----FDVVA-EGNNGGLAQPDRDGFM
BTUB_ENT38            GSHGYQNYGGSTQQTLGDNTRVTLAGDYTYTKG-----FDVVA-DGNNGGLAQTDRDGYM
BTUB_PECAS            GSKGYQSYDAATQQALGDSTTATLAGNYVYTKG-----FDVVA-YG-TASPAQPDRDGFM
E0SGD8_DICD3          GSHAYQQYDGSIKQHIGENTAVSLAGGYEGTHG-----FNVYP---GSTIAGDDQKSGYR
C5BC44_EDWI9          GTNHYQQYDAGVRQQLG-NTTLSLAGSFQTTRG-----FNVQP---DSPYGPDGDRDGFR
D4F053_EDWTA          GSNHYQQYDAGVRQQLG-NTTLSLAGAFQSTEG-----FNVKP---DSPYAPDGDRDGFR
B5XZ10_KLEP3          GSNGYQTYDGAINKRFG-DTVVTAAGAYQTTKG-----FNVQP---NSPYSGDSDRDGYR
A0KEE6_AERHH          GSNGYGQGQLRTVQALGQQTDMNMMIGYERTDG-----FDVVA------NAQQPDRDGFD
K1IXA4_9GAMM          GSNGYGQGELRTVQSFGQKTDMNMLIGYERTDG-----FDVVA------NAQQPDRDGFS
D0I392_GRIHO          GSFGSASADVGVTRKVNDSLSVQLMGGLESVDG-----YNVRP-----DIAPANDKHGFE
Q1ZL48_PHOAS          GSHNYQEANASGAYNIGDKTVLQLAAGYESDDG-----YNVRP----QPGLNDGDKHGFD
BTUB_VIBCM            GSLDYQELSIASGVAIGEKGQMNVALGTESDKG-----YNVRP----VPGVNDGDRHGFR
BTUB_VIBCB            GSNNHKKGTFVVSKPVGEGKHFKGVLGYEKTDG-----FNVKP----QPGLNDGDEHGFE
BTUB_VIBPA            GSNNHKKGTFAVSKPVGEGKHIKGVLGYEKTDG-----FNVKP----LPGLNDGDEHGFE
C4L9A8_TOLAT          GSRDYQNLNGSTSFDINQQQHLKLAAGYETEDG-----YNVHP----VEGVNDGDEHGFL
BTUB_VIBVU            GSDAQKEANFSTTRAFANGGVLKLAGGFEETEG-----FDIKDP-------ETGLNYGYE
F9S4Y9_9VIBR          GSDAQKEASFSITSELENTGVLKLAGGFEETEG-----FDIKDP-------ATGLDYGYE
C9P0V0_VIBME          GSNQSRKGEVVTRTDVNELGHLQLSAGFEKTDG-----YDIKSS-------QTGVDYGYE
B6ENT3_ALISL          GSNKYKEGNFAANTNVGDKGHLKIAAGFTQTEG-----YNVNPQP----GLNDGDKHGFE
BTUB_PHOPR            GSDGFYQLGGSVAGGLGESGWGKIALKTEGADG-----FSARK------EPFEQDDDGFK
D0Z0P4_PHODD          GSEGYYQVGASAAGQIGTEGWGKLAIRTEGNDG-----FSARQ------LPYEQDKDGFT
C9QBP0_VIBOR          GSHGYYEAGINAASDLNENTWGKVSVSVNGDSGAVSARTSTDT------TPFEDDKDGYD
A0A0M0IFF1_9VIBR      GSHGLYDVNASGSVSS-DTGWLNVSATHQQSEG--YNIQPTSI------NPVDADKDGHS
B7VM87_VIBA3          GSDSYKKGSVAVSGNITDSTSGSVAVKRAETDG-----FSVQN------SAGDQDADGHE
A0A0A1E845_9VIBR      GSDKYRQAGAGYSGKLGDKSWLNLSVNTEAAEG----FDVGGT------GPSQPDNDGYS
A3UZS0_VIBS1          GSNNSTQQTWRSVGDISDSTRGSFFYNKEKSDG-----YRVYE------GAASGEKSGYE
BTUB_VIBVY            GNDDHSSLAWRSSGQLNDSTQASFVFSDEKSDG-----YRVNE------VAPSGDSHGYQ
U3AJI9_9VIBR          GSNYYHSEGWRSSGDISDDTRGSFVVNNEVSKG-----YAISS------FNPDNEDYGYK
A0A0B8PD35_9VIBR      GSNSSHQEGWRSAGELSDTAKGHFLVSNEGSKG-----YNITD------QDID-QDFGYE
                      *.                              *                        *. 

