CLUSTAL format seed alignment for MF_01537

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PPNP_ACIAD       -MSSAQFDHVTVIKKSNVYFGGLCISHTVQFEDGTKKTLGVILPTE---QPLTFETHVPE
PPNP_ACIBT       -MSSTQFDHVTVIKKSNVYFGGACISHTVQFEDGTKKTLGVILPTE---QPLTFETHVPE
PPNP1_PSYA2      -MTAAQFTNVTVNAQATISYDGRCSSHTIMFEDGRHKTLGVILPCDNLVEHYHFSTNTSE
PPNP1_PSYCK      -MTAAQFTNVTVNAQATISYDGRCSSHTIMFEDGRHKTLGVILPCDNLVEHYHFSTNTSE
PPNP_AROAE       MSLTEKFDSVTVATKANVYFDGKCVSHGIVLADGTKKSVGVILPAT-----LTFNTGAPE
PPNP_AZOSB       MGITEKLDGVAVTTKANVYFDGKCVSHSVRFADGTGKSVGVILPSI-----LTFNTGAPE
PPNP_THIDA       ---MSRFDNVAVTKQANVYFDGKCVSHTVEFADGTKKSVGVILPST-----LTFNTGAPE
PPNP_DECAR       ---MSQYDNVSVVKKANVYFDGKCVSHTVVLADGTKKTVGVILPSS-----LTFNTGAPE
PPNP_ACIAC       -MTTEKIDGVSVTARANVYFDGKCVSHGITFPDGTKKSVGVILPAT-----LTFNTGAPE
PPNP_ACISJ       -MTTEKIDGVSVTTQANVYFDGKCVSHNLTYPDGTKKSVGVVLPAT-----LTFGTGAPE
PPNP_POLNA       -MTTEKIDNISVTTQANVYFDGKCISHGITLADGTKKSVGVILPAS-----LTFNTGAAE
PPNP_POLSJ       -MITEKIDNISVTTKANVYFDGKCVSHGITFTDGTKKSVGVILPAT-----LTFNTGAPE
PPNP_RHOFT       -MTTTHIDQVSVSTQASVYFDGKCISHGVTLADGTKKSVGVILPAT-----LTFNTGAPE
PPNP_RALSO       -MTTETIDGVRLTTKANVYFDGKCVSHSFALPDGTKKSVGVVLPAT-----LTFGTAAAE
PPNP_NOCFA       ---MSKFENVSVAKKANVYFDGACVSHSIEFPDGTAKSVGVILPAT-----LTFGTTAPE
PPNP_BURCA       MTSATQFDNVSVVKRANVYFDGKCVSHTVLFPDGTRKTLGVILPCA-----LNFGTDAPE
PPNP_BURCH       MTSATQFDNVSVVKRANVYFDGKCVSHTVLFPDGTRKTLGVILPCA-----LNFGTDAPE
PPNP_BURL3       MTSATQFDNVSVVKRANVYFDGKCVSHTVLFPDGTRKTLGVILPCA-----LNFGTDAPE
PPNP_BURCM       MTSATQFDNVSVVKRANVYFDGKCVSHTVLFPEGTRKTLGVILPCA-----LNFGTDAPE
PPNP_PARXL       MTAATQFDQVSIIKRANVYFDGKCVSHTVVFPDGSRKTLGVILPGA-----LNFGTDAAE
PPNP_CUPNH       -MEVSQFDNVSVVKKANLYFDGKCVSHTVLFPDGTRKTLGVIFPAA-----LTFNTGAPE
PPNP_CUPPJ       -MEVSQFDNVSVVKKANLYFDGKCVSHTVLFSDGTRKTLGVIFPAT-----LTFNTGAPE
PPNP_CUPMC       ---MSQFDNVSVVKKANLYFDGKCVSHTVTFADGTRKTLGVIFPAA-----LTFNTGAPE
PPNP_HERAR       --MTTQFDNVSVVKKANIYFDGKCVSHTVLFADGTKKTIGIIFPST-----LKFNTGAAE
PPNP_METFK       ---MAQFDNVSVKKKANVYFDGKCVSHTVLFPNGTRATVGVIFPGA-----LTFNTGSPE
PPNP_METCA       ---MSQFDNVSVIKQANVYFGGKCISHTVQFPDGSRKTLGVILPST-----LHFETGAPE
PPNP_LEPIN       ---MSQFENVTIIKKANVYYDGKVTSRSILFQDGSKKTLGILMPGQ-----YDFGTDEKE
