CLUSTAL format seed alignment for MF_01539

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TMCAL_CLOAB      -----MNITGIIAEYNPMHNGHIHHLEKTKEICKSDVILCVMSGDFVQRGEPAIIDKWSR
TMCAL_CLONN      -----MNITGIITEYNPLHKGHIYHINKTKELTSCDGIVCIMSGNFVQRGIPAIMDKWTR
TMCAL_CLOTE      -----MNITGVIVEYNPFHNGHLYHLNKTKEITDCDGIVAVMSGHFVQRGSPALLDKWTR
TMCAL_CLOPE      -----MNITGIITEYNPFHLGHELHLKSSKEITNCDGVICVMSGNFVQRGLPALTDKWTR
TMCAL_CLOP1      -----MNITGIITEYNPFHLGHELHLKSSKEITNCDGVICVMSGNFVQRGLPALTDKWTR
TMCAL_CLOPS      -----MNITGIITEYNPFHLGHELHLKNSKEITNCDGVICVMSGNFVQRGLPALTDKWTR
TMCAL_CLOD6      -----MNILGLIVEYNPFHNGHIYHLSKSIEKTNATHTVAIMSGNFLQRGEPALFDKYTR
TMCAL_CALS4      -----MEALGIIVEYNPLHNGHLYHLEESIKLTKCQYVVAVMSGNFVQRGEPAIVDKWKR
TMCAL_HUNT2      -----MKVLGLIVEYNPFHNGHLYHLEESKKISGADFVVCVMSGNFIQRGEPAIVNKWAR
TMCAL_THEMA      ------------MEYNPFHNGHLYHLTSARELVKPDYTIAVMSGNFCQRGEPAVIDKFAR
TMCAL_SYNWW      -----MAILGIVAEYNPFHNGHLYLLEKSRQQGDFSATVVVMSGNFLQRGEPAFCDKWAR
TMCAL_PELCD      -----MRAVGLITEYNPFHNGHLHHLRASREAAGAEVAVAVMSGHFLQRGEPALLDKWRR
TMCAL_BACSU      -----MKAVGLVVEYNPFHNGHLYHAQTAKLQTGCDTAVAVMSGHFLQRGEPAVVSKWAR
TMCAL_BACLD      -----MKAVGLVVEYNPFHNGHLYHIKEAKSETRSEVAVAVMSGSFLQRGEPAIVSKWAR
TMCAL_BACAN      -------------------------MQQTKKLTHSDITIAVMSGPFLQRGEPALVSKWYR
TMCAL_BACHK      -------------------------MQQTKKLTHSDITIAVMSGPFLQRGEPALVSKWYR
TMCAL_BACCZ      -------------------------MQQTKKLTHSDITIAVMSGPFLQRGEPALVSKWYR
TMCAL_BACAH      -------------------------MQQTKKLTHSDITIAVMSGPFLQRGEPALVSKWYR
TMCAL_BACC1      -------------------------MQQTKKLTHSDITIAVMSGPFLQRGEPALVSKWYR
TMCAL_BACCR      -------------------------MQQTKKLTQSDIIIAVMSGPFLQRGEPALISKWYR
TMCAL_BACHD      -----MKAVGVVVEYNPFHNGHLHHLTEARKQAKADVVIAVMSGYFLQRGEPAILPKWER
TMCAL_BACSK      -----MRALGLVVEYNPFHNGHLHHLTQAKQQTGADVVVAVMSGTFLQRGEPALLSRWYR
TMCAL_GEOKA      -----MKAVGVIVEYNPFHNGHFHHLNETRQKTDADCLIAVMSGNFLQRGEPAIVSKWAR
TMCAL_GEOTN      -----MKAVGIIVEYNPFHNGHWHHLQETKAKTAADCLIAVMSGNFLQRGEPAIVSKWAR
TMCAL_OCEIH      -----MDSCGLIVEYNPFHNGHQYHINQARNVSNSTCIIAIMSGNFLQRGEPAIIDKFHR
TMCAL_LISIN      -----MKATGIVVEYNPFHNGHQLHLNKARELTKSDVVIAVMSGSFVQRGEPAIIPKWER
TMCAL_LISW6      -----MKATGIVVEYNPFHNGHQLHLNKARELTKADVVIAVMSGSFVQRGEPAILPKWER
TMCAL_LISMO      -----MKATGIVVEYNPFHNGHKLHLNKARELTQADVVIAVMSGSFVQRGEPAIIPKWER
TMCAL_LISMF      -----MKATGIVVEYNPFHNGHKLHLNKARELTQADVVIAVMSGSFVQRGEPAILPKWER
TMCAL_STAA8      -----MKSVGLITEYNPFHNGHQYHINQSKKLTNADVTIAIMSGNFVMRGEPAIYNKFTR
TMCAL_STAA3      -----MKSVGLITEYNPFHNGHQYHINQSKKLTNADVTIAIMSGNFVMRGEPAIYNKFTR
TMCAL_STAAN      -----MKSVGLITEYNPFHNGHQYHINQSKKLTNADVTIAIMSGNFVMRGEPAIYNKFTR
TMCAL_STAAC      -----MKSVGLITEYNPFHNGHQYHINQSKKLTNADVTIAIMSGNFVMRGEPAIYNKFTR
TMCAL_STAAS      -----MKSVGLITEYNPFHNGHQYHINQSKKLTNADVTIAIMSGNFVMRGEPAIYNKFTR
TMCAL_STAAM      -----MKSVGLITEYNPFHNGHQYHINQSKKLTNADVTIAIMSGNFVMRGEPAIYNKFTR
TMCAL_STAAW      -----MKSVGLITEYNPFHNGHQYHINQSKKLTNADVTIAIMSGNFVMRGEPAIYNKFTR
TMCAL_STAAR      -----MKSVGLITEYNPFHNGHQYHINQSKKLTNADVTIAIMSGNFVMRGEPAIYNKFTR
TMCAL_STAAB      -----MKSVGLITEYNPFHNGHQYHINQSKKLTNADVTIAIMSGNFVMRGEPAIYNKFTR
TMCAL_STAES      -----MKSVGLITEYNPFHNGHLFHATLSKQRSETNVTIAIMSGNFVMRGEPAIYHKFKR
TMCAL_STAEQ      -----MKSVGLITEYNPFHNGHLFHATLSKQRSETNVTIAIMSGNFVMRGEPAIYHKFKR
TMCAL_STAS1      -----MKSVALVTEYNPFHNGHLYHAQQSKSITNSDISIAIMSGNFVMRGQPAIYNKFTR
TMCAL_STAHJ      -----MKSVGLITEYNPFHNGHLYHAQQSKLQSDAEISIAIMSGNFVMRGEPAIYNKFLR
TMCAL_LACLM      ----MTKITGIIAEFNPFHKGHEYLLNQID-----GLKIVAMSGNWMQRGEPAIFDKWTR
TMCAL_LACLS      ----MTKITGIIAEFNPFHKGHEYLLNQID-----GPKIVAMSGNWMQRGEPAIFDKWTR
TMCAL_LACLA      ----MNKITGIIAEFNPFHKGHEYLLNQIE-----GIKIVAMSGNWMQRGEPAIFDKWTR
TMCAL_STRA5      -----MTVTGIVAEFNPFHNGHKYLLEQAQ-----GIKVIAMSGNFMQRGEPAIVDKWTR
TMCAL_STRA1      -----MTVTGIVAEFNPFHNGHKYLLEQAQ-----GIKVIAMSGNFMQRGEPAIVDKWTR
TMCAL_STRA3      -----MTVTGIVAEFNPFHNGHKYLLEQAQ-----GIKVIAMSGNFMQRGEPAIVDKWTR
TMCAL_STRT2      -----MTVTGIIAEFNPFHNGHKYLLDHAE-----GIKIVAMSGNFVQRGEPAIVDKWIR
TMCAL_STRTD      -----MTVTGIIAEFNPFHNGHKYLLDHAE-----GIKIVAMSGNFVQRGEPAIVDKWIR
TMCAL_STRT1      -----MTVTGIIAEFNPFHNGHKYLLDYAE-----GIKIVAMSGNFVQRGEPAIVDKWIR
TMCAL_STRMU      -----MTTTGIIAEFNPFHNGHKYLLDQAH-----GLKIVAMSGNFVQRGEPAIIDKWTR
TMCAL_STRR6      -----MTITGIIAEFNPFHNGHKYLLDQAE-----GLKIVAMSGNFMQRGEPAIVDKWTR
TMCAL_STRP2      -----MTITGIIAEFNPFHNGHKYLLDQAE-----GLKIVAMSGNFMQRGEPAIVDKWTR
TMCAL_STRPN      -----MTITGIIAEFNPFHNGHKYLLDQAE-----GLKIVAMSGNFMQRGEPAIVDKWTR
TMCAL_STRSV      -----MTVTGIIAEFNPFHNGHKYLLEQAS-----GLKIIAMSGNFVQRGEPAIVDKWTR
TMCAL_STRS2      -----MSISGIIAEYNPFHTGHKYLLEQAE-----GLKIVVMSGNFMQRGEPAIVDKWTR
TMCAL_STRP8      -----MTVTGIIAEFNPFHNGHKYLLETAE-----GLKIIAMSGNFMQRGEPALIDKWIR