BTUB_YERPN            GKMLWAGLEHQFNEQFNGFARVYGFDNRSDYDGYTNYSNPL-----ALIDTRKLSSRTYD
BTUB_YERP3            GKMLWLGANHKFNEQFSGFVRGYGFDNRSDYDSYYYPGSP-------LVDTRSLSSRTYD
BTUB_PHOLL            SKMLWLGVDQKFNEQVSGFVRAYGYNNRTSYDADINWSYPY-----ARPDTRELYSRHYD
BTUB_ECOLI            SKTLYGALEHNFTDAWSGFVRGYGYDNRTNYDAYYSPGSP-------LLDTRKLYSQSWD
BTUB_SHIDS            SKTLYGALEHNFTDAWSGFVRGYGYDNRTNYDAYYSPGSP-------LVDTRKLYSQSWD
BTUB_SALTI            SKTLYGALEHTFSDRWSGFVRGYGYDNRTDYDAYYSPGSP-------LIDTRKLYSQSWD
BTUB_CITFR            SKTLYGALEHNFSDTWSGFVRGYGYDNRTNYDSYYSPGSP-------LLDTRKLYSQSWD
BTUB_ECOLX            SKTFYGKLEHNLSDTWSGFVRGYGYNNRTKYDAWYSPGSP-------LIDTRKLYSQSWD
BTUB_CROS8            NKTLYGALEHAFSDQWTGFVRGYGYSNRTAYDGYYNSFTPD-----VLVDTRQLYSQTWD
BTUB_ENT38            NKTIYGALEHAFSDQWSGFVRGFGYSNRTAYDAYYSSFTPD-----VLVDTRQLYSQTWD
BTUB_PECAS            SKSLYGTVEHKFGDQFSGFLRGYGYDNRTDYDNFSS------------VDTRQLYSQTWD
E0SGD8_DICD3          SKTFWGMVEHQFTPQLNGFVRNYGYDNLTDYNKIYSDSSS---------NRRYLSSRSYD
C5BC44_EDWI9          NKVLWGGVEHRFSEAWSGFVRGHGYSEASDYDAGKYGSDS-------SGTQRQLYNHSYD
D4F053_EDWTA          NKVLWGGVEHRFTQAWSGFVRGHGYSDASDYDAGKYGKAS-------SGTQRQLYNHSYD
B5XZ10_KLEP3          NKLFLGGVQHKFDDNFSGFFRGYGYTANTDYDQGSYGYVG-------GNDERQNYTQSWD
A0KEE6_AERHH          SLNGQFGLSHAFNDAWSADFNAQGYDNQTEMDDAYQSADQ-----------SRVQAFQYD
K1IXA4_9GAMM          GRNGQIGLNHAFNDAWSADFNAQGYDNLTETDDPYLSADQ-----------SRVQAFQYD
D0I392_GRIHO          SKNASLRLSYAPRENWRSNIIGRWYENEVGFADYVGAKKY-----------LWVESKAIG
Q1ZL48_PHOAS          SRNASLALHHQFSDQVSGYVATRWYKNQYQYDGSS-------IDTGHQYVRAETEFNDYS
BTUB_VIBCM            SDNALLGYVHQFDESWSLFANARAYENIYQYDNS---------YGTRDYKEAEKDDLSFT
BTUB_VIBCB            TLNLKLGYQQNFSDNLSGYVGVSAYNNEYDYDNSS-------IWSGHEKKTGEVEYVGTD
BTUB_VIBPA            TLNLKLGYQQNFSDNFSGYVGFSTYSNEYDYDNSSYGNPGWGTVDKHEKKTGEVEYVGAD
C4L9A8_TOLAT          GRNAMLDYQNQLTDEVNVYGAMHWTRNTMQSDGSY----SYGDYSQHERDETWEENTHYQ
BTUB_VIBVU            SQNLFASYSQAFNDEFSGSASVRWYDSLTEYDS--GGKNY-----------GYSENLSIT
F9S4Y9_9VIBR          SQNLFASYGQSITDALTGTVSLRWFDSLTEYDK--GSKYF-----------GYSENLSLT
C9P0V0_VIBME          SQNLMGGYEHRFNQNWLGYVSASWFDSDVEYNSS-GTLYH-----------SFSDNQSFA
B6ENT3_ALISL          NNQFMLNYEHQFSSNLSLFTGIRWFNSTSEYNHYTNTKSQ-----------SESESMAYS
BTUB_PHOPR            NSNVVAEVGTHVGDHWKLSLQGYYHDGESDYDDS----------YGAPHAQSESSLFNIA
D0Z0P4_PHODD          SKNAVAELGRHLGDNWKVSLQGYFHKGKNKYDDADF------FGNNKPNPKAENELYNIA
C9QBP0_VIBOR          KASVVAEIGHQVNDALQVSLQGYYHKGNSEYDKTNFDFGSF-TNVIQPNAESESTLYNFA
A0A0M0IFF1_9VIBR      TQYLTVDGGFKASTNLTLKANGYYQKHDVEFDNP-----------WGGVDNTDSELYALG
B7VM87_VIBA3          VTELALAITHKLNDEFKLKFNSTYSDGETEYDPK--------------NATKDQTLYSAI
A0A0A1E845_9VIBR      RKDVNFEVGTLISDSWSANFMGFYHHSNSDYESYD----------GKAPDEQESELYNYA
A3UZS0_VIBS1          SEVILGSLNHQINEKFALFFTGFSQNSASEYADTY----------SGPKKVSEVDAYSFS
BTUB_VIBVY            SQTLFGSLRHEIDDAWSVQFNGYQLSSDVEYANQF----------SGVKNESNTDFYSIA
U3AJI9_9VIBR          SQVAFGSLQHDITDNWSTNFSGYNQSSTSEF-------------QSTTKDETRTDFYSVA
A0A0B8PD35_9VIBR      SQFASGGVTKQINDNWSAGFNGIWQRYNNQYVGDFG--------PAGTPKRQDTENYIIS
                                                                                  

BTUB_YERPN            TGLRYKNGIYASQFIASYNRTKDYNYSPLFGQHDITASLDEAEQYNLQWGNTFQLTNGMI
BTUB_YERP3            TGINFSNGGYASQLIGSYSRTQDYNYDPSYGRYDQSATLDDISQYNLQWTNTYQLGLGNV
BTUB_PHOLL            MGVRFNQGIYSSQLITSYSHTKDYNFDPQYGRYDKSASLNDSEQYNLQWGNTFQLYQGIV
BTUB_ECOLI            AGLRYNGELIKSQLITSYSHSKDYNYDPHYGRYDSSATLDEMKQYTVQWANNVIVGHGSI
BTUB_SHIDS            AGLRYNGELIKSQLITSYSHSKDYNYDPHYGRYDSSATLDEMKQYTVQWANNIIIGHGNV