PPNP_LEPIC       ---MSQFENVTIIKKANVYYDGKVTSRSILFQDGSKKTLGILMPGQ-----YDFGTDEKE
PPNP_LEPBJ       ---MRQFENVTIVKKANVYYEGKVTSRTVLFQDGSKKTLGILMPGQ-----YDFGTDEKE
PPNP_LEPBL       ---MRQFENVTIVKKANVYYEGKVTSRTVLFQDGSKKTLGILMPGQ-----YDFGTDEKE
PPNP_WOLSU       --MMQSFENVTVVKKANRYFDDKVTSRTVIFPDGSKKTLGIMLPGS-----YEFGTDKAE
PPNP_HYDCU       ---MSQFENVTVVKAANVYYDGKVSSRTVLFADGSKKTLGLLLPGE-----YEFGTEAAE
PPNP_GEOSL       ---MSEFTNVTIIREANVYFDGGVVSRTVVFPDGTKKTLGIMQPGE-----YTFTTGAPE
PPNP_GEOMG       ---MSEFINVTVVREANVFFNGGVVSRTVIFPDGTKKTLGIMQPGE-----YTFNTGAPE
PPNP_CHLCH       ---MSQFTNVAITKEANIYFDGNVTSRSVHFADGTKKTLGIMLPGD-----YEFNTGAKE
PPNP_PELPD       ---MSEFSNVTVIKKANIYFEGKVASHTVLFPDGTKKTLGIMQAGD-----YEFSTANAE
PPNP_SULDN       ---MTKFENVTVVKKANIYDGGKVTSRTVEFADGTRKTLGIMMPGE-----YTFNTAEAE
PPNP_SYNC1       ---MSEFKNVTLIKKANVYYDGKVTSRTVIFADGTKKTLGIMMPGE-----YTFDTAAAE
PPNP_COLP3       ---MSEFKEVTVTKAASVYFDGKVTSRKVTFNDGSFKTLGIMMPGE-----YKFGTNEEE
PPNP_SHEDO       ---MSQFNNVTLVKAANVYFDGKVSSRTVQFNDGSHKTLGLMLPGE-----YEFGTQAKE
PPNP_CLOD6       ---MSEFKNVTAVKKANVYFDGKVSSRVIILPNGERKTLGLMLPGE-----YTFSTREEE
PPNP_PSET1       ---MSKFENVSVIKKANVYFDGKVSSRTVLLGSGEAKTLGFMQPGE-----FVFDTNQKE
PPNP_SHESM       ---MELIEQVSVAKKANIYFEGKVASRSVFFNDGSKQTLGVVLPGE-----YEFSTSQGE
PPNP_SHESR       ---MELIEQVSVAKKANIYFEGKVASRSVFFSDGSKQTLGVVLPGE-----YEFSTSQGE
PPNP_SHESA       ---MELIEQVSVAKKANIYFEGKVASRSVFFSDGSKKTLGVVLPGE-----YEFSTSQGE
PPNP_SHEON       ---MELIEQVAVAKKANIYFEGKVASRSVFFSDGSKQTLGVVLPGE-----YEFSTSQGE
PPNP_SHESW       ---MSLLEQVSVSKKANIYFDGKVASRSVFLADGSKQTLGVVLPGE-----YEFSTSQGE
PPNP_SHEFN       ---MSMLQQVSVAKKANVYFNGKVISRSVVLADGSKQTFGVVLPGE-----YEFSTAQGE
PPNP_SHEAM       ---MKVLENVNVALKANVYFDGKVTSRAIYVG-GQKQTIGVVLPGE-----YEFSTTQPE
PPNP_AERHH       ------------MLKVNEYFDGNVKSIGFE-QKGDKATVGVMEAGH-----YQFNTAAPE
PPNP_AERS4       ------------MLKVNEYFDGNVKSIGFE-QKGDKATVGVMEAGD-----YQFNTAAPE
PPNP_VIBVU       ------------MIKENSYFAGNVKSLGFN-QQGEDSSVGVMLPGN-----YTFGTDAPE
PPNP_VIBVY       ------------MIKENSYFAGNVKSLGFN-QQGEDSSVGVMLPGN-----YTFGTDAPE
PPNP_VIBCH       ------------MIKENVYFDGNVKSLGFS-QQDGESTVGVMAPGQ-----YTFGTGAPE
PPNP_VIBPA       -----------MSIKENSYFAGGVKSLGFN-QHGQDVSVGVMLPGE-----YTFGTQAPE