TMCAL_STRP3      -----MTVTGIIAEFNPFHNGHKYLLETAE-----GLKIIAMSGNFMQRGEPALIDKWIR
TMCAL_STRPB      -----MTVTGIIAEFNPFHNGHKYLLETAE-----GLKIIAMSGNFMQRGEPALIDKWIR
TMCAL_STRPC      -----MTVTGIIAEFNPFHNGHKYLLETAE-----GLKIIAMSGNFMQRGEPALIDKWIR
TMCAL_STRP1      -----MTVTGIIAEFNPFHNGHKYLLETAE-----GLKIIAMSGNFMQRGEPALIDKWIR
TMCAL_STRP6      -----MTVTGIIAEFNPFHNGHKYLLETAE-----GLKIIAMSGNFMQRGEPALIDKWIR
TMCAL_STRPM      -----MTVTGIIAEFNPFHNGHKYLLETAE-----GLKIIAMSGNFMQRGEPALIDKWIR
TMCAL_STRPD      -----MTVTGIIAEFNPFHNGHKYLLETAE-----GLKIIAMSGNFMQRGEPALIDKWIR
TMCAL_STRPF      -----MTVTGIIAEFNPFHNGHKYLLETAE-----GLKIIAMSGNFMQRGEPALIDKWIR
TMCAL_STRPG      -----MTVTGIIAEFNPFHNGHKYLLETVE-----GLKIIAMSGNFMQRGEPALIDKWIR
TMCAL_LACDB      -----MSVVGIVAEYNPFHSGHEFLMNQARLIAGDDPIIAVMSGNYVQRGEMAILDKWSR
TMCAL_LACDA      -----MSVVGIVAEYNPFHSGHEFLMNQARLIAGDDPIIAVMSGNYVQRGEMAILDKWSR
TMCAL_LACAC      -----MSAVGIIAEFNPLHSGHEFLLNQARLIAKKDPIVVLMSGNYVQRGEMAIMSKWDR
TMCAL_LACJO      -----MSVIGIVAEYNPFHSGHEFLMNQARLAAKNDPIIVVMSGNYVQRGQMAIMDKWQR
TMCAL_LACGA      -----MSVIGIVAEYNPFHSGHEFLLNQARLVSENDPIIVMMSGNYVQRGQMAIMDKWQR
TMCAL_LACSS      -----MRITGIIAEYNPLHNGHIYQLQQARQQSQADLVIVCMSGNYVQRGQAALLDKWTR
TMCAL_LACP3      -----MQTVGMIAEFNPFHTGHAYALAQARKLAQADVVVVVMSGNYVQRGEPAIFDKWIR
TMCAL_LACBA      ---MTLQAAGIVTEYNPFHNGHAYQIAQARQKTGADVIVAAMSGNWVQRGEPAIMDKWQR
TMCAL_LACPL      -----MQAVGLITEYNPLHNGHRYHLRQAQQLTNADCVIVVMSGDWLQRGEPAILDKWTR
TMCAL_LEUMM      -----MQAVGIITEYNPFHNGHIYHIQQAKKLTGADVVVAVMSGNFVQRGEPALFDKWQR
TMCAL_OENOB      -----MEATGLITEYNPFHNGHLYHLKKAQELTKADVTIVLMSGNWVQRGLPAITDKWKR
TMCAL_LACS1      -----MKIIGIIAEYNPFHNGHLYQIEKVKEIYPESIIIVAMSGNFLQRGEPAIVDKWVR
TMCAL_ENTFA      -----MKACGIIVEYNPFHNGHRYHAQQARQQSGAEVVIAIMSGNFLQRGEPALLDKWAR
TMCAL_PEDPA      -----MQACAVIAEFNPFHNGHQYLLEQARKVTKADLVIVIMSGNFVQRGEPALINKWER
TMCAL_MYCH2      ------MAIAIIAEYNPFHNGHIYQLEYTKKNFPNDKIYIILSGNFTQRGEISLADFKTK
TMCAL_MYCH7      ------MAIAIIAEYNPFHNGHIYQLEYTKKNFPNDKIYIILSGNFTQRGEISLADFKTK
TMCAL_MYCHJ      ------MAIAIIAEYNPFHNGHIYQLEYTKKNFPNDKIYIILSGNFTQRGEISLADFKTK
TMCAL_MYCPU      ------MAIAIIAEYNPFHNGHIYQINYVKEKFPGEKIHIILSGNYVQRGEIAIASFEKR
TMCAL_MYCMO      ------MAIGIIAEYNPFHNGHIYMINYIKNKFPNEEIIVFMSGKYTQRGEIAVASFETR
TMCAL_MYCS5      MLINKNLKIGIVVEYNPFHNGHIYQLNWIKNNYPNSKIIIVMSHKYSQRGEIICMPFWKR
TMCAL_FUSNN      ---MFENVVGLIVEYNPFHNGHLHHIQEIDRLFEDNIKIAVMSGDYVQRGEPSLINKLEK
                                                          :*  :  **         :

TMCAL_CLOAB      AYAALSSGVDLVIELPCVYSLSSAEFFAYGAVSLLNSLGSVSNICFGSEEGEMHDIYLIS
TMCAL_CLONN      CELALNSGVDLVIELPSVYSLSSAEFFAYGSISLLNSIGIINNICFGSESGNIDDIKSIA
TMCAL_CLOTE      AKLALLNGVDLVLELPTIYSTSSAEFFAYGATSLLDGINIVNNLCFGSELGNIDIILKTS
TMCAL_CLOPE      TKMALEAGVDLVVELPTLFATSSAEFFAFGAVSLLNSLNVVNNICFGSECGDIDLIKKLS
TMCAL_CLOP1      TKMALEAGVDLVVELPTLFATSSAEFFAFGAVSLLNSLNVVNNICFGSECGDIDLIKKLS
TMCAL_CLOPS      TKMALEAGVDLVVELPTLFATSSAEFFAFGAVSLLNSLNVVNNICFGSECGDIDLIKKLS
TMCAL_CLOD6      AKIAVENGVDLVIELPTLFACQSAEIFSHGAITILNSLNCINSICFGSEEGNTEILYNIA
TMCAL_CALS4      AEMALKAGVDLVIELPVVYATSTAENFAYGAVKLLDSLKVIDCIAFGSEEGDLEKLSKIA
TMCAL_HUNT2      TKMALSAGADLVIELPLSCAMASAEYFASGAVRILNDIGIVDYICFGSEHGDVKTLDYIA
TMCAL_THEMA      AEIALRMGVDVVLELPVVFATQDAGGFAFGAVCVLDATGVVTDVVFGSESNDIEFLQRVA
TMCAL_SYNWW      AEMALTAGVDLLIELPFCFATRSAYYFAKGAVQLLQRSGVVTHLAFGSESGQLSQLQEIA
TMCAL_PELCD      AEMALRCGVDVVVELPFPFACASAPHFARGAVQCLDAL-GVDSLCFGSESGDLGALQRCA
TMCAL_BACSU      TKMALQSGVDLVIELPYLYAVQKADIFARGSVSILNEL-ECEALFFGSENGDIKPFLETA
TMCAL_BACLD      TKMALASFADVVVELPYIFAVQKAETFAEGAVSILNEL-GCSSLFFGSEHGDIEAFLNTA
TMCAL_BACAN      TKMALACGVDLVVELPYAFSTQKAETFANGAISILNAL-HVSEICFGSEDGQIENFYNTI
TMCAL_BACHK      TKMALACGVDLVVELPYAFSTQKAETFANGAISILNAL-HVSEICFGSEDGQIENFYNTI
TMCAL_BACCZ      TKMALACGVDLVVELPYAFSTQKAETFANGAISILNAL-HVSEICFGSEDGQIENFYNTV
TMCAL_BACAH      TKMALACGVDLVVELPYAFSTQKAETFANGAISILNAL-HVSEICFGSEDGQIENFYNTV
TMCAL_BACC1      TKMALACGVDLVVELPYAFSTQKAETFANGAISILNAL-HVSEICFGSEDGQIENFYNTI
TMCAL_BACCR      TKMALANGVDLVVELPYVFATQKAETFANGAISILNAL-RVSEICFGSEDGQIENFYNTI
TMCAL_BACHD      TSLALQGGADLVVELPYAFSTQKAEWFATGAVSILAAL-EADALCFGSEEGTIEPFHRLY
TMCAL_BACSK      AEMALAAGADLVVELPYAYSVQTAERFAEGAVTILAAL-RCSVLNFGSEKGEIAPFYALA
TMCAL_GEOKA      AKMALAAGVDVVIELPYAFAVQAAEQFAHGAVQLLAAI-GCQELCFGSESGEISAFLSAA
TMCAL_GEOTN      TKMALAAGVDIVIELPYVFAVQAAEQFAHGAVRLLDAL-GCQELCFGSESGDIAAFLTAA
TMCAL_OCEIH      TKAALHGGADIVIELPYTFAVQNSDRFANGAIQTLNKF-GVSSVCFGSESGSMDPFFQAY
TMCAL_LISIN      TKMALAAGVDMVIELPVSFATQHATIFAEESIRLLDAL-HIDTLFFGSEHGVSEDFSTAA
TMCAL_LISW6      TKMALAAGVDMVVELPVSFATQHATIFAEESVRILDAL-HVDALFFGSEHGVSEDFLTAA
TMCAL_LISMO      AKMALSAGVDMVVELPVSFATQHATIFAEEAVRILDAI-HIDTLFFGSEHGVAEDFTFAA
TMCAL_LISMF      TRMALAAGVDMVVELPVSFATQHATIFAEEAVRILDAI-HVDTLFFGSEHGVAEDFTLAA