BTUB_SALTI            AGLRFNGERIQSQLVSSYSHSKDYNYDPHYGRYDTSATLDEMKQYNVQWTNSVVVGHGNV
BTUB_CITFR            AGLRFNGELIQSQLVSSYSHSKDYNYDPDYGRYDSSATLDEMKQYNVQWSNSIVVGHGNV
BTUB_ECOLX            AGLRYAGETLQSQLVSSYSHSKDYNYDPHYGRYDTSANLDDMKQYNLQWTNSVTVGHGNV
BTUB_CROS8            AGLRFNNDLFHSQLLSSYSHSKDYNYDPHLGRYDSTATLDEIKQYNVQWTNAVDVGHGNI
BTUB_ENT38            TGLRFNDGIFHSQLLSSYSHSKDYNYDPHLGRYDSTATLDEIKQYNVQWTNSVDVGHGNV
BTUB_PECAS            TGLRYQSGIYSTQLIGSYSHSKDYDYDPLRGLHSSGSTLVDSQQYNAQWGNVLQVGAGTV
E0SGD8_DICD3          TGLQFQQGIYAGQLVASYQTYDDQNYDDAVGRYSNSVTRIN--QRSLQWGNVFSVGQGSI
C5BC44_EDWI9          MGLRYHAGAYASQLIAAYQKIKDYNYSAVYGRFGNGSSLDDLRQYNLQWGNTYRFDSGML
D4F053_EDWTA          MGLRYQSGVYASQLIAAYQSVKDYNYGPVYGRYGKGSSLDDLRQYNLQWGNTYRFDSGML
B5XZ10_KLEP3          TGLRYSSGIYSSQLIANYQRIKDYNYSSDAGRYAAGATLDDMEQRYIQWGNNIEVGHGAI
A0KEE6_AERHH          GGLKYQSGALSSRLEASYGENKLKSWLESKGES-SAEPIHTGLTRFSWINSWSGVEGLNL
K1IXA4_9GAMM          GGLKFQGKDLISRLEVSYGENKLKNWLESNGEE-TGQPIHTGLTRLSWISSWSGIEGVSL
D0I392_GRIHO          ADTGFTSGKWNTQARIELGEQKNYDFSEGASPSDETLTSDIRQIYASVATRYQVNEQLAV
Q1ZL48_PHOAS          AGLKYAQNSYKSSLIFNYQKQDNFDYVD--KTNEVNRQDQYHQRNVQWHNQYQLLSTLSV
BTUB_VIBCM            IGTQYQSERWVSELQLTTQKQKSWDYTQS-KGKYSDTSDNLEQRNIQWINRYLVNDVWTF
BTUB_VIBCB            LSLEYNKDVYSSELKLAYGQQDNYDHKSGQNKS-TGDHVAIEQFNAIWLNSYSVNEELSI
BTUB_VIBPA            LSLEYSKDVYTSELKLAYGQQDNYDLKSGQSKS-TGDHVAIEQFNAIWLNSYSINDELSI
C4L9A8_TOLAT          LGTKYQKDRYQTELNTSLINNDMYYYPDTISRDEASSVYKTSQYQLSWLNNYQITDPWTV
BTUB_VIBVU            ADVQYSGSRLSSTLRANQQAIENLDYSQAEGKDNAGTVKKIALTNLQFLNQYLISEGITI
F9S4Y9_9VIBR          GALEYQREYFNSVLRVNQQSIENLDYSKSEGKDNAGTKKEIELTSVQFLNLYQFNDDFSI
C9P0V0_VIBME          GKMNYEGKRLKSLLMLNYQQTEKLDYTQSEGKNNANTKANIALTQTQWANLYQLNDIIKL
B6ENT3_ALISL          AKVSYKKDALLSDLSFSYQDNETLEYLENGSLD---SEQKIDQLNAQWTNQYKLMDSWFV
BTUB_PHOPR            AKAGYSNDKLDSQFTVAQNQDE----NRNFNDVSSGSKIKTERTVANWQNHYQLTDGLEL
D0Z0P4_PHODD          GKVNYSTAQYSSELTLAQNQDK----AKNYNDIEVGSEIKTTRLLANWQNHYQVNENWQI
C9QBP0_VIBOR          GKAKYLNGSYFSELTLAVNADK----GRDSNDLEDDSRFESERNVATWLHSYKLTNDFTF
A0A0M0IFF1_9VIBR      LVSDYKRDKLNSVVTLAANQDE----AESYGQGTTPSAITTKRQSVSWNNQYAVNESAVV
B7VM87_VIBA3          GRLSYTGETLSSNFSLSKAQDS----SKDYY---YKSTYQTDHQAVAFTNLFTVNNEVSI
A0A0A1E845_9VIBR      GSITYDIGRFSSVLSLSTNKDS----SDNFGGTTNGSHLVTKRHAASIVNIYRINAQWVM
A3UZS0_VIBS1          SGVKYSEGAILSSLEFGLMKNVGA--DGNADGTTAKTEISSKRESVSWVNTYVISPDFLI
BTUB_VIBVY            GSLNFHKDNYSSQLMVSRSDNESW--DGVASGMVAKTALFSSRNSVSWLNHWVVVPALTL
U3AJI9_9VIBR          GGVNYHVTNFQSSLQVSQTNNELG--TRDVAKTRAEAILEAKRNTVSWINSYQVLDSLNL
A0A0B8PD35_9VIBR      GDVAYQIEAFRSSLQVNFSAEEQS--DGNDQTNAPRSFIDSKRTSVLWVNTYTGVDALTL
                          :                                                      .

BTUB_YERPN            SAGADWQEQRTERK--------SSNQNTTADFTQHNTGIYLTGQQQ-ISDVTLEGAVR--
BTUB_YERP3            GGGLDWQKQTTE----------PGTNYLSNGYEQRNTGVYGTVQQF-VGPVTLEGAIR--
BTUB_PHOLL            STGVDFQKQSIE----------AGTSYIPKSKTVRNTGMYLTAQQQ-LKDFILEGAIR--
BTUB_ECOLI            GAGVDWQKQTTT----------PGTGYVEDGYDQRNTGIYLTGLQQ-VGDFTFEGAAR--
BTUB_SHIDS            GAGVDWQKQSTA----------LGTAYVKDGYDQRNTGIYLTGLQQ-VGDFTFEGAAR--
BTUB_SALTI            GAGVDWQKQTTT----------PGTGYVPEGYDQRNTGVYLTGLQQ-LGDFTLEAAAR--
BTUB_CITFR            GAGVDWQKQTTE----------PGTGYVTDGYDQRNTGLYLTGLQQ-LGDFTFEGAAR--
BTUB_ECOLX            GAGIDWQKQSTT----------PGTGYLPKGYDQRNTGIYLTGLQK-LGDFTLEGAVR--
BTUB_CROS8            GAGVDWQKQSTE----------PGTSYVTNGYDLRNTGVYLTALQK-FGDVTLEGAVR--
BTUB_ENT38            GAGVDWQKQSTE----------PGTNYVTNDTNLRNTGVYLTALQK-FGDFTLEGAAR--