PPNP_ALIF1       ------------MLTVNSYFEDKVKSIGFE-QNSNAISVGVMLPGN-----YTFGTAAAE
PPNP_PHOPR       ------------MLNVNEYFEGQVKSIGFE-AQGDRTSVGVMAAGE-----YTFGTAAPE
PPNP_YERPA       ------------MLKFNEYFTGKVKSIGFDSDSIGPASVGVMEKGE-----YTFSTAKAE
PPNP_YERPN       ------------MLKFNEYFTGKVKSIGFDSDSIGPASVGVMEKGE-----YTFSTAKAE
PPNP_YERPP       ------------MLKFNEYFTGKVKSIGFDSDSIGPASVGVMEKGE-----YTFSTAKAE
PPNP_YERPE       ------------MLKFNEYFTGKVKSIGFDSDSIGPASVGVMEKGE-----YTFSTAKAE
PPNP_YERPS       ------------MLKFNEYFTGKVKSIGFDSDSIGPASVGVMEKGE-----YTFSTAKAE
PPNP_YERE8       ------------MLKFNEYFTGKVKSIGFDSDSIGQASVGVMEKGE-----YTFSTAKPE
PPNP_PECAS       ------------MLNVNEYFAGKVKSIGFEGDSIGRASVGVMDAGE-----YTFGTGQPE
PPNP_ECOLI       ------------MLQSNEYFSGKVKSIGFSSSSTGRASVGVMVEGE-----YTFSTAEPE
PPNP_ECO57       ------------MLQSNEYFSGKVKSIGFSSSSTGRASVGVMVEGE-----YTFSTAEPE
PPNP_ECOL6       ------------MLQSNEYFSGKVKSIGFSSSSTGRASVGVMVEGE-----YTFSTAEPE
PPNP_SHIBS       ------------MLQSNEYFSGKVKSIGFSSSSTGRASVGVMVEGE-----YTFSTAEPE
PPNP_SHIF8       ------------MLQSNEYFSGKVKSIGFSSSSTGRASVGVMVEGE-----YTFSTAEPE
PPNP_SHISS       ------------MLQSNEYFSGKVKSIGFSSSSTGRASVGVMVEGE-----YTFSTAEPE
PPNP_SHIFL       ------------MLQSNEYFSGKVKSIGFSSSSTGRASVGVMVEGE-----YTFSTAEPE
PPNP_ECOUT       ------------MLQSNEYFSGKVKSIGFSSSSTGRASVGVMVEGE-----YTFSTAEPE
PPNP_ECOK1       ------------MLQSNEYFSGKVKSIGFSSSSTGRASVGVMVEGE-----YTFSTAEPE
PPNP_ECOL5       ------------MLQSNEYFSGKVKSIGFSSSSTGRASVGVMVEGE-----YTFSTAEPE
PPNP_SHIDS       ------------MLQSNEYFSGKVKSIGFSSSSTGRASVGVMVEGE-----YTFSTAEPE
PPNP_SALPA       ------------MLQSNEYFSGKVKSIGFTSSSTGRASVGVMAEGE-----YTFGTAEPE
PPNP_SALTI       ------------MLQSNEYFSGKVKSIGFTSSSTGRASVGVMAEGE-----YTFGTAEPE
PPNP_SALTY       ------------MLQSNEYFSGKVKSIGFTSSSTGRASVGVMAEGE-----YTFGTAEPE
PPNP_SALCH       ------------MLQSNEYFSGKVKSIGFTSSSTGRASVGVMAEGE-----YTFGTAEPE
PPNP2_PSYA2      ------------MPSVNNYFDNKVTSIAFQ-TATKPATVGVMEIGD-----YEFGTSEFE
PPNP2_PSYCK      ------------MPSVNNYFENKVTSIAFQ-TATKPATVGVMEIGE-----YEFGTSEFE
PPNP_ALCBS       ------------MFKVNEYFDAKVASIAFQ-TETKPATIGVMAPGD-----YEFGTSEHE