TMCAL_STAA8      AKMALST-ADLVIELPATASLSSGDHFAELAVKVADYM-SVDTIAFGSENNDIKTLKQLA
TMCAL_STAA3      AKMALST-ADLVIELPATASLSSGDHFAELAVKVADYM-SVDTIAFGSENNDIKTLKQLA
TMCAL_STAAN      AKMALST-ADLVIELPATASLSSGDHFAELAVKVADYM-SVDTIAFGSENNDIKTLKQLA
TMCAL_STAAC      AKMALST-ADLVIELPATASLSSGDHFAELAVKVADYM-SVDTIAFGSENNDIKTLKQLA
TMCAL_STAAS      AKMALST-ADLVIELPATASLSSGDHFAELAVKVADYM-SVDTIAFGSENNDIKTLKQLA
TMCAL_STAAM      AKMALST-ADLVIELPATASLSSGDHFAELAVKVADYM-SVDTIAFGSENNDIKTLKQLA
TMCAL_STAAW      AKMALST-ADLVIELPATASLSSGDHFAELAVKVADYM-SVDTIAFGSENNDIKTLKQLA
TMCAL_STAAR      AKMALST-ADLVIELPATASLSSGDHFAELAVKVADYM-SVDTIAFGSENNNIKTLKQLA
TMCAL_STAAB      AKMALST-ADLVIELPATASLSSGDHFAELAVKVADYM-SVDTIAFGSENNDIKTLKQLA
TMCAL_STAES      TEMALSA-VDLVVELPLIGSLSSSDTFAEIAIKTAQYL-DIDIISFGSESASLKDLQYLA
TMCAL_STAEQ      TEMALSA-VDLVVELPLIGSLSSSDTFAEIAIKTAQYL-DIDIISFGSESASLKDLQYLA
TMCAL_STAS1      AKMALRA-VDLVVELPAYASVSAGQYFAKTAVQIADYL-NVSHLSFGSESGNMDDFLSLA
TMCAL_STAHJ      TKMALSG-VDLVVELPAIASLSSSDYFATFAIKVAHYL-DIDTIAFGSEINDISRLENVA
TMCAL_LACLM      AEMALSCGADLVVELPVMVSVQAADFFASGAVDILKNL-GITDLAFGSES--AIDYNEIA
TMCAL_LACLS      AEMALSCGADLVVELPVTVSVQAADFFASGAVDILKNL-GITDLAFGSES--AIDYNEIA
TMCAL_LACLA      AQMALACGADLVVELPVTVSAQAADFFASGAVDILKNL-GITDLAFGSES--AIDYNEIA
TMCAL_STRA5      SQMALENGADLVIELPFLVSVQSADYFASGAVSILARL-GVDNLCFGTEE--MLDYARIG
TMCAL_STRA1      SQMALENGADLVIELPFLVSVQSADYFASGAVSILARL-GVDNLCFGTEE--MLDYARIG
TMCAL_STRA3      AQMALENGADLVIELPFLVSVQSADYFASGAVSILARL-GVDNLCFGTEE--MLDYDRIG
TMCAL_STRT2      AQMALENGADLVVELPFFTAVQSADYFASGAVDILSRL-GIDSLTFGTEE--VLDYQTIA
TMCAL_STRTD      AQMALENGADLVVELPFFTAVQSADYFASGAVDVLSRL-GIDSLTFGTEE--VLDYQTIA
TMCAL_STRT1      AQMALENGADLVVELPFFTAVQSADYFASGAVDILSRL-GIDSLTFGTEE--VLDYQTIA
TMCAL_STRMU      AQMALENGADLVVELPFLVAVQSADYFASGAVDILAKL-GIDTLAFGTET--ALDYNGLS
TMCAL_STRR6      AQMALENGADLVVELPFLVSVQAADFFGQGSVDILDRL-GIDSLAFGTEE--VLDYQKIA
TMCAL_STRP2      AQMALENGADLVVELPFLVSVQAADFFGQGSVDILDRL-GIDSLAFGTEE--VLDYQKIA
TMCAL_STRPN      TQMALENGADLVVELPFLVSVQAADFFGQGAMDILDRL-GIDSLVFGTEE--VRDYQKIA
TMCAL_STRSV      AQMALEAGADLVLELPFLVSVQAADFFAKGAVDILERL-GIDYLMFGTEE--VLDYESIS
TMCAL_STRS2      AQMALEHGADLVVEMPFLVSVQSADHFAKGAISILHRL-GVEKLVFGTEE--MLDYQKIA
TMCAL_STRP8      SEMALKNGADIVVELPFFVSVQSADYFAQGAIDILCQL-GIQQLAFGTEN--VIDYQKLI
TMCAL_STRP3      SEMALKNGADIVVELPFFVSVQSADYFAQGAIDILCQL-GIQQLAFGTEN--VIDYQKLI
TMCAL_STRPB      SEMALKNGADIVVELPFFVSVQSADYFAQGAIDILCQL-GIQQLAFGTEN--VIDYQKLI
TMCAL_STRPC      SEMALKNGADIVVELPFFVSVQSADYFAQGAIDILCQL-GIQQLAFGTEN--VIDYQKLI
TMCAL_STRP1      SEMALKNGADIVVELPFFVSVQSADYFAQGAIDILCQL-GIQQLAFGTEN--VIDYQKLI
TMCAL_STRP6      SEMALKNGADIVVELPFFVSVQSADYFAQGAIDILCQL-GIQQLAFGTED--VIDYQKLI
TMCAL_STRPM      SEMALKNGADIVVELPFFVSVQSADYFAQGAIDILCQL-GIQQLAFGTED--VIDYQKLI
TMCAL_STRPD      SEMALKNGADIVVELPFFVSVQSADYFAQGAIDILCQL-GIQQLAFGTED--VIDYQKLI
TMCAL_STRPF      SEMALKNGADIVVELPFFVSVQSADYFAQGAIDILCQL-GIQQLAFGTEN--VIDYQKLI
TMCAL_STRPG      SEMALKNGADIVVELPFFVSVQSADYFAQGAIDILCQL-GIQQLAFGTED--VIDYQKLI
TMCAL_LACDB      ARSAIEAGADLVFELPFSYAVQAADMFATGGVDLLTRL-GAKNLVFGVED-ANLNFEYFG
TMCAL_LACDA      ARSAIEAGADLVFELPFSYAVQAADMFATGGVDLLTRL-GAKNLVFGVED-ANLNFEYFG
TMCAL_LACAC      AKAALQSGADLVFETPFSTAVEPADLFSLGNIDQLAKL-GVTDLVFGVED-ANLNFAYLG
TMCAL_LACJO      AKAALASGADLVFELPFSFAVQPADIFANGSIKMLSDL-GVSELFFGVED-ANLNFSYLG
TMCAL_LACGA      AKAALNSGADLVFELPFSFAVQPADIFANGSIRMLSNL-GVSELFFGVED-ANLNFSYLG
TMCAL_LACSS      AELALQNGADMVVELPFVSAVQPADRFATGAVQLLAAL-GCQTIAFGSEQ-PTFDYQQAG
TMCAL_LACP3      AQAALQHGADIVVELPVTGAVQAADQFAEAGVTALAAM-GVNTLAFGTEH-PEVAYADLA
TMCAL_LACBA      TEAALAGGVDLVVELSGAAALQPAHLFAQGAIAVLATL-KCQWLVFGTEH-PDMDYDCLM
TMCAL_LACPL      AKLALENGADLVIELPVFFATQPAHLFARGGIELLSAL-DCTSVVFGAEH-PELDFQRLA
TMCAL_LEUMM      TQMALENGVDLVIELPTFFAVQPSHIFADGAIQLLSAL-GVDNIVFGSEH-PEVDFLSIA
TMCAL_OENOB      AQAAIDAGADLVFELPFYYAVQAGEIFAQGAVRLLSDL-QVSSIICGSEH-ADIDFINLA
TMCAL_LACS1      AKQALLNGVDVVVEIPIAGCVQPADRFAENGVRILNNM-GCEELFFGAEH-AEYDFMTYA
TMCAL_ENTFA      AEEALQNGVDLVIELPTAWSVQSADYFAKGGIKLLQAL-QCESLCFGTDSTSAIDYAAFG
TMCAL_PEDPA      ARVAINCGADLVVEIPTEYAIDSAKEFAHAGVEIAQKL-GASFLAFGSEN-PDLDFENES
TMCAL_MYCH2      SKIALKYGADFIIKLPFEYATQAAHIFAKGAIKIVNQH-KIDKIIFGSESNDVENLYKLA
TMCAL_MYCH7      SKIALKYGADFIIKLPFEYATQAAHIFAKGAIKIVNQH-KIDKIIFGSESNDVENLYKLA
TMCAL_MYCHJ      SKIALKYGADFIIKLPFEYATQAAHIFAKGAIKIVNQH-KIDKIIFGSESNDVENLYKLA
TMCAL_MYCPU      KKIALEYGADYVHELEFEYASQAAHIFAKGALAKINSL-QIDKLIFGSETNDINEFINIA
TMCAL_MYCMO      KKYVLEAGVSKVYELPFETSTQAAHIFAQGAIKMLYEY-NVDKLIFGSETNDIDLFYKIA
TMCAL_MYCS5      KLWAKKYDVSKVLKLSTRKTIQAAHIFAQNAIQKLNKE-KIDILVFGSESTNDSLMLKIA
TMCAL_FUSNN      TKIALSQGIDIVIELPTFYSTQSAEIFAKGSVNLLNKL-SCSHIVFGSESNDLDKLKRIA
                    .     . : :         .  *.               :  * :           

