CLUSTAL format seed alignment for MF_01535

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RHAB_ECOUT      -----MTFRNCVAVDLGASSGRVMLARYERECRSLTLREIHRFNNGLHSQNGYVTWNVDS
RHAB_ECOK1      -----MTFRNCVAVDLGASSGRVMLARYERECRSLTLREIHRFNNGLHSQNGYVTWNVDS
RHAB_ECOL6      -----MTFRNCVAVDLGASSGRVMLARYERECRSLTLREIHRFNNGLHSQNGYVTWNVDS
RHAB_ECOL5      -----MTFRNCVAVDLGASSGRVMLARYERECRSLTLREIHRFNNGLHSQNGYVTWNVDR
RHAB_ECOLI      -----MTFRNCVAVDLGASSGRVMLARYERECRSLTLREIHRFNNGLHSQNGYVTWDVDS
RHAB_ECO57      -----MTFRNCVAVDLGASSGRVMLARYERECRSLTLREIHRFNNGLHSQNGYVTWDVDS
RHAB_SHIBS      -----MTFRNCVAVDLGASSGRVMLARYERECRSLTLREIHRFNNGLHSQNGYVTWNVDS
RHAB_SHISS      -----MTFRNCVAVDLGASSGRVMLARYERECRSLTLREIHRFNNGLHSQNGYVTWNVDS
RHAB_SHIFL      -----MTFRNCVAVDLGASSGRVMLARYERECRSLTLREIHRFNNGLHSQNGYVTWDVDS
RHAB_SHIF8      -----MTFRNCVAVDLGASSGRVMLARYERECRSLTLREIHRFNNGLHSQNGYVTWDVDS
RHAB_SALCH      -----MTFRHCVAVDLGASSGRVMLARYDSKHRTLTLREIHRFVNCLQKTDGFDTWDIDS
RHAB_SALTY      -----MTFRHCVAVDLGASSGRVMLARYDSKHRTLTLREIHRFVNCLQKTDGFDTWDIDS
RHAB_SALPA      -----MTFRHCVAVDLGASSGRVMLARYDSKHRTLTLREIHRFVNCLQKTDGFDTWDIDS
RHAB_SALTI      -----MTFRHCVAVDLGASSGRVMLARYDSKHRTLTLREIHRFVNCLQKTDGFDTWDIDS
RHAB_YERPE      ----------MVAIDLGASSGRVMLASYYPGQQQLTLREVCRFTNQIKSIDGSDVWDIDA
RHAB_YERPA      ----------MVAIDLGASSGRVMLASYYPGQQQLTLREVCRFTNQIKSIDGSDVWDIDA
RHAB_YERPN      ----------MVAIDLGASSGRVMLASYYPGQQQLTLREVCRFTNQIKSIDGSDVWDIDA
RHAB_YERPS      ----------MVAIDLGASSGRVMLASYYPGQQQLTLREVCRFTNQIKSIDGSDVWDIDA
RHAB_YERPP      ----------MVAIDLGASSGRVMLASYYPGQQQLTLREVCRFTNQIKSIDGSDVWDIDA
RHAB_PECAS      -----MAVKNIVAVDLGASSGRVMLATFHTATQHLTLKEIHRFSNTLVFQDNHHQWDLVA
RHAB_MANSM      -----MTILNIAAVDLGASSGRVMLASYSTENHKISLEEIHRFKNQFVSQNGHECWDLAY
RHAB_BACTN      ------MKQNFFAVDLGATSGRTILGSFIEG--GLNLEEINRFPNHLIEVGGHFYWDIYA
RHAB_BACHD      -------MNYSLAVDIGASSGR-LIVGEC--NKKIQLTEIHRFENQIIEKNGQFCWDVDA
RHAB_OCEIH      ------MQQCNLAVDIGASSGR-VIAGYLQ-NGKLQLEEVHRFDNKLIDLNNYFCWDIDR
RHAB_LACPL      -------MKSYIAVDIGASSGR-LMLGQ-QKRGQLTLKEVHRFSNGFAMKDGHDRWDVDH
RHAB_LACS1      -------MKAYVAVDIGASSGR-LMLGQ-LEDGKLKLQEMHRFKNGFEFKNNHDRWNIDY
RHAB_LISIN      -------MKHYVAVDIGASSGR-LILGK-LVNEKLQLEEIHRFKNGFTYRDGHERWEIDQ
RHAB_LISMF      -------MKHYVAVDIGASSGR-LILGK-LVDEKLQLEEIHRFKNGFTYRDGHERWEIDQ
RHAB_LISMO      -------MKHYVAVDIGASSGR-LILGK-LVNEKLQLEEIHRFKNGFTYRDGHERWEIDQ
RHAB_BACSU      --------MIYTAIDVGASSGR-IMVGE-LNEGKLDIQEIHRFANGFSQRDGHCLWDIDH
RHAB_ENTFA      MKKEQVEKRTYLAVDIGASSGR-IMKSQRLANGQITIEEIHRFKNGFHQKDGYQRWDMAS
                            *:*:**:*** ::         : : *: ** * :   ..   *::  

RHAB_ECOUT      LESAIRLGLNKVCEEGIRIDSIGIDTWGVDFVLLDQQGQRVGLPVAYRDSRTNGLMAQAQ