PPNP_HAHCH       ------------MLKVNEYFNGRVKSIAFQ-TATLPATVGVMIPGD-----YEFSTSQHE
PPNP_MAGMM       ------------MLKVNEYFDGAVKSIGFQ-SETLPATVGVMAPGA-----YTFGTDQKE
PPNP_SACD2       ------------MLEVNTYFDGTVKSIAFQ-TATLPATVGVMAKGE-----YTFGTDCKE
PPNP_MARN8       ------------MLTVNEYFDGKVKSVAFQ-SSTLPATIGVISAGE-----YEFGTSEKE
PPNP_PSYIN       -----------MSFESNEYFDGNVKSIAFQ-SATLPGTLGVMDIGE-----YTFDTNAYE
PPNP_PSEAE       ------------MFKVNEYFDGTVKSIAFD-MTAGPATIGVMAAGE-----YEFGTSQLE
PPNP_PSEAB       ------------MFKVNEYFDGTVKSIAFD-MTAGPATIGVMAAGE-----YEFGTSQLE
PPNP_PSEPK       ------------MFQVNEYFNGTVKSIAFS-GEEGPATVGVMAPGE-----YEFGTAKRE
PPNP_PSEE4       ------------MFKVNEYFDGTVKSIAFE-GQEGPATVGVMAPGE-----YEFGTAKRE
PPNP_PSESM       ------------MFKVNEYFDGTVKSIAFS-QAEGQATIGVMAAGE-----YEFGTAQRE
PPNP_PSE14       ------------MFKVNEYFDGTVKSIAFS-QVDGQATIGVMAAGE-----YEFGTAQRE
PPNP_PSEU2       ------------MFKVNEYFDGTVKSIAFT-QADGEATIGVMAAGE-----YEFGTAQRE
PPNP_PSEF5       ------------MFKVNEYFDGTVKSIAFG-TAEGPATIGVMAPGE-----YEFGTAQRE
PPNP_PSEPF       ------------MFKVNEYFDGTVKSIAFG-TAEGPATIGVMAAGE-----YEFGTSQRE
PPNP_PSEA6       ------------MFNVNEYFEGNVKSIAFD-TAVGNSTLGVMAPGE-----YEFATSQHE
PPNP_RHOBA       -------------MQVNEYFDGNVTSIAFE-NGEGRATSGVMLVGD-----YEFGTSEKE
                                 .        *  .        : *.:           * *   *

PPNP_ACIAD       RMEIISGECRVKIADSTESELFRAGQSFYVPGNSLFKIETD---EVLDYVCHLEG--
PPNP_ACIBT       RMEIISGECRVKIADSNESELFRAGQSFYVPGNSVFKIETD---EVLDYVCHLEG--
PPNP1_PSYA2      RIEITGGECEVKINGEEAFSYYRAGQSFVVEGNSGFNLRTE---EIVQYICHLEG--
PPNP1_PSYCK      RIEITSGECEVKINGEEEFSYYRAGQSFVVEGNSGFNLRTE---QIVQYICHLEG--
PPNP_AROAE       IMEGVAGSCRVRLKGESEWTVYGAGESFNVPANSSFDIEVAG--EPYHYVCHFG---
PPNP_AZOSB       VMEGVAGSCRVRLKGETTWNTYGAGESYQVPGNSSFDIEVVG--EPYHYICHFG---
PPNP_THIDA       VMETVAGACRVKLAGENEWKSYAAGQSFEVPANSSFEIEVAA--EPYHYVCHFG---
PPNP_DECAR       IMEGVGGSCRVKLKGESEWKTYGDGQSFNVPGNSSFEI-ACD--EPYHYVCHFG---
PPNP_ACIAC       IMECVGGACEYKLDGTDAWVKSGEGDKFSVPGNSKFEIRVT---EAYHYICHFG---
PPNP_ACISJ       IMECVGGSCEYQLDGTDAWVKVGAGEKFSVPGNSKFNIRVT---EAFHYICHYG---
PPNP_POLNA       IMECVAGACEYKLAGSDEWVQSSAGESFSVPGNSKFDIRVAAGFEAYHYICHFA---
PPNP_POLSJ       IMECVAGACEYRLAGSDSWVKSAAGEKFSVPGNAKFDIRVAEGFEAYHYICHFG---