TMCAL_CLOAB      KILVDEPYEYKSILKDYLNQGFSFPKSRMHALEMYLNSSLSK-----VDHGLNHDILSS-
TMCAL_CLONN      KILNNEPSEFKNHLKDYLDKGVSYPVARSKALVEYFNDNLE-----------TQEILKS-
TMCAL_CLOTE      KILQEEPLSFKEDLKNFIDKGISFPNAREKALINFMRKGKNS--------FDFNNVLCL-
TMCAL_CLOPE      EIIINEPPLFKEYLKDYLKEGLPFPKARSEALMKYLDDNNYK-----IDFSYLEKVLNS-
TMCAL_CLOP1      EIIINEPPLFKEYLKDYLKEGLPFPKARSKALMKYLDDNNYK-----IDFSYLEKVLNS-
TMCAL_CLOPS      EIIVNEPPIFKEYLKDYLKEGLPFPKARSEALMKYLDYNNYK-----TDFSYLEKVLNS-
TMCAL_CLOD6      EILANEPNKFKLLLKKYLDDGLLFPTARANALFDYIHQDKKNNFIQNYSKEQLSKTLNS-
TMCAL_CALS4      DILLEEPPDYKRALKENLGKGLTFAKARELALVKVTGDE------------SISKTLQT-
TMCAL_HUNT2      QILVEEPESYKSFLKEELDNGLSYPAARESALKKYTAHSI-----------NIPQIISS-
TMCAL_THEMA      RILYEQPDEYQKFLHEELKKGYSFPNARKYALMRYFSMKGWN----------EEEVLKLE
TMCAL_SYNWW      GILAHEPESYKTALKKRLSQGWSFPLARSSALQEYMGGEKKQ----------LQEILPG-
TMCAL_PELCD      QLLEECGEQVAERTATLLRRGMHYAAARSQVCAELSGCDAAT--------------LPLH
TMCAL_BACSU      QLIDEHKHILNDRIKEELKKG-ASYPAAAAIAFSSILHTE-S-------------ALDLS
TMCAL_BACLD      AHTIEHEDRLNEEARKQIAFG-LSYPQAMAKAFRSVTREGGN-------------IVDLS
TMCAL_BACAN      SVQKNEEETFNRLVKQFMNAG-NSYAKATSEAFLHILSSE-K-------------NIDMS
TMCAL_BACHK      SVQKNEEETFNRLVKQFMNAG-NSYAKATSEAFLHILSSE-K-------------NIDMS
TMCAL_BACCZ      SAQKNEEETFNRLVKQFMNAG-NSYAKATSEAFLHILSSE-K-------------NIDMS
TMCAL_BACAH      SAQKNEEETFNRLVKQFMNAG-NSYAKATSEAFLHILSSE-K-------------NIDMS
TMCAL_BACC1      SVQKNEEETFNRLVKQFMNAG-NSYAKATSEAFLHILSSE-K-------------NIDMS
TMCAL_BACCR      SIQKNEEETFNCLVKQFMDAG-NSYAKATSDAFSHILTSE-K-------------NIDMS
TMCAL_BACHD      HFMAKHRLAWDRMIKEELDKG-MSYPTATSLAFKRLEGSA-E-------------HLDLS
TMCAL_BACSK      EFMNDHQVAFNHHVKQFLKDG-VSYPKASAQAFSMLSGHE-K-------------LLPLD
TMCAL_GEOKA      KTWLEQKETFDSLIRTGLARG-QSFPKAAAEAWQKFGAAP----------------LDLS
TMCAL_GEOTN      KTWFQHKEKFDSLVRSELARG-QSFPKANAEAWRQLDSDA----------------LDLS
TMCAL_OCEIH      KTIKNSSEAFDNLLKDNLSDG-LSFPDAATAVYETLGLTE-G-------------NLDLS
TMCAL_LISIN      KTVVENEAAFNETIQLALGDKKTSYARAYTDAFTHLFGKE---------------LLDVT
TMCAL_LISW6      KTVVEHEASFNQAIQLALIDKKTSYARAYTETFKQSFGTE---------------LLDVT
TMCAL_LISMO      KKVVENEARFDEAIQLALVDKKTSYARAYTEAFKKLFGQN---------------LLDIT
TMCAL_LISMF      KKVVDNEARFDEAIQLALVDKKTSYARAYTEAFKKLFGQN---------------LLDIT
TMCAL_STAA8      HSINEIE--QSESFSQKVKEG-KSYPRIISELLEHHEALA--------------------
TMCAL_STAA3      HSINEIE--QSESFSQKVKEG-KSYPRIISELLEHHEALA--------------------
TMCAL_STAAN      HSINEIE--QSESFSQKVKEG-KSYPRIISELLEHHEALA--------------------
TMCAL_STAAC      HSINEIE--QSESFSQKVKEG-KSYPRIISELLEHHEALA--------------------
TMCAL_STAAS      HSINEIE--QSESFSQKVKEG-KSYPRIISELLEHHEALA--------------------
TMCAL_STAAM      HSINEIE--QSESFSQKVKEG-KSYPRIISELLEHHEALA--------------------
TMCAL_STAAW      HSINEIE--QSESFSQKVKEG-KSYPRIISELLEHHEALA--------------------
TMCAL_STAAR      HSINEIE--QSESFSQKVKEG-KSYPRIISELLEHHEALA--------------------
TMCAL_STAAB      HSINEIE--QSESFSQKVKEG-KSYPRIISELLEHHEALA--------------------
TMCAL_STAES      TQMIDYE--KHPDFKEKLKQG-KSYPRILSELTHNDTLLQ--------------------
TMCAL_STAEQ      TQMIDYE--KHPDFKEKLKQG-KSYPRILSELTHNDTLLQ--------------------
TMCAL_STAS1      QSIDKIE--QSPLFLEKLKEG-KSYPRILSELITDNDLLS--------------------
TMCAL_STAHJ      SNINSLE--QSSYFQDLIKQG-NSYAKIVHDLIDDQQVLR--------------------
TMCAL_LACLM      DIYETKE--TEMESFIKALPDQLSYPEKTQMMWQHFTGIK----------------FDGN
TMCAL_LACLS      DIYETKE--TEMESFIKALPEQLSYPEKTQMMWQHFTGIK----------------FDGN
TMCAL_LACLA      DIYEKRG--EEMESYIQSLADQLSYPEKTQKMWQHFTGIE----------------FDGN
TMCAL_STRA5      DIYVNKK--EEMEAFLKKQSDSLSYPQKMQAMWQEFAGIT----------------FSGQ
TMCAL_STRA1      DIYVNKK--EEMEAFLKKQSDSLSYPQKMQAMWQEFAGIT----------------FSGQ
TMCAL_STRA3      DIYVNKK--EEMEAFLKKQSDSLSYPQKTQAMWQEFAGIA----------------FSGQ
TMCAL_STRT2      DVYSEKS--EEMEAFVESLPSDLSYPQKTQKMWEKFAGVD----------------FTGN
TMCAL_STRTD      DVYSEKS--EEMEAFVESLPSDLSYPQKTQKMWEKFAGVD----------------FTGN
TMCAL_STRT1      DVYSEKS--EEMEAFVESLPSDLSYPQKTQKMWEKFAGVD----------------FTGN
TMCAL_STRMU      TIYGKMA--EQMSEFLTTLPEKLSYPQKTQLMWEKFAGVQ----------------FTGD
TMCAL_STRR6      DLYTEKG--AEMEKFVKNLPDSLSYPQKTQAMWKEFAGLD----------------FSGN
TMCAL_STRP2      DLYTEKG--AEMEKFVKNLPDSLSYPQKTQAMWKEFAGLD----------------FSGN
TMCAL_STRPN      DLYTEKG--AEMEKFVENLPDSLSYPQKTQAMWKEFAGLD----------------FSGN
TMCAL_STRSV      KVYGEKA--EQMEAYLAGLPDSLSYPQKTQAMWQEFAGLN----------------FSGS
TMCAL_STRS2      DIYVDKS--EEMENFVKNLPDNFSYPQKTQAMWQEFAGLT----------------FTGD
TMCAL_STRP8      KVYEKKS--EQMTAYLSTLEDTLSYPQKTQKMWEIFAGVK----------------FSGQ
TMCAL_STRP3      KVYEKKS--EQMTAYLSTLEDTLSYPQKTQKMWEIFAGVK----------------FSGQ