RHAB_ECOK1      LESAIRLGLNKVCEEGIRIDSIGIDTWGVDFVLLDQQGQRVGLPVAYRDSRTNGLMAQAQ
RHAB_ECOL6      LESAIRLGLNKVCEEGIRIDSIGIDTWGVDFVLLDQQGQRVGLPVAYRDSRTNGLMAQAQ
RHAB_ECOL5      LESAIRLGLNKVCEEGIRIDSIGIDTWGVDFVLLDQQGQRVGLPVAYRDSRTNGLMAQAQ
RHAB_ECOLI      LESAIRLGLNKVCEEGIRIDSIGIDTWGVDFVLLDQQGQRVGLPVAYRDSRTNGLMAQAQ
RHAB_ECO57      LESAIRLGLNKVCEEGIRIDSIGIDTWGVDFVLLDQQGQRVGLPVAYRDSRTNGLMAQAQ
RHAB_SHIBS      LESAIRLGLNKVCEEGIRIDSIGIDTWGVDFVLLDQQGQRVGLPVAYRDSRSNGLMAQAQ
RHAB_SHISS      LESAIRLGLNKVCEEGIRIDSIGIDTWGVDFVLLDQQGQRVGLPVAYRDSRSNGLMAQAQ
RHAB_SHIFL      LESAIRLGLNKVCEEGIRIDSIGIDTWGVDFVLLDQQGQRVGLPVAYRDSRTNGLMPQAQ
RHAB_SHIF8      LESAIRLGLNKVCEEGIRIDSIGIDTWGVDFVLLDQQGQRVGLPVAYRDSRTNGLMPQAQ
RHAB_SALCH      LEKDIRLGLKKVCNEGILIDSIGIDTWGVDYVLLDKQGQRVGLPVSYRDNRTTGIMPQAL
RHAB_SALTY      LEKDIRLGLKKVCNEGILIDSIGIDTWGVDYVLLDKQGQRVGLPVSYRDNRTTGIMPQAL
RHAB_SALPA      LEKDIRLGLKKVCNEGILIDSIGIDTWGVDYVLLDKQGQRVGLPVSYRDNRTTGIMPQAL
RHAB_SALTI      LEKDIRLGLKKVCNEGILIDSIGIDTWGVDYVLLDKQGQRVGLPVSYRDNRTTGIMPQAL
RHAB_YERPE      IEQSIREGLSQLDSEGIALDSIGIDSWGVDFVLLDKQGKRIGQPVSYRDSRTQGVMARAQ
RHAB_YERPA      IEQSIREGLSQLDSEGIALDSIGIDSWGVDFVLLDKQGKRIGQPVSYRDSRTQGVMARAQ
RHAB_YERPN      IEQSIREGLSQLDSEGIALDSIGIDSWGVDFVLLDKQGKRIGQPVSYRDSRTQGVMARAQ
RHAB_YERPS      IEQSIREGLSQLDSEGIALDSIGIDSWGVDFVLLDKQGKRIGQPVSYRDSRTQGVMARAQ
RHAB_YERPP      IEQSIREGLSQLDSEGIALDSIGIDSWGVDFVLLDKQGKRIGQPVSYRDSRTQGVMARAQ
RHAB_PECAS      LERDILTGLQQIDAMGIAPDSIGVDSWGVDYVLLDKNGQRVGLPYSYRDHRTDGVMAAVT
RHAB_MANSM      LENEIVNGLRKISNSGRTLHSIGIDTWGVDYVLLDQNGEVVGPTYAYRDHRTDGVMQKVQ
RHAB_BACTN      LYRHIIDGLKLVAHRGESIASIGIDTWGVDFVLLGKDGNLLRQPYAYRDPHTVGAPEAFF
RHAB_BACHD      LFSEIKTGLKKCREAGIEPVSMGIDTWAVDFVLLDEHDKPLTDAVSYRDPRTDGVMEEVI
RHAB_OCEIH      IYQEILMGIKSAVDNGYQPISLGIDTWAVDFVLLDENDMRLTDAVSYRDPRTDGMMEEVF
RHAB_LACPL      LIHEIFKGLEKVKKMGIKDVELGIDTWAVDYVLVGENGHKLEDPISYRDKRTHNAIQQLT
RHAB_LACS1      LIDEIFKGLEKIKESGYTEVSLGIDTWAVDYVLVGKDGKKLQDPISYRDKRTSNSINELT
RHAB_LISIN      LMQEIFIGLEKVKQLGISECVLGIDTWGVDYVLIGASGEKLADPISYRDKRTLNAVQNLT
RHAB_LISMF      LMQEIFIGLEKVKQLGISECVLGIDTWGVDYVLIGASGEKLADPISYRDKRTLNAVQNLT
RHAB_LISMO      LMQEIFIGLEKVKQLGISECVLGIDTWGVDYVLIGASGEKLADPISYRDKRTLNAVQNLT
RHAB_BACSU      LLKQILQGLQKVKTLGYEHCTVGIDTWAVDYVLLDEKGDRLREAISYRDRRTDHTIDKLE
RHAB_ENTFA      LVHELLLGLQKVKQLGIKECFIGIDTWGVDYCLLDQSGQLLDEPIAYRDGRTEAAVTNFS
                :   :  *:      *     :*:*:*.**: *:.  .  :  . :*** ::        

RHAB_ECOUT      QQLGKRDIYQRSGIQFLPFNTIYQLRALTEQQPELIPHIAHALLIPDYFSYRLTGKMNWE
RHAB_ECOK1      QQLGKRDIYQRSGIQFLPFNTIYQLRALTEQQPELIPHIAHALLIPDYFSYRLTGKMNWE
RHAB_ECOL6      QQLGKRDIYQRSGIQFLPFNTIYQLRALTEQQPELIPHIAHALLIPDYFSYRLTGKMNWE
RHAB_ECOL5      QQLGKRDIYQRSGIQFLPFNTIYQLRALTEQQPELIPHIAHALLIPDYFSYRLTGKMNWE