PPNP_RHOFT       VMECVAGSCDYKLPGSEVWLKSKPGDKFSIPGNTPFDIRVT---EPYHYICHFG---
PPNP_RALSO       IMECVGGSCEYRLDGSDEWKQSGPGERFQVPANSKFDIRVT---EAYHYICHYA---
PPNP_NOCFA       VMELVEGHCRVTLPGADAPVTFRGGESFEVPADSEFTIEVL---ETVHYVCHYG---
PPNP_BURCA       LMEVQAGKCRVKLDGSSEWQTYGAGESFSVPGKSRFDIEVL---ETLDYVCSYL---
PPNP_BURCH       LMEVQAGKCRVKLDGSSEWQTYGAGESFSVPGKSRFDIEVL---ETLDYVCSYL---
PPNP_BURL3       LMEVQAGKCRVKLDGSSEWQTYGAGESFSVPGKSRFDIEVL---ETLDYVCSYL---
PPNP_BURCM       LMEVQAGKCRVKLDGSSEWQTYGAGESFSVPGKSRFDIEVL---ETLDYVCSYL---
PPNP_PARXL       LMEVQAGQCRIRLEGSEDWKTYGAGESFSVPGNSRFDIDVV---ETLDYVCSYL---
PPNP_CUPNH       IMEINAGTCRVRLAGSEDWQTYGAGQQFSVPGNSSFDIEVQ---ETLDYVCHFA---
PPNP_CUPPJ       IMEINAGVCRVRLAGSEAWQTYGAGQQFDVPGNSSFDIEVQ---ETLDYVCHFG---
PPNP_CUPMC       IMEINAGVCRVRLAGSDEWKTYGAGQQFDVPGNSSFDIEVT---ETLDYVCHFG---
PPNP_HERAR       IMELNAGKCRIRLAGATEWNTYEGGQQFEVPANSSFDIETV---DTLDYVCHFI---
PPNP_METFK       LMEINSGACKVRLSGESDWKAYGAGEKFTVPGNSSFDIEVT---ETLDYVCHFE---
PPNP_METCA       VMEIVAGGCRVQLAGQTGWQSYQAGDSFSIPGNSGFQIEVS---DTLHYVCHFG---
PPNP_LEPIN       IMEILDGELLVKLPGQEVWSEIKGGQSFEVPAKSRFQMDVK---KISDYCCSYIQNS
PPNP_LEPIC       IMEILDGELLVKLPGQEVWSEIKGGQSFEVPAKSRFQMDVK---KISDYCCSYIQNS
PPNP_LEPBJ       IMEILDGDMLVKLPGEDSWKEIKGAQSFEVPAKSRFQMDVK---KISDYCCSYIG--
PPNP_LEPBL       IMEILDGDMLVKLPGEDSWKEIKGAQSFEVPAKSRFQMDVK---KISDYCCSYIG--
PPNP_WOLSU       IMEILEGELEVFLPQESKWRTLRGGESFDVPAHSRFSLKVN---ETVDYCCSYVG--
PPNP_HYDCU       IMEMLAGDVDVLLPGETKWQSLSAGESFNVPANSKFGINVK---TVADYCCSYID--
PPNP_GEOSL       IMEILSGELDLKLPGSDAWNRVGGGESFDVPANSSFTMKVL---SLTDYCCSFLG--
PPNP_GEOMG       IMEILTGELDLKLPGSDLWDRIGGGESFEVPANSSFTMKVL---SLTDYCCSFLG--
PPNP_CHLCH       LMEILSGDLEIQLVG-EEWRKISAGESFEVPANSSFKLKIY---KITDYCCSFLG--
PPNP_PELPD       VMEILSGTLEWQMKGECCWKTIGAGESFQIPADSVFLMKVP---AVADYCCSYIQ--
PPNP_SULDN       IMEMMSGELDIRLPN-EDWKTLNTPESFNVPANSSFDLKIR---TVTDYCCSYIK--
PPNP_SYNC1       VMEMLGGSMEVLLPGAETWQSFHEGQSFEVPANSQFSLKIK---EVADYCCSYLK--
PPNP_COLP3       LMEITAGECEILLAGATEWQNISDGQSFGVPANSSFEVRAK---TLIDYCCTYIS--
PPNP_SHEDO       LMEIMSGELQIMLPESHTWQSIVGPQSFEARESPDNCFYFQ---FSRHAWCYLI---
PPNP_CLOD6       IMEMLAGSMDVKLPGSNEFVTYKEGQKFNVPSDSSFDLKVN---EVVDYCCSYIAD-