TMCAL_STRPB      KVYEKKS--EQMTAYLSTLEDTLSYPQKTQKMWEIFAGVK----------------FSGQ
TMCAL_STRPC      KVYEKKS--EQMTAYLSTLEDTLSYPQKTQKMWEIFAGVK----------------FSGQ
TMCAL_STRP1      KVYEKKS--EQMTAYLSTLEDTFSYPQKTQKMWEIFAGVK----------------FSGQ
TMCAL_STRP6      KVYEKKS--KQMTAYLSTLEDTLSYPQKTQKMWEIFAGVK----------------FSGQ
TMCAL_STRPM      KVYEKKS--KQMTAYLSTLEDTLSYPQKTQKMWEIFAGVK----------------FSGQ
TMCAL_STRPD      KVYEKKS--KQMTAYLSTLEDTLSYPQKTQKMWEIFAGVK----------------FSGQ
TMCAL_STRPF      KVYEKKS--KQMTAYLSTLEDTLSYPQKTQKMWEIFAGVK----------------FSGQ
TMCAL_STRPG      KVYEKKS--EQMTAYLSTLEDTLSYPQKTQKMWEIFAGVK----------------FSGQ
TMCAL_LACDB      DRISK----IPRQRQEFADYSQTYSTQYNQMVAREI---G----------------HEVS
TMCAL_LACDA      DRISK----IPRQRQEFADYSQTYSTQYNQMVAREI---G----------------HEVS
TMCAL_LACAC      SRIAE----IPQNHMDFKDYSQTYSTQYNQMVAHEV---G----------------HEIN
TMCAL_LACJO      QKINQ----IPKNRMDFRDYTQTYATQYNEMVAREV---G----------------HEVN
TMCAL_LACGA      QKINQ----IPKNRMDFRDYTQTYATQYNEMVAREV---G----------------HEVN
TMCAL_LACSS      QQIID----LPEQSAAFVDYQKTYATQLNEFYQEQL---S----------------LQID
TMCAL_LACP3      EKLAT----AALTGDGFRDYTQTYATQLNAVYAKAA---G----------------ITQT
TMCAL_LACBA      AHLPS----DPAI---FKRFDQTYASLFQGYLREQT---G----------------ITLS
TMCAL_LACPL      TAIAA----RQGS---FTHYNATFATQFNAALQAAT---G----------------VTLT
TMCAL_LEUMM      KQAPT----IAEGQ-EFKNHTQTFASAYAKQLEAET---S----------------FKLE
TMCAL_OENOB      AHEPD----ISGNS-NFDKKNRTFASNYAAALEEKT---G----------------FYLE
TMCAL_LACS1      QLVQN----LDSTE--FSKKNISYAEAFQEAVAAKI---G----------------HNID
TMCAL_ENTFA      QFVQENQSLIDQTFHALTDKQLSYPQKMTAVFRQVYPESR----------------FDFS
TMCAL_PEDPA      KILDR----------QFDQRAKKYNQNFAAQLFDDT---------------------AIM
TMCAL_MYCH2      NLWNQNQEAYNAFLKYALKLGYSFPKASAFALEEISGQKI-------------------V
TMCAL_MYCH7      NLWNQNQEAYNAFLKYALKLGYSFPKASAFALEEISGQKI-------------------V
TMCAL_MYCHJ      NLWNQNQEAYNAFLKYALKLGYSFPKASAFALEEISGQKI-------------------V
TMCAL_MYCPU      KIIKDNKSQYQLFLKENLKKGLSFPKASSLASQKITGKYF-------------------Q
TMCAL_MYCMO      NTLKNNEQEYNLKLKEFLKQGLGFPNASSLALKSLVGYEI-------------------V
TMCAL_MYCS5      TFIKENKEIYNQTLKKNLKGGNSFPKANFLTLKELTNEDF-------------------S
TMCAL_FUSNN      TISLTKE--FELSLREFLAEGFSYPTAFSKVLFDEKLG----------------------
                                                                             

TMCAL_CLOAB      -SNNILGVEYCKSLIKLK--SNIKPYTIKREGNNYNDLELKT-----ISSASAIRNALKS
TMCAL_CLONN      -SNNILGIEYCKSLLKLK--STIIPYTIQRKGSNYNDDKLESK----FSSATAIRSHVKN
TMCAL_CLOTE      -SNNILALEYCKNLFKIN--SNIKPFTVKRQGSHYNCLHLRDN----LSSATAIREYIGN
TMCAL_CLOPE      -SNNILAIEYCKSLYKLQ--SSIKPFTIQRLGADYNDEELSKNE---IASASAIRKSIYT
TMCAL_CLOP1      -SNNILAIEYCKSLYKLQ--SSIKPFTIQRLGADYNDEKLSKNE---IASASAIRKSIYT
TMCAL_CLOPS      -SNNILAIEYCKSLYKLQ--STIKPFTIQRLGADYNDEELSKNE---IASASAIRKSIYT
TMCAL_CLOD6      -SNNILGIEYIKNLIHLN--SSIKPFTISRVQSEYNSEEIESD----ICSATAIRTSLKE
TMCAL_CALS4      -SNNILGIEYLKALKKIK--SSIVPFTIKRRGALYTSLKLEGE----FASATSIRKAIEE
TMCAL_HUNT2      -SNNILGIEYLKALRRIK--SSIIPLTIKRINNDYNTENITGS----ISSASSIRKYIST
TMCAL_THEMA      KSNDILGVEYIHSALKIG--SNIRFHTIKRVGAEEKDTSFRGR----FSSATAIRNLMRE
TMCAL_SYNWW      -PNNILALEYLRVIEEEG--IPLLPLTIPRQGSS-FHSSDLSP----YSSARAIRQALYH
TMCAL_PELCD      QPNNILGIEYLRALRATG--SAMQPFTISRLGAGYHDDAVGPGN---IASASGIRKRLAM
TMCAL_BACSU      KPNNILGYQYVTSILTGG--YPMKPYTTARISSDYHDADLPEGE-NHIASATSIRKAMI-
TMCAL_BACLD      KPNNILGFHYVKAIMQKQ--LSMKPETVKRRSSGYHDSTFPEAD--RIASATSIRKSIF-
TMCAL_BACAN      QPNNILGFQYIKAILMQN--SSMQAQTIKRFASHYHDETF--ND-QHIASATSIRKQLFS
TMCAL_BACHK      QPNNILGFQYIKAILMQN--SSMQAQTIKRFASHYHDETF--ND-QHIASATSIRKQLFS
TMCAL_BACCZ      QPNNILGFQYIKAILMQN--SSMQAQTIKRFASHYHDETF--ND-QHIASATSIRKQLFS
TMCAL_BACAH      QPNNILGFQYIKAILMQN--SSMQAQTIKRFASHYHDETF--ND-QHIASATSIRKQLFS
TMCAL_BACC1      QPNNILGFQYIKAILMQN--SSMQAQTIKRFASHYHDETF--ND-QHIASATSIRKQLFS
TMCAL_BACCR      QPNNILGFQYMKAILSQN--SSIQAQTIKRFASHYHDETF--ND-QHIASATSIRKQLFS
TMCAL_BACHD      RPNNILGFHYVKAIYDLH--TSIKAMTIPRIKAGYHDDSLN--E-SSIASATSIRKSLKT
TMCAL_BACSK      QPNNILGYHYVKAIQRLG--ISMEATTTLRIQAGYHDKEF---A-GPIASATAIRKALLS
TMCAL_GEOKA      KPNNVLGFAYVKAIWQNK--LAMMPRTIPRLAAGYHDESF--SH-PSIASATSLRKTLR-
TMCAL_GEOTN      KPNNVLGFAYVKAIWQNK--LAIVPRTIPRLAAGYHDESF--SH-SSIASATSLRKVLR-
TMCAL_OCEIH      KPNNILGFSYVKAIQEYA--PTIKPLTIQRKNNDFHDESI---N-GSIASATSIRKQILQ
TMCAL_LISIN      KPNNILGFHYALAIQKQN--PSIALQTMPREHSGYHDAEA--SH-DYIASATAIRKLLL-
TMCAL_LISW6      KPNNILGFHYALAIQKQN--PTISLQTMARIHAGYHDIEA--NH-DQIASATAIRKLLL-
TMCAL_LISMO      KPNNILGFHYALAVQKQN--PSISLQTIPREHAGYHDEEA--SH-DQIASATAIRKLIL-
TMCAL_LISMF      KPNNILGFHYALAAQKQN--PSISLQTIPREHAGYHDEEA--NH-DQIASATAIRKLIL-
TMCAL_STAA8      SPNNILGISYLKAIAKNA--KNINAISIKRENAQHHDSLI--QH-HQFASGTSIRTSIIS