RHAB_ECOLI      QQLGKRDIYQRSGIQFLPFNTLYQLRALTEQQPELIPHIAHALLMPDYFSYRLTGKMNWE
RHAB_ECO57      QQLGKRDIYQRSGIQFLPFNTLYQLRALTEQQPELIPHIAHALLMPDYFSYRLTGKMNWE
RHAB_SHIBS      QQLGKRDIYQRSGIQFLPFNTLYQLRALTEQQPELIPHIAHALLMPDYFSYRLTGKMNWE
RHAB_SHISS      QQLGKRDIYQRSGIQFLPFNTLYQLRALTEQQPELIPHIAHALLMPDYFSYRLTGKMNWE
RHAB_SHIFL      QQLGKRDIYQRSGIQFLPFNTLYQLRALTEQQPELIPHIAHALLMPDYFSYRLTGKMNWE
RHAB_SHIF8      QQLGKRDIYQRSGIQFLPFNTLYQLRALTEQQPELIPHIAHALLMPDYFSYRLTGKMNWE
RHAB_SALCH      VQIGKSEIYRRSGIQFLPFNTIYQLRALTKQQPELTAQVAHALLMPDYFSYRLTGEMNWE
RHAB_SALTY      VQIGKSEIYRRSGIQFLPFNTIYQLRALTKQQPELTAQVAHALLMPDYFSYRLTGEMNWE
RHAB_SALPA      VQIGKSEIYRRSGIQFLPFNTIYQLRALTKQQPELTAQVAHALLMPDYFSYRLTGEMNWE
RHAB_SALTI      VQIGKSEIYRRSGIQFLPFNTIYQLRALTKQQPELTAQVAHALLMPDYFSYRLTGEMNWE
RHAB_YERPE      QTLGSNAIYRRTGIQFLPFNTLYQLRALSEQQPHLLADVAHLLLIPDYLHYRLTGQLNWE
RHAB_YERPA      QTLGSNAIYRRTGIQFLPFNTLYQLRALSEQQPHLLADVAHLLLIPDYLHYRLTGQLNWE
RHAB_YERPN      QTLGSNAIYRRTGIQFLPFNTLYQLRALSEQQPHLLADVAHLLLIPDYLHYRLTGQLNWE
RHAB_YERPS      QTLGSNAIYRRTGIQFLPFNTLYQLRALSEQQPHLLADVAHLLLIPDYLHYRLTGQLNWE
RHAB_YERPP      QTLGSNAIYRRTGIQFLPFNTLYQLRALSEQQPHLLADVAHLLLIPDYLHYRLTGQLNWE
RHAB_PECAS      AELGREAIYQHTGIQFLPFNTLYQLKALCDAPPDDLDKVEHLLMIPDYFHYRLTGNLVCE
RHAB_MANSM      AELGKEVIYRKTGIQFLTFNTLYQLKAMTDENPAWLSQVKDFVMIPDYLNYRLTGVINRE
RHAB_BACTN      SRISRSEVYGKTGIQVMNFNSLFQLDTLRRNHDSALEAADKVLFMPDALSYMLTGKMVTE
RHAB_BACHD      EQFMKERLYLETGIQFQQFNTIYQLYALKKQHPDIFKKAKSFLMIPDYFHFLLTGKKANE
RHAB_OCEIH      SQISKERLYLETGIQFQKFNTMYQLQALKNSNPDLIEKATSFLMIPDYLNFLLTGKKVNE
RHAB_LACPL      SDLPKEYIYEKTGIQFQDFNTLYQLYKENH---DLLAKTDKIMMMPDYLGYVLTGNAVTE
RHAB_LACS1      TEVSKEYIYKKTGIQFLNFNTLYQLFEEDK---ELLKKTDKIMMIPDYIGYILTGKAVTE
RHAB_LISIN      SEYPREYIYKKTGIQFMELNTLYQLYVEER---NLLERAEKILLIPDYIGYVLTGVKVAE
RHAB_LISMF      SEYPREYIYKKTGIQFMELNTLYQLYVEER---DLLERAEKILLIPDYIGYVLTGVKVAE
RHAB_LISMO      SEYPREYIYKKTGIQFMELNTLYQLYVEER---DLLERAEKILLIPDYIGYVLTGVKVAE
RHAB_BACSU      HTLSKAAIYQKTGIQFQPFNTIYQLFEEDR---ELLKKTDKIMMIPDYLGYCLTGKAVTE
RHAB_ENTFA      KGYSLEKLYQQTGIQVQPFNTIFQLFVEEK---ERLAAASQLLLIPDYLGYVFTGKAVIE
                       :* .:***.  :*:::**                 :::** : : :**    *

RHAB_ECOUT      YTNATTTQLVNINSDDWDESLLAWSGANKAWFGRPTHPGNVIGHWICPQGN-----EIPV
RHAB_ECOK1      YTNATTTQLVNINSDDWDESLLAWSGANKAWFGRPTHPGNVIGHWICPQGN-----EIPV
RHAB_ECOL6      YTNATTTQLVNINSDDWDESLLAWSGANKAWFGRPTHPGNVIGHWICPQGN-----EIPV
RHAB_ECOL5      YTNATTTQLVNINSDDWDESLLAWSGANKAWFGRPTHPGNVIGHWICPQGN-----EIPV
RHAB_ECOLI      YTNATTTQLVNINSDDWDESLLAWSGANKAWFGRPTHPGNVIGHWICPQGN-----EIPV
RHAB_ECO57      YTNATTTQLVNINSDDWDESLLAWSGANKAWFGRPTHPGNVIGHWICPQGN-----EIPV
RHAB_SHIBS      YTNATTTQLVNINSDDWDESLLAWSGANKAWFGRPTHPGNVIGHWICPQGN-----EIPV