BTUB_PECAS            SAGVDWQDQIIK----------PDSTSVNREESQNNTGIYLTGQQR-FASIVLEGSVR--
E0SGD8_DICD3          STGVDWRDERAAA---------GGASAISESQSRTNTGLYLTTQQR-IGQFTLEGAIR--
C5BC44_EDWI9          SAGADWQQQRLI----------SSDTKRTQHYQRYDAGFYLSGQHK-VGSVTLEASGR--
D4F053_EDWTA          SAGADWQQQRLI----------SSDIQKKQHYQRYDTGFYLSGQHK-VGSVTLEASGR--
B5XZ10_KLEP3          SGGVDWKQEKLT----------SSSTTLSDAYKRDTTGLYLTGQQQ-IDSVTLEASGR--
A0KEE6_AERHH          TGGADWQQEQLKSDT-------RSYGQAFNAPDRDNTGLFVVGSYR-WQALLWELSGR--
K1IXA4_9GAMM          TGGADWQREEMKSDS-------RSYGKNFNAPDRDNKGLFAVGSYR-WQALLWELSGR--
D0I392_GRIHO          TGGVDLTSERYLDGN-------MIAIDVIKDNPRENIGVFGLANFNVTDNVLIEGSVR--
Q1ZL48_PHOAS          SGGIDWRQEQWND-----------LTGFAGNKERDNTGYYAIGLWD-YSLVSIETSIR--
BTUB_VIBCM            AGGVDWRDESYID-----------KTADKEFD-RSNTAAFAVVAAE-WQQWLLEASLR--
BTUB_VIBCB            GGGLDYRTEKLAKGYIAPSDRGPAKDYDPEKNPRTNFGVSAIAQYA-YDVWTLEASVR--
BTUB_VIBPA            GGGLDYRNEKLAKGYLAPSDWGPAKDYNPEKNPRTNIGISAIAQYA-LNAWTFEASVR--
C4L9A8_TOLAT          GAGVDLRRDVLHSDSQSSG----SAFFDEDKN-RNNVSVYALSQYR-WEQWLGELSGR--
BTUB_VIBVU            GAGADWRKEKLDDDALSYG----YPDKL-AGESRSTTGVYLSTDLQ-LGDLQVTGSVR--
F9S4Y9_9VIBR          GAGADWRREELKDGAMSYG----SPDPL-AGDARDTTGVYTSVDAQ-FGDLSVLGSVR--
C9P0V0_VIBME          GAGIDGRWEKLDHDALSYG----SRHVL-AGESRDTYGIFGSGKLT-VSDWVFEANIR--
B6ENT3_ALISL          NAGIDWTNEQVKADITNFS----HQVIIDEGESRMSTGVYLGTEYQ-LEKLTLEANTRFD
BTUB_PHOPR            GGGLEWYRDSVSNTG-----------TQYAEDERDNTAVYLTSIYR-ISDWQFEGSVR--
D0Z0P4_PHODD          GGGTEWHRDKVSNST-----------QQYSKDQRDNTAFYLTSIYK-LQDWQFEGSAR--
C9QBP0_VIBOR          AGGLEWNEEKVSTTE-----------GTYIQESRDNKALFVTANYV-VEQFATEASVR--
A0A0M0IFF1_9VIBR      VGGVDWYQDKVKNES-----------TAMTKDSRNNTALYAGGNIA-VGELTAEANVR--
B7VM87_VIBA3          GAGLDWSKDDVSESS-----------KDYAEKSRTNNSLYVSGFYD-NQAVQAELALR--
A0A0A1E845_9VIBR      NAGLDFTQDSVADSNIYS----SGKYQKYGKTGRSNQAIFVSSLWG-FDSTQLEASIR--
A3UZS0_VIBS1          NGGIDYYKEYADRG--------AANTTSYDKETKDNKAVFITGIASFLEGGTIEASAR--
BTUB_VIBVY            AAGVDYDQENARQG--------GANATNYSKTEKDNKAAYVTAHFS-KNIVTAEASIR--
U3AJI9_9VIBR          TGGVDYYQEKVDRG--------GSNSANYQKTDRNNTGIFATSSLN-LEPVIVEASIR--
A0A0B8PD35_9VIBR      NGGVDYSYDEANNSGVIF----GTPVQDFTETTRNNTGVFATAAVD-LKPVLLEASVR--
                        * :   :                            .                   *  

BTUB_YERPN            -SDDNSQFGWHSTWQTSAGWEFIDGYRLIGSYGTAYKAPNLMQLYSAYGG----------
BTUB_YERP3            -GDDNSQFGWHTTWQSSAGWEFVDGYRLIGSYGTAFKAPNLGQIYSSTYG----------
BTUB_PHOLL            -SDKHSEAGWNTTWQASLGWEFIKDYRLIASYGTAFKAPTLSQMY-GFGG----------
BTUB_ECOLI            -SDDNSQFGRHGTWQTSAGWEFIEGYRFIASYGTSYKAPNLGQLYGFYG-----------
BTUB_SHIDS            -SDDNSQFGRHGTWQTSAGWEFIEGYRFIASYGTSYKAPNLGQLYGFYG-----------
BTUB_SALTI            -SDDNSQFGRHGTWQTSAGWEFIEGYRFIASYGTSYKAPNLGQLYGYYG-----------
BTUB_CITFR            -SDDNSEFGRHGTWQTSAGWEFIEGYRFIASYGTSYKAPNLGQLHGYYG-----------
BTUB_ECOLX            -NDDNSQFERHTTWQSSAGWEFIEGYRFIASYGTAFKAPNLGQLYGMYG-----------
BTUB_CROS8            -SDDNSQFGRHGTWQSSAAWEFIEGYRFIASYGTAYKAPNLGQLYGFYG-----------
BTUB_ENT38            -SDDNSQFGRHGTWQSSAAWEFIEGYRFIASYGTAYKAPNLGQLYGFYG-----------
BTUB_PECAS            -GDDQSEFGWHNTWRTGASWEFIEGYSLIASYGTAFKAPNMGQLYGRFGS----------
E0SGD8_DICD3          -GDDNQQYGRHGTWQTAAGWEFIDGYRLTGSYGTAFKAPTFSQIYNTDYNV--------G
C5BC44_EDWI9          -ADNDQQFGWHGTWQSAAGWEFIPGYRATLSYGTGFLAPSLGQQFGSDR------MDIQS
D4F053_EDWTA          -ADNDQQFGWHGTWQSAAGWEFASGYRATLSYGTGFLSPSLGQQFGADR------MNIKS