TMCAL_STAA3      SPNNILGISYLKAIAKNA--KNINAISIKRENAQHHDSLI--QH-HQFASGTSIRTSIIS
TMCAL_STAAN      SPNNILGISYLKAIAKNA--KNINAISIKRENAQHHDSLI--QH-HQFASGTSIRTSIIS
TMCAL_STAAC      SPNNILGISYLKAIAKNA--KNINAISIKRENAQHHDSLI--QH-HQFASGTSIRTSIIS
TMCAL_STAAS      SPNNILGISYLKAIAKNA--KNINAISIKRENAQHHDSLI--QH-HQFASGTSIRTSIIS
TMCAL_STAAM      SPNNILGISYLKAIAKNA--KNINAISIKRENAQHHDSLI--QH-HQFASGTSIRTSIIS
TMCAL_STAAW      SPNNILGISYLKAIAKNA--KNINAISIKRENAQHHDSLI--QH-HQFASGTSIRTSIIS
TMCAL_STAAR      SPNNILGISYLKAIAKHA--KNINAISIKRENAQHHDSLI--QH-HKFASGTSIRTSIIS
TMCAL_STAAB      SPNNILGISYLKAIAKHA--KNINAISIKRENAQHHDSLI--QH-HQFASGTSIRTSIIS
TMCAL_STAES      SPNNILGISYLKAMQQFA--PHMSALTIKREGSLHHQKVI--DH-HHFASGTSIRRSLMN
TMCAL_STAEQ      SPNNILGISYLKAMQQFA--PHMSALTIKREGSLHHQKVI--DH-HHFASGTSIRRSLMN
TMCAL_STAS1      SPNNTLGLSYVRAIQTYA--PSIQPWTISRFQSAHHDNEI--SH-QTFASGTSIRQSLMN
TMCAL_STAHJ      SPNNILGVAYIKAISNIA--PTIKRIAIQRQSTAHHDQEI--KH-DNFASGSAIRHALLN
TMCAL_LACLM      TPNHVLALAYAKAAAGKN----INLQAIKRVGK-FHSTKLTE----GFASATALRQQLFS
TMCAL_LACLS      TPNHVLALAYAKAAAGKN----INLQAIKRVGK-FHSTKLTE----GFASATALRQSLFS
TMCAL_LACLA      TPNHVLALAYAKAAAGKQ----INLQAIKRVGK-FHSLELTE----GFASATALRQELFS
TMCAL_STRA5      TPNHILGLAYTKAASQNG----IRLNPIQRQGAGYHSSEKTE----IFASATSLRKHQ--
TMCAL_STRA1      TPNHILGLAYTKAASQNG----IRLNPIQRQGAGYHSSEKTE----IFASATSLRKHQ--
TMCAL_STRA3      TPNHILGLAYTKAASQNG----IRLNPIQRQGAGYHSSEKTE----IFASATSLRKHQ--
TMCAL_STRT2      TPNHILGLAYAKACAGKG----ITLNPIQRQGAGYHSLDKEV----SFASATSLRLHK--
TMCAL_STRTD      TPNHILGLAYAKACAGKG----ITLNPIQRQGAGYHSLDKEV----SFASATSLRLHK--
TMCAL_STRT1      TPNHILGLAYAKACAGKG----ITLNPIQRQGAGYHSLDKKV----SFASATSLRLHK--
TMCAL_STRMU      TPNHILALAYAKACAGRN----IRLRPIQRRGADYHSTEKTV----AYASATSLRHHR--
TMCAL_STRR6      TPNHVLALAYAKAVAGRN----IKLHPIQRQGAGYHSVNKDV----DFASATALRQHQ--
TMCAL_STRP2      TPNHVLALAYAKAVAGRN----IKLHPIQRQGAGYHSVNKDV----DFASATALRQHQ--
TMCAL_STRPN      TPNHVLALAYAKAVAGRN----IKLHPIQRQGAGYHSVNKDV----DFASATALRQHQ--
TMCAL_STRSV      TPNHILGLAYAKAVAGRD----IKLCSIQRQGAGYHSLSANQ----EFASATALRQNL--
TMCAL_STRS2      TPNHILALAYAKGVAGTG----IQLSPVQRQGAGFHSEEVET----SYASAIAIRKGA--
TMCAL_STRP8      TPNHILGLSYAKASAGKH----IQLCPIKRQGAAYHSKDKNH----LLASASAIRQHL--
TMCAL_STRP3      TPNHILGLSYAKASAGKH----IQLCPIKRQGAAYHSKDKNH----LLASASAIRQHL--
TMCAL_STRPB      TPNHILGLSYAKASAGKH----IQLCPIKRQGAAYHSKDKNH----LLASASAIRQHL--
TMCAL_STRPC      TPNHILGLSYAKASAGKH----IQLCPIKRQGAAYHSKDKNH----LLASASAIRQHL--
TMCAL_STRP1      TPNHILGLSYAKASAGKH----IQLCPIKRQGAAYHSKDKNH----LLASASAIRQHL--
TMCAL_STRP6      TPNHILGLSYAKASAGKH----IQLCPIKRQGAAYHSKDKNH----LLASASAIRQHL--
TMCAL_STRPM      TPNHILGLSYAKASAGKH----IQLCPIKRQGAAYHSKDKNH----LLASASAIRQHL--
TMCAL_STRPD      TPNHILGLSYAKASAGKH----IQLCPIKRQGAAYHSKDKNH----LLASASAIRQHL--
TMCAL_STRPF      TPNHILGLSYAKASAGKH----IQLCPIKRQGAAYHSKDKNH----LLASASAIRQHL--
TMCAL_STRPG      TPNHILGLSYAKASAGKH----IQLCPIKRQGAAYHSKDKNH----LLASASAIRQHL--
TMCAL_LACDB      EPNAILGLAYAVANANLG--SPLKLSPVNRVGAGHDDILQRE---AVVQSASAIRNLLLN
TMCAL_LACDA      EPNAILGLAYAVANANLG--SPLKLSPVNRVGAGHDEILQRE---AVVQSASAIRNLLLN
TMCAL_LACAC      QPNAILGLAYAVANHNLG--SPLKLHPVNRIGAGHDDILQRS---GVVQSASAIRNLLLH
TMCAL_LACJO      QPNMMLAVAYAVASEQLK--NPLHLHPITRVGSGHDDPLLQD---KIVSSATAIRNYCLH
TMCAL_LACGA      QPNMMLAVAYAVASEQLD--TPLHLHPVTRLGSGHDDQLLQD---KIISSATAIRNYCLH
TMCAL_LACSS      QPNHLLGISYAVANARLA--QPLNLLAIKREQAQHGDQTVST---APYASASAIRQVVTQ
TMCAL_LACP3      DPNFMLGLSYAKANLALK--RPMTLLPFARRGIGHDEVGIQ----ANIASASTVREYLRA
TMCAL_LACBA      AANDILGFFYAVANQQQG--QPLQLVPLARRGSQHNDTAVMQ--GTNYASATAIRAASLA
TMCAL_LACPL      AANDMLSFCYYAANQTLA--HPMQLLPIKRRQADHATTTIAA--DSRYASGTAVRQAALA
TMCAL_LEUMM      EPNDILALGYASAILNQQ--ANIGIIPIQRAEANYHDANFTD--EQSIASASSIRLALHK
TMCAL_OENOB      NANDILAFSYAKAILNQNLTEKIKLRTISRVSADYHDQFLND--GE-IASATAIRKALSE
TMCAL_LACS1      SPNDVLGLAYAKANLKFG--KKLKLNPISRNVAGYHDKSLSP--DSNIASATAIRKVLFS
TMCAL_ENTFA      SPNHILGMSYAKENATYP--TPMTLYPIARKQAGFHDATISG----KVASATAIRQSVFQ
TMCAL_PEDPA      NSNDILGINYAYWNSKSK--RGLQLIPLQREQADHRDTEIKG----SIASASAIRRAALE
TMCAL_MYCH2      FPNDILGFEYIKQIVANN--YPIRAYTLKRSEEFSLKNPEPN-----IASATYLRQLVNE
TMCAL_MYCH7      FPNDILGFEYIKQIVANN--YPIRAYTLKRSEEFSLKNPEPN-----IASATYLRQLVNE
TMCAL_MYCHJ      FPNDILGFEYIKQIVANN--YPIRAYTLKRSEEFSLKNPEPN-----IASATYLRQLVNE
TMCAL_MYCPU      MPNDILGFEYVKQIIFNN--YKITAFCHTRTNDYKSDKPSGK-----YASSTLIRKMIFE
TMCAL_MYCMO      MPNDILGLEYVKAIVNNN--YNIQAYCLKRTINFHSEFTLEN-----FASASYLRTLIYK
TMCAL_MYCS5      LPNDILGFEYIKQIVENN--YKIQPIAIKRSVGFHSEEPSDE-----FASASLIRKMLKD
TMCAL_FUSNN      -SNDILALEYLRAIKTIN--SKIEAYCIKREKTGYYDDEKDN-----FSSATYIRKILLD
                  .*  *.  *            :      *                   *.  :*     

TMCAL_CLOAB      KKEISTLRYQV---------------PKKTFDLISDNINS---LCYKDYIFDYIKYKALT