RHAB_SHISS      YTNATTTQLVNINSDDWDESLLAWSGANKAWFGRPTHPGNVIGHWICPQGN-----EIPV
RHAB_SHIFL      YTNATTTQLVNINSDDWDESLLAWSGANKAWFGRPTHPGNVIGHWICPQGN-----EIPV
RHAB_SHIF8      YTNATTTQLVNINSDDWDESLLAWSGANKAWFGRPTHPGNVIGHWICPQGN-----EIPV
RHAB_SALCH      YTNATTTQLVNINTDDWDDTLLAWTGAKKSWFGRPSHPGNVIGDWICPQGN-----RIPV
RHAB_SALTY      YTNATTTQLVNINTDDWDDTLLAWTGAKKSWFGRPSHPGNVIGDWICPQGN-----RIPV
RHAB_SALPA      YTNATTTQLVNINTDDWDDTLLAWTGAKKSWFGRPSHPGNVIGDWICPQGN-----RIPV
RHAB_SALTI      YTNATTTQLVNINTDDWDDTLLAWTGAKKSWFGRPSHPGNVIGDWICPQGN-----RIPV
RHAB_YERPE      YTNASTTQLLNIETGDWDSDLLAYAGVPAHWFAKPGKPGNTIGYWHSANGQ-----QVPV
RHAB_YERPA      YTNASTTQLLNIETGDWDSDLLAYAGVPAHWFAKPGKPGNTIGYWHSANGQ-----QVPV
RHAB_YERPN      YTNASTTQLLNIETGDWDSDLLAYAGVPAHWFAKPGKPGNTIGYWHSANGQ-----QVPV
RHAB_YERPS      YTNASTTQLLNIETGDWDSDLLAYAGVPAHWFAKPGKPGNTIGYWHSANGQ-----QVPV
RHAB_YERPP      YTNASTTQLLNIETGDWDSDLLAYAGVPAHWFAKPGKPGNTIGYWHSANGQ-----QVPV
RHAB_PECAS      YTNASTTQLLNLEKKTWDGELLDYLGVPRRWLSDPVQPGHAVGNWTAPSGR-----QIPV
RHAB_MANSM      YTNATTTQLVNVNIDSWDTALLDYLGLPASWFGRIRHPGHQVGLWEN---------RVPV
RHAB_BACTN      YTIASTAQLVNAHTQRLEPELLKAVGLQEENFGRFVFPGEKIGTLTEEVQKITGLGAIPV
RHAB_BACHD      YTNATTTQLVNAFTKKWDKDIIEALGFNPDMFQEIKLPTESLGKLKSEWVEEVGF-DLEV
RHAB_OCEIH      YTNATTTQLVNAFTKKWDIDLIEQLGFNSNMFMDIQPPESVIGNLRPELQEELGV-DFNV
RHAB_LACPL      ITNASTTQMLNLRVGLFDKDLLGKVNVSQDQFPRLVESGSVLGNVSHKWHTQYDIPEVEV
RHAB_LACS1      ITNASTTQMLSLREGLFDKNLLEKVNVSSDQFAKLVDAGTVLGNLKEDWYSKYELPKVNV
RHAB_LISIN      TTNSSTTQMLNLREQLFDKDLLSHLNIDVEKFAPLTDAGTYLGKVKAEWLEEYDIPNCDV
RHAB_LISMF      TTNSSTTQMLNLREQLFDKDLLSHLNIDVEKFAPLTDAGTYLGKVKEEWLEKYDIPNCDV
RHAB_LISMO      TTNSSTTQMLNLREQLFDKDLLSHLNIDVEKFAPLTDAGTYLGEVKEDWLKMYDIPNCDV
RHAB_BACSU      ITNVSTTQLLNVSTGNLDPELLEAVSVLEQQFAPLTEPGCELGKLRNEWFPDYDLPACKV
RHAB_ENTFA      ATNASTTQLLNAGTKQWESELLDFLGIDETLFPTLVEPGTILGDLQTAAFPDYDLPNATL
                 *  :*:*::.      :  ::   .     :     .   :*                :

RHAB_ECOUT      VAVASHDTASAVIASPLNGSRAAYLSSGTWSLMGFESQTPFTNDTALAANITNEGGAEGR
RHAB_ECOK1      VAVASHDTASAVIASPLNGSRAAYLSSGTWSLMGFESQTPFTNDTALAANITNEGGAEGR
RHAB_ECOL6      VAVASHDTASAVIASPLNGSRAAYLSSGTWSLMGFESQTPFTNDTALAANITNEGGAEGR
RHAB_ECOL5      VAVASHDTASAVIASPLNGSRAAYLSSGTWSLMGFESQTPFTNDTALAANITNEGGAEGR
RHAB_ECOLI      VAVASHDTASAVIASPLNGSRAAYLSSGTWSLMGFESQTPFTNDTALAANITNEGGAEGR
RHAB_ECO57      VAVASHDTASAVIASPLNGSRAAYLSSGTWSLMGFESQTPFTNDTALAANITNEGGAEGR
RHAB_SHIBS      VAVASHDTASAVIASPLNGSRAAYLSSGTWSLMGFESQTPFTNDTALAANITNEGGAEGR
RHAB_SHISS      VAVASHDTASAVIASPLNGSRAAYLSSGTWSLMGFESQTPFTNDTALAANITNEGGAEGR
RHAB_SHIFL      VAVASHDTASAVIASPLNGSRAAYLSSGTWSLMGFESQTPFTNDTALAANITNEGGAEGR