B5XZ10_KLEP3          -EDHDEQFGWHGTWQTAAGWEFIDGYRATLSYGTGFLAPSLGQQYGATRFASFYGPGIAS
A0KEE6_AERHH          -TDDNKQYGRHNTWSAASGLDLDDNHNVRLSYGTAFKAPTFLDLYYPGYE----------
K1IXA4_9GAMM          -TDDNQQYGRHNTWSAASGLDFDENHNVRLSYGTGFKAPTFMDLYYPGYE----------
D0I392_GRIHO          -HDENDQFGGNTTGLIAASWKMHDDYRIFSSYGTAFKAPGFDKLYGFGG-----------
Q1ZL48_PHOAS          -LDENQQYGTHSTYNIAGGWYLNDSIQLRGSYGTAFKAPNLYQLYVKSAWS-------TG
BTUB_VIBCM            -FDDNQEYGSQTTHNIALGYQFIPEFGVKASYGSAFKAPNLYQQYDPS----------YG
BTUB_VIBCB            -NDDNNQFGNNTTWQTAAGWSFYEGYELTLSHGTAFRAPSFVDLYYPG----------YE
BTUB_VIBPA            -NDENNQFGNNTTWQTAAGWKVYEGYELTLSHGTAFRAPSFVDLYYPG----------YE
C4L9A8_TOLAT          -TDDNQQYGRHNTWQAGLGWNFLPEYRLSARYGTAFRAPTFNDLYTPY----------SV
BTUB_VIBVU            -NDKHDTYDNYRTWSLGTRYQITESHSVRATFGTSFKAPSYSDLTNNPD-----------
F9S4Y9_9VIBR          -YDKHDSYDNYTTWSLGSLYHISDNHAVRFAVGTAFKAPSYSDLKDNAD-----------
C9P0V0_VIBME          -HDKHDKYDDYTTWSFAAGYQVNDHYRMRASYGTAFKAPSYTDLSTAPD-----------
B6ENT3_ALISL          KHDKHDKYDEYVTWGVGASYQINEIYRISSAYNTAFKAPSFYDLSTAPD-----------
BTUB_PHOPR            -TDDNDSYGTNNTWQLATAYNITSELKVSANAGTGFKAPTFNDLYWP----------DSG
D0Z0P4_PHODD          -TDDNQSYGRHNTWQLGSSYQITPEVKSYASVGTAFKAPTFNDLYWP----------ASG
C9QBP0_VIBOR          -TDDNESYGRSNTWQLGASYKLSDEIKAAANVGTGFKAPTFNDLYYP----------DAG
A0A0M0IFF1_9VIBR      -WDDNSSFGNFTTYQVGTGYHVTESVRLVAMYGTAFKAPTFNELYWPLECGPWG--CYSG
B7VM87_VIBA3          -GDDNQRYGKNTTWQAGLGYWLAANYRVTANAGTAFKAPTFNQLYWP----------GSG
A0A0A1E845_9VIBR      -QDGNSVYGQNTTWQLGAGYQLNQNIRFVASGGTAFQAPTYNNLYWP----------GYG
A3UZS0_VIBS1          -YDDDSAFGDHSTWNLAAGYYVLENVEAIASIGTAFKAPTFNDLYWP----------GSG
BTUB_VIBVY            -SDDDSAFGKHNTWNLGLGIAPSDYVEFIASTGTGFKAPTFNDLYWP----------SSG
U3AJI9_9VIBR          -NDNDSSFGSNTTWNLAAGVNIGDSLVASVSHGTAYRAPTFNDMYWPEDAF------SKG
A0A0B8PD35_9VIBR      -HDENSAYGGNTTWGVGAGWYITDSLQLTGNYGTAFRAPTFFDLFYSDAFG------GSG
                        * ..      *   .               .:.: :*   .                 

BTUB_YERPN            NANLKPEESKQWEGGVEGLTGPLTWRLSAYRNDIDQLIDYSNLT----------NGYFNI
BTUB_YERP3            NRDLKPEESTQWEAAITGITGPLDWRLSAYRNDIDQMIATRGVYPN--------SRYYNV
BTUB_PHOLL            NHDLKPEESKQWEGGIEGVTGQLTWRMTVYRNEIEQLIDYANSR------------YYNI
BTUB_ECOLI            NPNLDPEKSKQWEGAFEGLTAGVNWRISGYRNDVSDLIDYDDHT----------LKYYNE
BTUB_SHIDS            NPNLDPEKSKQWEGAFEGLTAGVNWRISGYRNDVSDLIDYDDHT----------LKYYNE
BTUB_SALTI            NPNLNPEKSKQWEGAFEGLTAGVSWRISGYRNDINDMIDYDDHL----------QKYYNE
BTUB_CITFR            NSNLDPEQSKQWEGAFEGLTAGVNWRVSGYRNDIDDMIDYDPHT----------EKYFNE
BTUB_ECOLX            NPNLAPEKSKQWEGAFEGLTGGVNWRISGYRNDISEMINYNPHT----------LRYYND
BTUB_CROS8            NDHLDPEESKQWEGAFEGLTAGVNWRVSAYRNDVDNLIDFNNNL----------QEYYNV
BTUB_ENT38            NDHLNPEESKQWEGAFEGLTAGVSWRVSAYRNDVDNLIDFDSNL----------QQYYNV
BTUB_PECAS            NRDLQPEESKQWESGVEGLTGPVIWRVSGYRNDIDNLIDATGSTG---------YVYENV
E0SGD8_DICD3          NISLKPEESKQWEFGVEGISGPVNWRASTYRNDINNLIEYDGTSNPAS------PTYFNV
C5BC44_EDWI9          NPNLRPEESRQWEVGLSGLSGPLDWQLSAYRNQVRNLITYFSDPITRH------GQYSNI
D4F053_EDWTA          NPDLRPEESRQWELGLSGVSGPLDWQLSAYRNQVRNLITYFSDPDTQQ------GQYLNI
B5XZ10_KLEP3          NPNLKPEESKQWEAGIDGLTGPLDWRISAYHYEIQNLIDYKNN------------QYINV
A0KEE6_AERHH          NPALKPEESKNLELGFSGRYTGWDWSLNLYRNQIQNLIACQSASS---------TCRPDN
K1IXA4_9GAMM          NPALQPEESKNLELDFSGRYTGWDWSANFYRNQIQNLIQCQKGYI---------TCTKGN
D0I392_GRIHO          NVNLKPEESENIEIGLEGNTYNIGWSLNGYINNIDNLITYSGSYPT--------GTNKNV
Q1ZL48_PHOAS          NPNLNPETSKNIDVSLHADYDIGSFAVTAYQMRIDDLIAYTGGTPS---------YQNVA