PPNP_PSET1       CMELLAGQWDILLPGESEWKTFNAGESFNVDANVSFKVKVS---DFADYCCSYTD--
PPNP_SHESM       IMQVTSGSFEVLLPDSTTWQTFSEGSQFELVANASFKIRNS---AIAEYCCSYL---
PPNP_SHESR       IMQVTSGSFEVLLPDSTTWQTFSEGSQFELVANVSFKIRNS---AIAEYCCSYL---
PPNP_SHESA       IMQVTSGSFEVLLPNSTTWQTFSEGSQFELAANVSFKIRNN---AIAEYCCSYL---
PPNP_SHEON       IMHVTSGSFEVLLPNSSTWQAFSEGSQFELAANVSFKIRNN---AIAEYCCRYL---
PPNP_SHESW       VMEVTSGRFEVLLPESTVWQEFSEGTQFELAANVSFKIRNT---AIAEYCCSYL---
PPNP_SHEFN       IMQVISGKFDVLLPGKTEWVAYAEASQFELAPNVSFSIRTD---QISEYCCQYI---
PPNP_SHEAM       QMQVTSGSFEVLLPGESQWQTFAEGSTFNLDADVSFSIRAT---DVAEYLCSYL---
PPNP_AERHH       RMTVVKGALTIQLADEDEWHTYEQGQSFDVAGHSSFKLEVK---TPTAYLCEFLD--
PPNP_AERS4       RMTVVKGALTIQLADEDEWHTYSQGQSFEVAGHSSFKLEVK---TPTAYLCEFLD--
PPNP_VIBVU       RMTVVKGALVIKREGDEEWSTYQAGEAFEVAGKSSFDLQVE---VATAYLCEYL---
PPNP_VIBVY       RMTVVKGALVIKREGDEEWSTYQAGEAFEVAGKSSFDLQVE---VATAYLCEYL---
PPNP_VIBCH       RMTVVKGALTIKRVTDADWVTFTAGEAFEVAGNSSFDLQVE---VATAYLCEFLPA-
PPNP_VIBPA       RMTVVKGALVVKRVGEADWTTYSSGESFDVEGNSSFELQVK---DATAYLCEYL---
PPNP_ALIF1       KMSVITGALTIKRSTDADWVTFSSGEDFSVEGNSSFEVKVE---IETAYLCEYL---
PPNP_PHOPR       RMTVVKGSMDVKRPGHVEWETFNAGDDFEVPGDSSFEVKIT---SSTAYLCDYL---
PPNP_YERPA       EMTVITGSLKVLIPGSPDWQTFMPGETFYIPGESEFNLQVA---EASSYLCKYLS--
PPNP_YERPN       EMTVITGSLKVLIPGSPDWQTFMPGETFYIPGESEFNLQVA---EASSYLCKYLS--
PPNP_YERPP       EMTVITGSLKVLIPGSPDWQTFMPGETFYIPGESEFNLQVA---EASSYLCKYLS--
PPNP_YERPE       EMTVITGSLKVLIPGSPDWQTFMPGETFYIPGESEFNLQVA---EASSYLCKYLS--
PPNP_YERPS       EMTVITGSLKVLIPGSPDWQTFMPGETFYIPGESEFNLQVA---EASSYLCKYLS--
PPNP_YERE8       EMTVITGSLKVLIPGSSGWEVFNPGETFYVPANSEFNLQVA---EASSYLCKYLS--
PPNP_PECAS       EMTVITGALKVLLPGAPDWQVFTPGETFFVPGKSEFNLQVV---EPTSYLCKYL---
PPNP_ECOLI       EMTVISGALNVLLPDATDWQVYEAGSVFNVPGHSEFHLQVA---EPTSYLCRYL---
PPNP_ECO57       EMTVISGALNVLLPDATDWQVYEAGSVFNVPGHSEFHLQVA---EPTSYLCRYL---
PPNP_ECOL6       EMTVISGALNVLLPDATDWQVYEAGSVFNVPGHSEFHLQVA---EPTSYLCRYL---
PPNP_SHIBS       EMTVISGALNVLLPDATDWQVYEAGSVFNVPGHSEFHLQVA---EPTSYLCRYL---
PPNP_SHIF8       EMTVISGALNVLLPDATDWQVYEAGSVFNVPGHSEFHLQVA---EPTSYLCRYL---
PPNP_SHISS       EMTVISGALNVLLPDATDWQVYEAGSVFNVPGHSEFHLQVA---EPTSYLCRYL---