RHAB_SHIF8      VAVASHDTASAVIASPLNGSRAAYLSSGTWSLMGFESQTPFTNDTALAANITNEGGAEGR
RHAB_SALCH      VAVASHDTASAVIASPLANKHSAYLSSGTWSLMGFESKMPYTTDEALAANITNEGGAEGR
RHAB_SALTY      VAVASHDTASAVIASPLANKHSAYLSSGTWSLMGFESKMPYTTDEALAANITNEGGAEGR
RHAB_SALPA      VAVASHDTASAVIASPLANKHSAYLSSGTWSLMGFESKKPYTTDEALAANITNEGGAEGR
RHAB_SALTI      VAVASHDTASAVIASPLANKHSAYLSSGTWSLMGFESKKPYTTDEALAANITNEGGAEGR
RHAB_YERPE      VAVATHDTASAVLAAPLIDADAAYLSSGTWSLMGFESGTPLTHQQAQCSNITNEGGAEGR
RHAB_YERPA      VAVATHDTASAVLAAPLIDADAAYLSSGTWSLMGFESGTPLTHQQAQCSNITNEGGAEGR
RHAB_YERPN      VAVATHDTASAVLAAPLIDADAAYLSSGTWSLMGFESGTPLTHQQAQCSNITNEGGAEGR
RHAB_YERPS      VAVATHDTASAVLAAPLIDADAAYLSSGTWSLMGFESGTPLTHQQAQCSNITNEGGAEGR
RHAB_YERPP      VAVATHDTASAVLAAPLIDADAAYLSSGTWSLMGFESGTPLTHQQAQCSNITNEGGAEGR
RHAB_PECAS      TAVATHDTASAVVGAPLQSRDSAYLSSGTWSLMGIESDTPFNSPQALAANITNEGGVDDT
RHAB_MANSM      MSVASHDTASAVISAPLSDENAAYLCSGTWSLMGLDTTTPCTDECAMNANITNEGGIDGH
RHAB_BACTN      IAVAGHDTGSAVAAVPALDRNFAYLSSGTWSLMGVETDAPVITAETEALNFTNEGGVEGT
RHAB_BACHD      ILPATHDTGSAVVAVPKV-ADTIYLSSGTWSLIGVENSFPICVTKALDYNFTNEGGMNYQ
RHAB_OCEIH      ILPATHDTGSAVVAVPEQ-ENSIYISSGTWSLIGVENHFPICTTKALDYNFTNEGGADYR
RHAB_LACPL      VTVATHDTASAVVGTPGEGDRWAFLSSGTWSLLGTELNVPENGLQAFHENYTNEWGAYGT
RHAB_LACS1      VTVATHDTASAVIGTPCEGQHWAYLSSGTWSLIGTELNIPENGAKVFKENYTNEWGAYGT
RHAB_LISIN      VTVATHDTASAVVGTPAEGENWAFLSSGTWSLIGMELIAPINNEAAFKENYTNEWGAYGT
RHAB_LISMF      VTVATHDTASAVVGTPAEGENWAFLSSGTWSLIGMELSAPINNEAAFKENYTNEWGAYGT
RHAB_LISMO      VTVATHDTASAVVGTPAEGENWAFLSSGTWSLIGMELSAPINNEVAFKENYTNEWGAYGT
RHAB_BACSU      MTVATHDTASAVIAAPGVNDGWAYISSGTWSLIGVENKTPIITDLALENNYTNERGANNT
RHAB_ENTFA      ITIASHDTASAILGTPGIGDDWAYISSGTWSLLGIETTVTTISAEAFQENYTNEWGAQNT
                   * ***.**: . *       ::.******:* :   .     .   * *** *    

RHAB_ECOUT      YRVLKNIMGLWLLQRVLQERQ-INDLPALIAATQALPACRFIINPNDDRFINPDEMCSEI
RHAB_ECOK1      YRVLKNIMGLWLLQRVLQERQ-INDLPALIAATQALPACRFIINPNDDRFINPDEMCSEI
RHAB_ECOL6      YRVLKNIMGLWLLQRVLQERQ-INDLPALIAATQALPACRFIINPNDDRFINPDEMCSEI
RHAB_ECOL5      YRVLKNIMGLWLLQRVLQERQ-INDLPALIAATQALPACRFIINPNDDRFINPDEMCSEI
RHAB_ECOLI      YRVLKNIMGLWLLQRVLQEQQ-INDLPALISATQALPACRFIINPNDDRFINPETMCSEI
RHAB_ECO57      YRVLKNIMGLWLLQRVLQERQ-INDLPALISATQALPACRFIINPNDDRFINPETMCSEI
RHAB_SHIBS      YRVLKNIMGLWLLQRVLQERQ-INDLPALIAATQALPACRFIINPNDDRFINPEAMCSEI
RHAB_SHISS      YRVLKNIMGLWLLQRVLQERQ-INDLPALIAATQALPACRFIINPNDDRFINPEAMCSEI
RHAB_SHIFL      YRVLKNIMGLWLLQRVLQERQ-INDLPALIAATQALPACRFIINPNDDRFINPDEMCSEI
RHAB_SHIF8      YRVLKNIMGLWLLQRVLQERQ-INDLPALIAATQALPACRFIINPNDDRFINPDEMCSEI
RHAB_SALCH      YRVLKNIMGLWLLQRVLKERR-ITDLPALIAQTEALPACRFLINPNDDRFINPDDMRAEI
RHAB_SALTY      YRVLKNIMGLWLLQRVLKERR-ITDLPALIAQTEALPACRFLINPNDDRFINPDDMRAEI