TMCAL_CLONN      SKNINILKDIL---------------PSKTFNYLYDKFNNN-NLVFEDSMFSFIKYKSLT
TMCAL_CLOTE      NENLDNLVKSV---------------PETVLNMLKNFQNEQCKFPFEEDMFTYIKHKYFS
TMCAL_CLOPE      S-NMEESLDFM---------------PEYSYNLLKNTSFSD-----LDKMFDLVKYAIVS
TMCAL_CLOP1      S-NIEESLDFM---------------PEYSYNLLKNTSFSD-----LDKMFDLVKYAIVS
TMCAL_CLOPS      S-NIEESLDFM---------------PEYSYNLLKNTSFSD-----LDKMFDLVKYAIVS
TMCAL_CLOD6      NTDLFHLKNVI---------------PEKTYNILNEKIDNGFLPMFDDFFFDILKTIILR
TMCAL_CALS4      K-GIKAVKNYV---------------PDFTLKILERAFKEGQGPVYLQDFSPIILYLLRS
TMCAL_HUNT2      S-NSTSFDDVLA-----------MTMPKTSVDILFEEFSAGRGPVFKEDFYPVVTSLIRK
TMCAL_THEMA      K-RWEEVRDSL---------------PEDSFEILMREINEGRGPVFLENMGDFLLSFFRL
TMCAL_SYNWW      NLDWEKITNSI---------------SPATEKILQREIALGRAPIGPDSLEQAIMVNLRL
TMCAL_PELCD      GETVDELLPAP------------------AVDVVAGARADRLFP--DEDLLHRLLLAQIF
TMCAL_BACSU      GQNLEAC--------------LRF-LPAASARELAAYRKSFGLWHTPESYFSYLKYSLST
TMCAL_BACLD      ETGSLAD--------------SRFYLPKTTVDELDEYARTFGMWHSPEDYFPFLKYSLHT
TMCAL_BACAN      ENSSFTE--------------IESFIPKATASLLASYKQNYGTLHNWEQYFSFFKYKLMT
TMCAL_BACHK      ENSSFTE--------------IESFIPKATASLLASYKQNYGTLHNWEQYFSFFKYKLMT
TMCAL_BACCZ      ENSSFTE--------------IESFIPKATASLLASYKQNYGTLHNWEQYFSFFKYKLMT
TMCAL_BACAH      ENSSFTE--------------IESFIPKATASLLASYKQNYGTLHNWEQYFSFFKYKLMT
TMCAL_BACC1      ENSSFTE--------------IEPFIPKATASLLASYKQNYGTLHNWEQYFSFFKYKLMT
TMCAL_BACCR      EEGSFTT--------------IEPFLPQATTSLLANYKQNYGILHNWEQYFSFFKYRLMT
TMCAL_BACHD      KEGWQM---------------VDRVVPSYTTEMLKSFEKETTFLPSWERLFPLLKYRLLT
TMCAL_BACSK      GEN------------------IETAVPAHTARLIQMYKRRYRLLHTWEHYFPFLQHKVLT
TMCAL_GEOKA      QTGRLES--------------IAAYVPPATLEQLRQYRETYGRFHDWEVYFPLLKYRLLT
TMCAL_GEOTN      QTGQLER--------------IAAYIPSTTAEQLQQYRLTYGRWHDWEAYFPLLKYRLLT
TMCAL_OCEIH      SDSMDDD--------------VHNAIPIETLHQLQSYKDKTAIWHDFEQYFPLLRYRVLT
TMCAL_LISIN      -AGNLEE--------------ASRYLPDSSIEVLNNYR---GPFLSFEDYWPLLKFRLIQ
TMCAL_LISW6      -AGNLEE--------------ASRYLPASSIEILKNYD---GPFLSWENYWALLKYRLIQ
TMCAL_LISMO      -AGKLEE--------------ASHYLPASSIDILRNYE---GPFLSWTDYWSFLQYRLIQ
TMCAL_LISMF      -AGKLEE--------------SSHYLPASSIAILRNYE---GPFLSWTDYWSFLQYRLIQ
TMCAL_STAA8      QDD-----------------------HWHHVVPKDIQHLYVTPHITLNQIFPYLKYQIIA
TMCAL_STAA3      QDD-----------------------HWHHVVPKDIQHLYVTPHITLNQIFPYLKYQIIA
TMCAL_STAAN      QDD-----------------------HWHHVVPKDIQHLYVTPHITLNQIFPYLKYQIIA
TMCAL_STAAC      QDD-----------------------HWHHVVPKDIQHLYVTPHITLNQIFPYLKYQIIA
TMCAL_STAAS      QDD-----------------------HWHHVVPKDIQHLYVTPHITLNQIFPYLKYQIIA
TMCAL_STAAM      QDD-----------------------HWHHVVPKDIQHLYVTPHITLNQIFPYLKYQIIA
TMCAL_STAAW      QDD-----------------------HWHHVVPKDIQHLYVTPHITLNQIFPYLKYQIIA
TMCAL_STAAR      QDD-----------------------HWHHVVPKDIQHLYVTPHITLNQIFPYLKYQIIA
TMCAL_STAAB      QDD-----------------------HWHHVVPKDIQHLYVTPHITLNQIFPYLKYQIIA
TMCAL_STAES      DNV-----------------------DWKNVVPNQIQSLYCKPHTTVEDTFPFIKHQLIT
TMCAL_STAEQ      DNV-----------------------DWKNVVPNQIQSLYCKPHTTVEDTFPFIKHQLIT
TMCAL_STAS1      QTD-----------------------LWKDVVPCEIHKHYERPHISIEDTFNYLKYAILS
TMCAL_STAHJ      KEN-----------------------TWKDVVPADIKHLYETPHLLKKQTFNFIKYNILS
TMCAL_LACLM      LTD-------EVGQSLF---SLTDLSAIENHVPSVILETYASPKTNWAAYFPLLQYKIRL
TMCAL_LACLS      LTERKNLLTEQTHQSVSQKPAILDLSAIKNHVPSVILETYASPKTNWAAYFPLLQYKIRL
TMCAL_LACLA      LTERQNLLTEQTNQSVSNKLVLTDLSAIKNHVPSAILAAYASPKTNWAAYFPLLQYKIRV
TMCAL_STRA5      ----------------------SDRFFVEKGMPNSDLFLN-SPQVVWQDYFSLLKYQIMT
TMCAL_STRA1      ----------------------SDRFFVEKGMPNSDLFLN-SPQVVWQDYFSLLKYQIMT
TMCAL_STRA3      ----------------------SDRFFVEKGMPNSDLFLN-SPQVVWQDYFSLLKYQIMT
TMCAL_STRT2      ----------------------EDSNFVDKFMPNSKLFQT-SPQVSWDNYFQLLVYQILT
TMCAL_STRTD      ----------------------EDSDFVDKFMPNSKLFQT-SPQVSWDNYFQLLVYQILT
TMCAL_STRT1      ----------------------EDSDFVDKFMPNSKLFQT-SPQVSWDNYFQLLVYQILT
TMCAL_STRMU      ----------------------QDPAFVAKSMPNANLFQT-SPQVTWEDYFTLLQYQVLT
TMCAL_STRR6      ----------------------KDQDFLERFMPSVALFEQ-ASKVIWEDYFPLLRYQILS
TMCAL_STRP2      ----------------------KDQDFLERFMPSVALFEQ-ASKVIWEDYFPLLRYQILS
TMCAL_STRPN      ----------------------KDQDFLERFMPSVALFEQ-ASKVIWEDYFPLLRYQILS
TMCAL_STRSV      ----------------------DQPDFLKKFTPAHHLLET-APKVIWSDLFSYLRYQIVT
TMCAL_STRS2      ----------------------DQLDLVRDFLPSASLFEE-ATKVSWRNYFPLLRYQITT
TMCAL_STRP8      ----------------------NDWDFISHSVPNAGLLIN-NPHMSWDHYFSFLKYQILN
TMCAL_STRP3      ----------------------NDWDFISHSVPNAGLLIN-NPHMSWDHYFSFLKYQILN
TMCAL_STRPB      ----------------------NDWDFISHSVPNAGLLIN-NPHMSWDHYFSFLKYQILN