BTUB_VIBCM            NVNLQPEDADSAELSFYGLFSGIKWSITGYDYKINNLIDYNSTTKN---------YQNVI
BTUB_VIBCB            MPNLKPEESENTELSLSGAVSIVDWTVTGYYNEIENMLIWEGAGM------------QNV
BTUB_VIBPA            MPNLKPEESKNTELSLSGVASIVDWTVTGYYNQIENMLIWKGAGM------------QNI
C4L9A8_TOLAT          SPDLKPETSKNSEIALEGTTQEVLWRVTAYRNDLEDMIEWAPDSSGY-------WYPGNV
BTUB_VIBVU            ---LKPEEAMSREIGYTGEFALFTVDVAAYDNDVDNLIIWYEG--------SPWW-YPEN
F9S4Y9_9VIBR          ---LQPEEAMNREIGYIGNFNLFDLEITAYDNKVDNLIIWYQA--------SPW--YPLN
C9P0V0_VIBME          ---LEPEKSKNSEIGFYITYPLARVSVSAYDNQVDNLIIWYSDPNGAVCDVVNWGGCTLN
B6ENT3_ALISL          ---LEPETSDNIDVGLAAEYALVSVNLSLYKNKVDNLIIYYDA--------PNYMGYSAN
BTUB_PHOPR            NPNLKPEESKNYEISLSGTHQLLDWSITGYQSEIDQLIAWAPKDASNPSG---DWIPMNV
D0Z0P4_PHODD          NPDLQPEESTNYELGLSGHHQLLDWSVTAYRNDIDQLIAWAP----NATG---MWIPQNV
C9QBP0_VIBOR          NPNLQPEESFGYELGFHGYHDSVEWQVTGYKSEIDQLIAWAPVDPNNTAG---DWIPSNV
A0A0M0IFF1_9VIBR      NPDLEPEESQTAELAIEANLDLIELRIAAHSSDVEKMI---------ASN---GLTQVNI
B7VM87_VIBA3          VPTLKPEESKNYEVAFEAHQSLVDWRVSAYKNDIKNMIV--------------GWPSKNI
A0A0A1E845_9VIBR      NEDLQPEESLNFEAGAEVYTELADFRVIGYSNTITNLINYQS-----------KGEDLKN
A3UZS0_VIBS1          NPDLKRETSESKEVGFRGYHDLLDWSVVGYQSDIEDMIDW---APT-PAG---PWVPSNV
BTUB_VIBVY            NPNLKPETSKSSEVGIRSYLPFVQIDISAYRNEIEDMIDW---APTGPGG---AWTPSNI
U3AJI9_9VIBR          NPDLNPEKSESTELSLQGFHSWASWTISAYQTNIKDMIEWAP-DLSDPQG---KWQPSNV
A0A0B8PD35_9VIBR      NADLEAETSKSFEIGLNGYYDIVTWQLVAYQSDIENLI------VADPM----TFVPENV
                         *  * :   :                :   : .::                      

BTUB_YERPN            NKATIKGVEWTGSFDTGPLSHQVTLEYLDPRN--A---------DTHEILVRRAKQQVKY
BTUB_YERP3            EKATIKGVEWTGSFETGPLSHQVTLEYLDPRN--A---------DTHEILARRAKQQVKY
BTUB_PHOLL            GKAKIKGVEWTGLIDTGMFQHQLTIQYIDPRN--S---------ETNEILVRRAKQQVKY
BTUB_ECOLI            GKARIKGVEATANFDTGPLTHTVSYDYVDARN--A---------ITDTPLLRRAKQQVKY
BTUB_SHIDS            GKARIKGVEATANFDTGPLTHTVSYDYVDARN--A---------ITDTPLLRRAKQQVKY
BTUB_SALTI            GKARIKGIEATANFDTGPLTHTVSYDYVDARN--A---------ITDTPLPRRSKQMAKY
BTUB_CITFR            GKVRIKGVEATANFDTGPLAHTLSYDMVDSRN--A---------ITDKPLARRSKQQVKY
BTUB_ECOLX            GKVHVKGIEATVNFDTGALTHTVSYDYTDARN--A---------LTDKPLERRPKLQVKY
BTUB_CROS8            GKARIKGVEATASFDTGPLTHTLGYDYVDARN--A---------ATNALLVRRAKQQVKY
BTUB_ENT38            GKARIKGVEATASFDTGPLTHTVGYDYVDARN--A---------ATNELLDRRAKQQVKY
BTUB_PECAS            GKAKIKGIEATASFDTGPVGHRISYDYVDSRN--A---------ITDEPLARRAKQQVKY
E0SGD8_DICD3          AKAVIKGVEFTASYDTGPVTHHATLEYLDARN--A---------ETQAVLERRAHKKAKY
C5BC44_EDWI9          DSATIKGVEWVGSMDTWALSHRVTLQYIDPRD--D---------KTGDLLPRRSRHQGKY
D4F053_EDWTA          DSATIKGVEWVGSFDTWGVSHRITLQYIDPRD--D---------KTGELLPRRSRHQGKY
B5XZ10_KLEP3          KSATIKGLEWTGNVTTGPVEHHLTLQYVDPRD--D---------DTGKVLYRRAKQQVKY
A0KEE6_AERHH          TDAEIRGVEVALGLETGPLRHDLSFDYTRAEDK-N---------DGDQQLLRRAKQKASW
K1IXA4_9GAMM          TDAEIEGIELALGLDTWLVHHDFNYDYTRAKDK-N---------ANDQQLLRRAKHKGTW
D0I392_GRIHO          EEARIKGIELIADFDLGPVYNQVSLELRDPKD--L---------TKNMQLARRAKEVVKW
Q1ZL48_PHOAS          GESKIKGIEVEADFDTGFLSHQLNFDFKDPRNS------------KGQRLDRREKFSFKW
BTUB_VIBCM            GESNIKGVEFTAEFATGIVQHQLSVDLKDADDS------------KGKTLQRRAEHMYKW
BTUB_VIBCB            GEAEIKGVELEVKLDTDIVSHEFYLDYKDPVDKSG---------AEDTQLAYRSKRGAKW
BTUB_VIBPA            GEAEIKGIELEVKLDTDIVSHEFYLDYKDPVDKSG---------AEDTQLAYRSKRGAKW
C4L9A8_TOLAT          GRARIKGIELEAEFATGWLTHKLSADFKNARDL-----------EDGTVLSRRAKRNYKW
BTUB_VIBVU            VDATLKGLEITGYFNTWFVHHTVVAEFKDHQDS------------GGNKLAKRADENYKW