RHAB_SALPA      YRVLKNIMGLWLLQRVLKERR-ITDLPALIAQTEALPACRFLINPNDDRFINPDDMHAEI
RHAB_SALTI      YRVLKNIMGLWLLQRVLKERR-ITDLPVLIAQTEALPACRFLINPNDDRFINPDDMRAEI
RHAB_YERPE      YRVLKNIMGLWLLQRATDELQ-IDDLPQLIEQAARQPACRSLINPNDSRFINPPNMCREI
RHAB_YERPA      YRVLKNIMGLWLLQRATDELQ-IDDLPQLIEQAARQPACRSLINPNDSRFINPPNMCREI
RHAB_YERPN      YRVLKNIMGLWLLQRATDELQ-IDDLPQLIEQAARQPACRSLINPNDSRFINPPNMCREI
RHAB_YERPS      YRVLKNIMGLWLLQRATDELQ-IDDLPQLIEQAARQPACRSLINPNDSRFINPPNMCREI
RHAB_YERPP      YRVLKNIMGLWLLQRATDELQ-IDDLPQLIEQAARQPACRSLINPNDSRFINPPNMCREI
RHAB_PECAS      YRVLKNIMGLWLLQRVCQERD-IKDLGTLIQSATTLPAFVSLINPNDDRFINPPSMHQAI
RHAB_MANSM      YRVLKNIMGLWLFNRLCTERD-VTDIPALVKQAEAELPFQSLINPNAECFLNPSSMVEAI
RHAB_BACTN      IRLLKNICGMWLLERCRLNWG-DTSYPELITEADSCEPFRSLINPDDDCFANPADMEQAI
RHAB_BACHD      FRFLKNIMGLWMIQEVRRNYDNRYSFAQLVELSKGI-SFKSTVDVNDPRFLKPTNMIKEI
RHAB_OCEIH      YRFLKNIMGLWMIQEVKRNFNDEFEFADFAAMAKGE-SFKSIVDVDDDRFLKPENMIEEI
RHAB_LACPL      YRFLKNIMGLWVAQCVRHELGDQYSFGELADLAQQVRPFQQFIDINDERFTNPENMIKEL
RHAB_LACS1      YRFLKNIMGLWMAQCVKKELNDQYSFSELAELAGEVEPFEQFINVNDQRFQNPGNMIQEI
RHAB_LISIN      YRFLKNIMGLWIVQEIARMDDYKHSFAEMAEEASNYPYFKQIINVNDARFNNPENMVDEI
RHAB_LISMF      YRFLKNIMGLWIVQEIARMDDYKHSFAEMAEEASNYPYFKQIINVNDARFNNPENMVDEI
RHAB_LISMO      YRFLKNIMGLWIVQEIARMDDYKHSFAEMAEEAGNYPYFKQIINVNDARFNNPENMVDEI
RHAB_BACSU      IRFLKNIIGMWVIQEVKQQLQADYSFQQLAEEAKKTEPFQQFINLNDKRFLNPENMIKEI
RHAB_ENTFA      IRFLKNIMGMWLIQEVARHQNYQYSYAELAALAEKEPAFQQFIDVNDPRFLNPGNMITEL
                 *.**** *:*: :          .   :   :         :: :   * :*  *   :

RHAB_ECOUT      QAACRETAQPIPESDAELARCIFDSLALLYADVLHELAQLRG--EDFSQLHIVGGGCQNT
RHAB_ECOK1      QAACRETAQPIPESDAELARCIFDSLALLYADVLHELAQLRG--EDFSQLHIVGGGCQNT
RHAB_ECOL6      QAACRETAQPIPESDAELARCIFDSLALLYADVLHELAQLRG--EDFSQLHIVGGGCQNT
RHAB_ECOL5      QAACRETAQPIPESDAELARCIFDSLALLYADVLHELAQLRG--EDFSQLHIVGGGCQNA
RHAB_ECOLI      QAACRETAQPIPESDAELARCIFDSLALLYADVLHELAQLRG--EDFSQLHIVGGGCQNT
RHAB_ECO57      QAACRETAQPIPESDAELARCIFDSLALLYADVLHELAQLRG--EDFSQLHIVGGGCQNT
RHAB_SHIBS      QAACRETAQPIPESDAELA-------------------QLRG--EDFSQLHIVGGGCQNT
RHAB_SHISS      QAACREMAQPLPESDAELARCIFDSLALLYADVLHELAQLRG--EDFSQLHIVGGGCQNT
RHAB_SHIFL      QAACRETAQPIPGSDAELARCIFDSLALLYADVLHELAQLRG--EDFSQLHIVGGGCQNT
RHAB_SHIF8      QAACRETAQPIPGSDAELARCIFDSLALLYADVLHELAQLRG--EDFSQLHIVGGGCQNT
RHAB_SALCH      QAVCRETDQPVPVSDAELARCIFDSLALLYADILHELANLRG--EKFTQLHIVGGGCQNS
RHAB_SALTY      QAACRETDQPVPVSDAELARCIFDSLALLYADILHEQANLRG--EKFTQLHIVGGGCQNS
RHAB_SALPA      QAACRETDQPVPVSDAELARCIFDSLALLYADILHELANLRG--EKFTQLHIVGGGCQNA
RHAB_SALTI      QAACRETDQPVPVSDAELARCIFDSLALLYADILHELANLRG--EKFTQLHIVGGGCQNA
RHAB_YERPE      QNACREHQFPVPNTAAQLARCIFDSLAMLYRQVAQELATLRG--RPISHLHIVGGGCQNQ