PPNP_SHIFL       EMTVISGALNVLLPDATDWQVYEAGSVFNVPGHSEFHLQVA---EPTSYLCRYL---
PPNP_ECOUT       EMTVISGALNVLLPDATDWQVYEAGSVFNVPGHSEFHLQVA---EPTSYLCRYL---
PPNP_ECOK1       EMTVISGALNVLLPDATDWQVYEAGSVFNVPGHSEFHLQVA---EPTSYLCRYL---
PPNP_ECOL5       EMTVISGALNVLLPDATDWQVYEAGSVFNVPGHSEFHLQVA---EPTSYLCRYL---
PPNP_SHIDS       EMTVINGALNVLLPDATDWQVYEAGSVFNVPGHSEFHLQVA---EPTSYLCRYL---
PPNP_SALPA       EMTVVSGALKVLLPGTVEWKVYTAGEVFNVPGHSEFHLQVA---EPTSYLCRYL---
PPNP_SALTI       EMTVVSGALKVLLPGTVEWKVYTAGEVFNVPGHSEFHLQVA---EPTSYLCRYL---
PPNP_SALTY       EMTVVSGALKVLLPGTVEWKVYTAGEVFNVPGHSEFHLQVA---EPASYLCRYL---
PPNP_SALCH       EMTVVSGALKVLLPGTVEWKVYTAGEVFNVPVHSEFHLQVA---EPTSYLCRYL---
PPNP2_PSYA2      TMTVVSGALTVKLPESDEWQTFNAGAQFTVDANQKFQVKVE---VETAYLCTYGE--
PPNP2_PSYCK      TMSVVSGALTVKLPESDEWQTFNAGEQFTIEANQKFQVKVE---VESAYLCTYGK--
PPNP_ALCBS       TMTVTSGALTVKLPGSADWQTFVAGETFEIEADQKFQVKVA---IDTAYLCLYGE--
PPNP_HAHCH       TMTVVSGALSVKLPESESWTRFNAGDRFEIPANATFNLKVA---VDTAYLCTYG---
PPNP_MAGMM       TMTVVSGALTVKLPGQDGWQRFAAAEHFEVEANQSFELKVE---VATAYLCTYG---
PPNP_SACD2       IMTVVSGELIVQLPNQEEWQTFIDGQTFEVEANQSFNLKVP---VETAYLCKYIR--
PPNP_MARN8       TMTVVSGELTVLLPGQQDWQTFGAGESFEVAGQASFKAKTD---ADTAYLCTYG---
PPNP_PSYIN       FMTVVNGALTVKLPGATDWKTFNAGETFEVEANVSFDVKVK---VQTAYLCLYK---
PPNP_PSEAE       IMHVVAGALTVKLPGSDEWQEYASGSQFTVPANSKFQLKVA---QDTAYLCEYR---
PPNP_PSEAB       IMHVVAGALTVKLPGSDEWQEYASGSQFTVPANSKFQLKVA---QDTAYLCEYR---
PPNP_PSEPK       IMHVVSGALTVKLPGSDNWETFNAGDKFNVPADSKFQLQVK---VDTAYLCEYRD--
PPNP_PSEE4       IMHVVSGALTVKLPGSDNWEKFAAGSQFNVPADSKFQLKVA---VDTAYLCEYRD--
PPNP_PSESM       IMHVISGELNVKLPDSTDWETFSTGSQFNVPANSKFQLKVS---VDTAYLCEYR---
PPNP_PSE14       IMHVISGELNVKLPDSTDWETFSTGSQFNVPANSKFQLKVS---VDTAYLCEYR---
PPNP_PSEU2       IMHVISGELSVKLPDSTDWETFATGNQFNVPANSKFQIKVK---VDTAYLCEYR---
PPNP_PSEF5       IMHVVSGALTVRLPDSADWETFPAGSQFNVPANSKFQLKVA---VDTAYLCEYRG--
PPNP_PSEPF       IMHVVSGALTVKLPDSSDWETFAAGSQFNVPANSKFQLKVA---VDTAYLCEYRG--
PPNP_PSEA6       TMSVVSGAMTVLLPGESEWKTLTAGQVFTVDANVKFKAQVS---VNTAYLCDYV---
PPNP_RHOBA       LMKIVSGKLEAKLPGEPGFRAYPAGSEFRIDANQKFQVRVI---EPTAYLCFYS---
                  :    *                    :                      *