F9S4Y9_9VIBR          VDAKLKGIEITGQFDTSFIHHTVIAEFKDHKDS------------QGNKLAKRADENYKW
C9P0V0_VIBME          TDARIKGVELEVNFDTGPINHTLVAEYKDHKDD------------NHVQLARRAKENYKW
B6ENT3_ALISL          VDADIKGAELELLFDTGIVSHTVIAEYKDHEDT------------QGQQLARRAKQNYKW
BTUB_PHOPR            DEAEIQGIELTAGFATGMLYHDVSYDYLDAKDKGL-----------DKQLIRRSKDSAKW
D0Z0P4_PHODD          AKAKIKGVELTTGFATGPIYHDISYDYLEPEDAAT-----------GNQLIRRSKHNAKW
C9QBP0_VIBOR          NKAEMKGIESSITFYLDNVSNTFGYDYVDATDSST-----------GKQLIRRSKHVARW
A0A0M0IFF1_9VIBR      GEAEVKGYEVVGSFYTGPLYHTASYDYLDTEDKST-----------GNQLARRAKHSAKL
B7VM87_VIBA3          GVAEIKGLELSGEFDTGSFSHQVSLDFMDPTDKSD-----------GSQLLRRAKQNAKW
A0A0A1E845_9VIBR      SDAHIKGIELSSTFDTGNLSHSVSMDFLDHKNKVNVAGWGKPEDIQTKKLNRRANFVAKW
A3UZS0_VIBS1          DNVEIKGLEVEISFEVASISNRFVADWKDPKDKKD-----------NSQLIRRAKENFKW
BTUB_VIBVY            DNAKIEGIEIEALFETGVIEHRVSAEWKDPRDKSD-----------DSFLIRRARENFSW
U3AJI9_9VIBR          SKAEIRGIEASVEFDTWLIHHTVSADWKDPKNKET-----------GLQLANRAKQNYSW
A0A0B8PD35_9VIBR      DEARIQGIELSLDFETGPIQHTLVGDWKDPQDRSN-----------DRQLDRRAKQNYKW
                          :.* *         . :    :     :                 *  *       

BTUB_YERPN            QLDWQVADLDWSVTYQYLGQRYDK--------DYSTYP-----EETVELGGVSLWDLAVS
BTUB_YERP3            QLDWQMADLDWSVTYQYIGQRYDSV-----F-DPITYA-----ASPVKLAGISLWDLAVS
BTUB_PHOLL            QLDWQLYDFDWGLTYQYLGRRYDK--------DFSTSP-----AKRVKLGGVSFWDLTVS
BTUB_ECOLI            QLDWQLYDFDWGITYQYLGTRYDK--------DYSSYP-----YQTVKMGGVSLWDLAVA
BTUB_SHIDS            QLDWQLYDFDWGITYQYLGTRYDK--------DYSSYP-----YQTVKMGGVSLWDLAVA
BTUB_SALTI            QLDWDVYDFDWGVTYQYLGSRYDS--------DYSAYP-----YRTVKMGGVSLWDLTVA
BTUB_CITFR            QLDWQVYDFDWGLTYHYLGTRYDT--------DYVTY-------QPVKMGGVSLWDLAVS
BTUB_ECOLX            QLDWQVFDFDWGITYQYMGSRYDS--------DYSSWP-----YKSVKMGGVSLWDVAVA
BTUB_CROS8            QLDTQLYDFDWSLTYHYLGTRYDT--------DFSTYP-----TQNVKLGGVSLWDVAVS
BTUB_ENT38            QLDTQVYDFDWSLTYHYLGTRYDT--------DFGSYP-----YQKVKMGGVSLWDLAVS
BTUB_PECAS            QLDWQVYDLDWSVTYQYLGSRYDK--------DYGNYIPAVDDYQTVKLGGVSLWDLAAS
E0SGD8_DICD3          SIDTTVADVDWSLAWIYQGARADK--------KYNEFP-----SDPVKLGGYSTWDLSAA
C5BC44_EDWI9          QLDWNLWDLGMDLAYQYFGRSSDK--------SAPGG----------KLPSYSTVDISAS
D4F053_EDWTA          QLDWAMGSLEMDLAYQYYGRRNDS--------SAPGG----------KLPSYSTMDVSAS
B5XZ10_KLEP3          ELTGQIYDLDWNVMYQYLGKRYDD--------DYDNGR-------DVKMGGLSLWDVGLS
A0KEE6_AERHH          LTQVQLGPVDLSTELLYVGKRDDKNFSSFP-------------AERVELGSYTLINLGAS
K1IXA4_9GAMM          LTSFTTGQMTWSTEVLYVGERLD--------------------VGNVELSPYTLVNLGAT
D0I392_GRIHO          RTSVWLGDVLLGTQFMYQGERPNFS-----------------DGSGGTLSSYSVWDLTAQ
Q1ZL48_PHOAS          VGTASIGDLDSALTYQYHGKRPDQ------------------YGPTGELAAYDTWDLALT
BTUB_VIBCM            NALVAFEQVDWSIGYQYVGKRPDLD---YNTY----------PTQNITLDAYSLVDTSVS
BTUB_VIBCB            NAYATFDQWTLGSQYLYQGERFNG---------------------STRLPSYSLWNFTAS
BTUB_VIBPA            NAYATFDQWTLGSQYLYQGERFNG---------------------STRLPSYSLWNFTAS
C4L9A8_TOLAT          TGMANWDKWDASLTGQYQSERYDS---------------------STRLAPYALWNAAAG
BTUB_VIBVU            LMDASYENFDVNLTYTYTGERLGNPKE--------------VSDPKNELPSVSLWDASVG
F9S4Y9_9VIBR          LMDAAYENFDFNLTYTFTGERLGNPNE--------------TYTEENMLPSVGLWDISVG
C9P0V0_VIBME          MTAIQLGNFDINTTYTYTGKRLDLPTP--------------EPTSNDYIHSTNLWDVSVG
B6ENT3_ALISL          ISNVSFGDLDMNLSYIYTGKRSDLPSA--------------PGVATNYLDPYSLWTLAGA
BTUB_PHOPR            NVSYLAEQWQLDVSAIYKGTSYD------------------DAANTKKLDAYTLVDIAAS
D0Z0P4_PHODD          RMSYLLDDWQFDVNTIYHGSSYE------------------DATNKQKMDAYTLVDLAAS