RHAB_YERPA      QNACREHQFPVPNTAAQLARCIFDSLAMLYRQVAQELATLRG--RPISHLHIVGGGCQNQ
RHAB_YERPN      QNACREHQFPVPNTAAQLARCIFDSLAMLYRQVAQELATLRG--RPISHLHIVGGGCQNQ
RHAB_YERPS      QNACREHQFPVPNTAAQLARCIFDSLAMLYRQVAQELATLRG--RPISHLHIVGGGCQNQ
RHAB_YERPP      QNACREHQFPVPNTAAQLARCIFDSLAMLYRQVAQELATLRG--RPISHLHIVGGGCQNQ
RHAB_PECAS      RDYCREHGQPVPQSDAELARCIFDSLALLYRQVVLELGELRH--APIRQLHIVGGGSQNA
RHAB_MANSM      QQYCREHNQVIPKTTAQLARCIFDSLAMLYRKVALELAGLQG--KPISALHIVGGGSQNA
RHAB_BACTN      REYCRTTGQPVPEQRGQIVRCIFESLALRYRQVLENLRALSP--RPIETLHVIGGGSRND
RHAB_BACHD      QRYCQETGQQAPELPGEVAKCVFESLAESYTSAVAEIEDIFE--KDFKSINVIGGGCRNE
RHAB_OCEIH      KAYCKETNQAIPQSPSEVAKCVFNSLAVSYQQAISQIEEIYE--IDFPTIYVIGGGSKNE
RHAB_LACPL      QDYCRETKQTIPETPGELFQAIYSNLSLFYANELNKLDRILG--YHIDTLNIVGGGSNVA
RHAB_LACS1      QTYCRETGQKVPETPGEIMMAIYSNLALFYANEISKLDDIMG--YHIDTLNIVGGGSNVA
RHAB_LISIN      KLYCQETGQTVPETIGELTNCVYGSLALYYALELEKMTEITG--KKIEKLYIVGGGSNVA
RHAB_LISMF      KLYCQETGQTIPETIGELTNCVYGSLALYYALELEKMTEITG--KKIEKLYIVGGGSNVA
RHAB_LISMO      RLYCRETGQTVPETIGELTNCVYGSLALYYALELEKMTEITG--KKIEKLYIVGGGSNVA
RHAB_BACSU      QHYCRQTRQKIPRTAGELACCIYSNLAIIYAIAIKELETITE--KPIEQFHIIGGGARND
RHAB_ENTFA      QAYCRETQQTVPESPGELARCIYDNLALCYSVELEKLAQLTGIERKITTLHVVGGGSNNR
                :  *:      *   .::                     :      :  : ::***..  

RHAB_ECOUT      LLNQLCADACGIRVIAGPVEASTLGNIGIQLMTLDELNNVDDFRQVVSTTANLTTFTPN-
RHAB_ECOK1      LLNQLCADACGIRVIAGPVEASTLGNIGIQLMTLDELNNVDDFRQVVSTTANLTTFTPN-
RHAB_ECOL6      LLNQLCADACGIRVIAGPVEASTLGNIGIQLMTLDELNNVDDFRQVVSTTANLTTFTPN-
RHAB_ECOL5      LLNQLCADACGIRVIAGPVEASTLGNIGIQLMTLDELNNVDDFRQVVSTTANLTTFTPN-
RHAB_ECOLI      LLNQLCADACGIRVIAGPVEASTLGNIGIQLMTLDELNNVDDFRQVVSTTANLTTFTPN-
RHAB_ECO57      LLNQLCADACGIRVIAGPVEASTLGNIGIQLMTLDELNNVDDFRQVVSTTANLTTFTPN-
RHAB_SHIBS      LLNQLCADACGIRVIAGPVEASTLGNIGIQLMTLDELNNVDDFRQVVSTTANLTTFTPN-
RHAB_SHISS      LLNQLCADACGIRVIAGPVEASTLGNIGIQLMTLDELNNVDDFRQVVSTTANLTTFTPN-
RHAB_SHIFL      LLNQLCADACGIRVIAGPVEASTLGNIGIELMTLDELNNVDDFRQVVSTTANLTTFTPN-
RHAB_SHIF8      LLNQLCADACGIRVIAGPVEASTLGNIGIELMTLDELNNVDDFRQVVSTTANLTTFTPN-
RHAB_SALCH      LLNQLCADACGIRVIAGPVEASTLGNIGIQLMTLDELNNVDDFRQVVSANYDLTTYIPN-
RHAB_SALTY      LLNQLCADACGIRVMAGPVEASTLGNIGIQLMTLDELNNVDDFRQVVSANYDLTTYIPN-
RHAB_SALPA      LLNQLCADACGIRVMAGPVEASTLGNIGIQLMTLDELNNIDDFRQVVSANYDLTTYIPN-
RHAB_SALTI      LLNQLCANACGIRVMAGPVEASTLGNIGIQLMTLDELNNVDDFRQVVSANYDLTTYIPN-
RHAB_YERPE      FLNQLCADACGLNVSMGPVEASTLGNIGSQLISLGEVADVTHYRRIVANNFPLHHLSPH-
RHAB_YERPA      FLNQLCADACGLNVSMGPVEASTLGNIGSQLISLGEVADVTHYRRIVANNFPLHHLSPH-
RHAB_YERPN      FLNQLCADACGLNVSMGPVEASTLGNIGSQLISLGEVADVTHYRRIVANNFPLHHLSPH-