C9QBP0_VIBOR          NLGYQLNAWQLDATAVYRGKSYE------------------DADNTNELEAFTLVDFAAS
A0A0M0IFF1_9VIBR      NTTYELNDWRFDLSYLYQGKRFD------------------DLANTTELEAYSLFDLAAS
B7VM87_VIBA3          NVTYFADNWQADLSYLYQGKRMD------------------SGN--AELDEYSLVDIAAS
A0A0A1E845_9VIBR      FVSYEYNAIRTDLSYQYQGKRFD------------------DTKNTTELAPYSLVNWSLS
A3UZS0_VIBS1          VSTYQFENFDLGLSVNYTGDRKD--------------------KSGETLKAYTTADLGLG
BTUB_VIBVY            VSTYSADRFGFSAVANYVGDRKD--------------------STGKTMDAYTLLDISAN
U3AJI9_9VIBR          IGTLEWQDLQTSLVTNYVGERPDS-----------------STAGANMMGSYITVDLALK
A0A0B8PD35_9VIBR      IAGYKYEDLGLSVATNYTGERPE-------------------AKGTVELDSYITVDIAAS
                                      : .                             :           

BTUB_YERPN            YPVTSHLTVRGRIANLFDKDYEMVYGY---------QTPGREYYFTGSYNF
BTUB_YERP3            YPVTSHLTVRGRIANLFDKDYEMVYGY---------QTPGREYYFTGSYNF
BTUB_PHOLL            YPVTSYLTIRARIANLLDKDYETVYGY---------RIPGREYYLTGSYNF
BTUB_ECOLI            YPVTSHLTVRGKIANLFDKDYETVYGY---------QTAGREYTLSGSYTF
BTUB_SHIDS            YPVTSHLTVRGKIANLFDKDYETVYGY---------QTAGREYTLSGSYTF
BTUB_SALTI            YPVTSHLTVRGKIANLFDKDYETVYGY---------QTAGREYTLSGSYTF
BTUB_CITFR            YPITSQLTVRGKIANRFDKDYETVYGY---------ATAGREYTLSGSYTF
BTUB_ECOLX            YPVTPHLIVRGKIANLFNKDYETGYGY---------QAAGREYILSGSYTF
BTUB_CROS8            YPVTSHLTVRGKIANLFDKDYETAYGY---------ATAGREYTLSGSYTF
BTUB_ENT38            YPVTSHLTVRGKIANLFDKDYETVYGY---------ETAGREYTLSGSYTF
BTUB_PECAS            YPVTSHLTVRGRIANLFDKDYETAYGY---------RTAGREYYLTGSYTF
E0SGD8_DICD3          YPVTSHLTVRARIANLFDKNYETVYGY---------RTAGREYYLTGSYSF
C5BC44_EDWI9          YPVTSQLTVRGRIGNLLDKNYQTAYGY---------QTAGREYYLSGSYTF
D4F053_EDWTA          YPVTSQLTVRGRIGNLLDKNYQTAYGY---------QTAGREYYLSGSYTF
B5XZ10_KLEP3          YPVTSHLTVRGKIANLFDKDYETVYGY---------QSAGREYTLSGSYTF
A0KEE6_AERHH          YGVTPQFTLGGRIDNLFDRDYAPAYGY---------ASAGTEFKLTADYRL
K1IXA4_9GAMM          YAATNQLTLGGRIDNLFDRNYEVAKGY---------ASPGTEFKVTADYRF
D0I392_GRIHO          YDISNNITLGAKVSNLFDKEYETAGDY---------PAAERAFYVNLNFAY
Q1ZL48_PHOAS          YWLQPKLALKGRVANLLNEDYETVGGY---------QMPGRTYYTSINYLF
BTUB_VIBCM            YYVTDSTTISARIDNLLDKEYETANGY---------PAAERAYYLNIGYQF
BTUB_VIBCB            YAVNQNWDINAKLSNAFDKDYEMYVGY---------VTPGRQYFVSADYRF
BTUB_VIBPA            YAVNSSWDINAKLSNAFDKNYEMYSGY---------ATPGRQYFVSADYRF
C4L9A8_TOLAT          YHVLPQLRIGGRIDNLFDKDYALASGY---------ATPERSYYVDFSYQL
BTUB_VIBVU            YWISPDLVVRARVDNLTNEKYQTTLSY---------NAPERRYFANLTYQF
F9S4Y9_9VIBR          YWISPKLVVRGKVDNLTDKEYQTTIGY---------AAPERRFFANMTYQF
C9P0V0_VIBME          YWLSDTMVIRSRIENLFNEQYQSALGY---------RAPERAFYLNASYQF
B6ENT3_ALISL          YWVTTELAVRGRVENLLDEEYETAGGY---------KPAERSYYVSLDYQF
BTUB_PHOPR            YFVTDNLSVRGRIANLFDKDYVAKETY---------NVQERSYYATATYKF
D0Z0P4_PHODD          YYMTEHLTLRGRIGNLFDADYQTRTSY---------NTPERTYYATATYQF
C9QBP0_VIBOR          YAFSEQLTVRGRIHNAFDEEYTTQETY---------NTMGRSYYLNATYAF
A0A0M0IFF1_9VIBR      YYFANGVTVAGKVANLFDEEYETAQGY---------KTPERNYYVSVAYQF
B7VM87_VIBA3          YFVTDHFTMRGRIANLFDKDYTLAKGY---------ETQERSFFINADYQF
A0A0A1E845_9VIBR      YQVDPNWVVRAKIDNLLNEQYETAYKY---------NTQDRAYYLNTAYQF
A3UZS0_VIBS1          YQVTDNFSTDLRLSNIFDEEYKTALGA----NGNYYLGEGRAYYFSASYQF
BTUB_VIBVY            YKMTEALTLGARVGNLFDKEYQTAHSS----GGKYYVGEGRNWFATVNYRF
U3AJI9_9VIBR          YSFTENLDARFKVSNLLDEDYEISKDTNSFTSTEYFKGAERGYYAGIDYRF
A0A0B8PD35_9VIBR      YQATDNLEVKFKVDNLFDEEYETSYDS---FNQFYWVGPERSFYAGVDYRF
                      *          :: *  : .*                     :     :