RHAB_YERPS      FLNQLCADACGLNVSMGPVEASTLGNIGSQLISLGEVADVTHYRRIVANNFPLHHLSPH-
RHAB_YERPP      FLNQLCADACGLNVSMGPVEASTLGNIGSQLISLGEVADVTHYRRIVANNFPLHHLSPH-
RHAB_PECAS      FLNQLCADVCQIPVLAGPVEASTLGNIGCQLMALGAVTDLAAFRHMLTHNFPLHRYTPR-
RHAB_MANSM      FLNQLCADLCGIDVFAGPVEASVLGNVGCQLMALDQIHNAAEFRQLVVKNFPLKQFKKRP
RHAB_BACTN      LLNQFTANAIGIPVVAGPSEATAIGNVMIQAMTVGEATDVAGMRQLISRSIPLKTYHPQ-
RHAB_BACHD      LLNQLIADRTKKDVFAGPIEATAIGNLVAQWMALGEIESIQQARKLIYDSFDVKRYVSA-
RHAB_OCEIH      MLNQLIADTTGKTVIAGLSEATAIGNLIVQMMAIDQIDDMQQARQIIKHSFDLYTYAKV-
RHAB_LACPL      LMNQLTSTLANIKVVAGPSEATAVGNIMVQMITSDEVENIGAGRRLIETSFDLKRYLPE-
RHAB_LACS1      LMNQLTSTIANVDVYAGPSEATAIGNILVQMITAGDVLNVYLGRRIISNSFDIKHYTPE-
RHAB_LISIN      MLNQLTAKLAGIEVFAGPSEATAIGNLVVQMINQGEIESMRAGRKIIRNSFEIGEFSCG-
RHAB_LISMF      MLNQLTAKLAGIEVFAGPSEATAIGNLVVQMINQGEIESMRAGRKIIRNSFEIGEFSCG-
RHAB_LISMO      MLNQLTAKLAGIEVFAGPSEATAIGNLVVQMINQGEIESMRAGRKIIRNSFEIGEFSCG-
RHAB_BACSU      FLNQLTADMSGKAVYAGPIEATATGNLLMQMIAAKEVKDIKEARQVVRNSFPIKVFTPK-
RHAB_ENTFA      LLNQLTADVANVTVNAGPGEAIALGNLLMQMIATGELKDIPAARTCIQTSFPTEIYQAN-
                ::**: :      *  *  ** . **:  : :      .    *  :  .          

RHAB_ECOUT      ---PDSEIAHYVAQIHSTRQ-TKELCA------
RHAB_ECOK1      ---PDSEIAHYVAQIHSTRQ-TKELCA------
RHAB_ECOL6      ---PDSEIAHYVAQIHSTRQ-TKELCA------
RHAB_ECOL5      ---PDSEIAHYVAQIHSTRQ-TKELCA------
RHAB_ECOLI      ---PDSEIAHYVAQIHSTRQ-TKELCA------
RHAB_ECO57      ---PDSEIAHYVARIHSTRQ-TKELCA------
RHAB_SHIBS      ---PDSEIAHYVAQLHSTRQ-TKELCA------
RHAB_SHISS      ---PDSEIAHYVAQLHSTRQ-TKELCA------
RHAB_SHIFL      ---PDSEIAHYVAQIHSTRQ-TKELCA------
RHAB_SHIF8      ---PDSEIAHYVAQIHSTRQ-TKELCA------
RHAB_SALCH      ---PDSEIARHVAQFQPKRQ-TKELCA------
RHAB_SALTY      ---PDSEIARHVAQFQPKRQ-TKELCA------
RHAB_SALPA      ---PDSEIARHVAQFQPKRQ-TKELCA------
RHAB_SALTI      ---PDSEIARHVAQFQPKRQ-TKELCA------
RHAB_YERPE      ---DNSDFAAHWLQFQSLSQLPKELCI------
RHAB_YERPA      ---DNSDFAAHWLQFQSLSQLPKELCI------
RHAB_YERPN      ---DNSDFAAHWLQFQSLSQLPKELCI------
RHAB_YERPS      ---DNSDFAAHWLQFQSLSQLPKELCI------
RHAB_YERPP      ---DNSDFAAHWLQFQSLSQLPKELCI------
RHAB_PECAS      ---AESDFAGHWRRFQALSQPETAPQGKKETTQ
RHAB_MANSM      HFMPASDFEEKWCEFCALN--------------
RHAB_BACTN      ---DMAAWDAAYIHFKNCVR-------------
RHAB_BACHD      ----DRE--------------------------
RHAB_OCEIH      ----TMEG-------------------------
RHAB_LACPL      ----TNKYGDILKEYQRFLTNKSKEMV------
RHAB_LACS1      ----QGKYSKVLAEYQQFLNKERG---------
RHAB_LISIN      ----DVRFEEIKERFTKVLEFN-----------
RHAB_LISMF      ----DVRFEEIKERFTKVLEFN-----------
RHAB_LISMO      ----DVRFEEIKERFTKVLEFN-----------
RHAB_BACSU      ----DIDRSTIIQSFQQTVLKALSK--------
RHAB_ENTFA      ----PI-DSTIKNRYQAFMKRSSL---------