TMCAL_STRPC      ----------------------NDWDFISHSVPNAGLLIN-NPHMSWDHYFSFLKYQILN
TMCAL_STRP1      ----------------------NDWDFISHSVPNAGLLIN-NPHMSWDHYFSFLKYQILN
TMCAL_STRP6      ----------------------NDWDFISHSVPNAGLLIN-NPHMSWDHYFSFLKYQILN
TMCAL_STRPM      ----------------------NDWDFISHSVPNAGLLIN-NPHMSWDHYFSFLKYQILN
TMCAL_STRPD      ----------------------NDWDFISHSVPNAGLLIN-NPHMSWDHYFSFLKYQILN
TMCAL_STRPF      ----------------------NDWDFISHSVPNAGLLIN-NPHMSWDHYFSFLKYQILN
TMCAL_STRPG      ----------------------NDWDFISHSVPNAGLLIN-NPHMSWDHYFSFLKYQILN
TMCAL_LACDB      GAER-------------------SELEQWLPKGEIAAFDQEKVLPNWELLFPFLKYRLES
TMCAL_LACDA      GAER-------------------SELEQWLPKGEIAAFDQEKVLPNWELLFPFLKYRLES
TMCAL_LACAC      GEDT-------------------SNLKYWMPKNEANILAKQKVYPNWNLLYPFLKYRIES
TMCAL_LACJO      HPNDL------------------SELKKYLPKGELVSLESQKVYPNWNLLFSFLKYRIES
TMCAL_LACGA      HPNDL------------------IELKKYLPKGELAALEKQKVYPNWNLLFNFLKYRIES
TMCAL_LACSS      GTAL-------------------AALQHVVPAGTLAALADSTLLTE-DQLWPLLKYRIES
TMCAL_LACP3      DQSV----------------------EAIVPT-ELVDFYAKQQQYSWAQFFPWLKYRLQT
TMCAL_LACBA      GDWA--------------------TVQPVVPAKTLALLQQES-LISWADFWPLLRYQLIS
TMCAL_LACPL      QDWA--------------------ALKPVVPADTFTALTTQR-LQRWSDFWPFLQYQLLT
TMCAL_LEUMM      GKTE-------------------KIKNVVPEATKVALDTAANTIDFESKFWSMLKYRLTT
TMCAL_OENOB      GQN----------------------------VDSYTPMSDLQYTDYEARLFQLLKYRLST
TMCAL_LACS1      KDHN-----------------------LVDKYLPSYQDLKDEKYISWDDFWPFLRYKLIS
TMCAL_ENTFA      QEIT---------------------QVLPTVPSITAQHLQTQTMISWENYWPFLKYKIVQ
TMCAL_PEDPA      -----------------------QSEYFNAVPKASLKAIRNAKLTSWEDFWIMLNYRLLT
TMCAL_MYCH2      NKS--------------------------ISRFSPMKFIHPVCS--LANLYPEFQKIVRE
TMCAL_MYCH7      NKS--------------------------ISRFSPMKFIHPVCS--LPNLYPEFQKIVRE
TMCAL_MYCHJ      NKS--------------------------ISRFSPMKFIHPVCS--LANLYPEFQKIVRE
TMCAL_MYCPU      GKD--------------------------VSKYTPMIFEKKPIR--IEDLYFDFQTIIFN
TMCAL_MYCMO      SED--------------------------ISKYSPMIFETIPDR--IENYYEEFKQKVIS
TMCAL_MYCS5      GRD--------------------------VSKYTPVDLKQIPTKLLIENTFLKFKKYILK
TMCAL_FUSNN      SNEKKENKLNK--------------IKNLVPEFSYKILEENFGVFSCLSDFYDLIKYNII
                                                                      .      

TMCAL_CLOAB      SKE-SLNKLPDVSEGIDNKIYNSLLKC---SNMDSLMTLTKNKRYTYSRISRILTQYFIG
TMCAL_CLONN      LKN-KLENLPDVKEGLHNKIYSELKNS---NSFYELVSNIKSKRYAYTRISRILCQYFIG
TMCAL_CLOTE      NTG-SIENLPDVSEGIHNRIYRALDTC---NTLKEAMDMIKTKRYTYTRIKRILCHYFIG
TMCAL_CLOPE      NPN-VLKEIPEASEGIDNKIIQNIGKA---NSLDELINLCKSKRYSYTRLNRILCHVLLN
TMCAL_CLOP1      NPN-VLKEIPEASEGIDNKIIQNIGKA---NSLDELINLCKSKRYSYTRLNRILCHVLLN
TMCAL_CLOPS      NPN-ILKEIPEASEGIDNKIIQNIGKA---NSLDELINLCKSKRYSYTRLNRILCHILLN
TMCAL_CLOD6      DMD-TLKEYFEVNEGIENRIYKDIFTS---EFLHELQLAIKSKRYTLTKIKRTLNNILLG
TMCAL_CALS4      GHP--LENIFDVAEGIDNKIYKAASMT---NNIKDLIKLTKSKRYTESRIRHILLHLLLK
TMCAL_HUNT2      MTPEQIRNFAYVSEGLENRIKSAADTA---GTYEELVESICTRRYTKTRVQRILMGILMG
TMCAL_THEMA      KNMDFFEKIHGFSEGLEKRFHVCARQT---GSYRDFLECVKAKRFTFSRIRRLALFSVFE
TMCAL_SYNWW      VSTDYLREIYEVSEGLEFRIKEATNSC---GTLEELRQFIKSKRYSLTRINRTLLYTLFA
TMCAL_PELCD      RGRDYLQSLYQVESGIDARLTDAAATS---RDWQALVDAVKVRQFTRTRIQRTLMYILND
TMCAL_BACSU      VTARELQQVYEVEEGLEHRIIRSIRKS---SSYQEFMELLKTKRYTWTRLQRMNTHILTR
TMCAL_BACLD      MDTEELKGIYEVEEGLEHRVKKAIRKA---GSFKEYMELLKTKRYTWTRLQRMNTHILTK
TMCAL_BACAN      MSPENLRHIYEIEEGLEHRILSKIQTS---SSFHSFMESLKTKRYTWTRLQRACTHILTN
TMCAL_BACHK      MSPEDLRHIYEIEEGLEHRILSKIQTS---SSFHSFMESLKTKRYTWTRLQRACTHILTN
TMCAL_BACCZ      MSPKDLQHIYEIEEGLEHRILSKIQTS---SSFHSFMEALKTKRYTWTRLQRACTHILTN
TMCAL_BACAH      MSPEDLRHIYEIEEGLEHRILSKIQTS---SSFHLFMEALKTKRYTWTRLQRACTHILTN
TMCAL_BACC1      MSPEDLRHIYEIEEGLEHRILSKIQTS---SSFHSFMEALKTKRYTWTRLQRACTHILTN
TMCAL_BACCR      MSPGDLRHIYEIEEGLEHRILSKIQNS---SSFYSFMEALKTKRYTWTRLQRACTHILTN
TMCAL_BACHD      ATPEQLHAIYEGEEGLEYRALKTIVSA---TSFHDWMTKMKTKRYTWTRIQRYATHLFTN
TMCAL_BACSK      TPLAELAKTAECSEGLEHRLRDSLFSA---SSFQGWLSATKSKRYTQTRLQRLFAHLLTG
TMCAL_GEOKA      ATEADLRRIAGVEEGIEHRLKQHIAHA---ETFAAFIAAVKTKRYTWTRLQRLCAHVLTN
TMCAL_GEOTN      SSEEDLRRIAGVEEGIEYRLKQKIVSA---ETFATFIAATKTKRYTWTRLQRLCVHVLTN
TMCAL_OCEIH      MSIKELQNIQGVVEGLEYRIQQTASDA---LSFVDWMHKIKTKRYTWTRIQRIFIHILTN
TMCAL_LISIN      ASSDELEGIRGVSEGIQNRMQLAAKKA---HSFSDFIEIMKTKRYSNARLQRTALQILLN
TMCAL_LISW6      AETDELEGIRNVSEGIQNRMQIAATKA---QYFSDFIESMKTKRYSNARIQRTALQILLN
TMCAL_LISMO      ASTEELEGIRGVSEGIQNRMQQAATKA---QNFSDFIELTKTKRYSNARLQRTALQILLN
TMCAL_LISMF      AGSEELEGIRGVSEGIQNRMQQAATKA---QNFSDFIELTKTKRYSNARLQRTALQILLN
TMCAL_STAA8      MTTDSLKNIYTVTEGFENRLKSNIYEA---TDFHHFVKLLKTKRYTYTHIQRLLMNVLLN
TMCAL_STAA3      MTTDSLKNIYTVTEGFENRLKSNIYEA---TDFHHFVKLLKTKRYTYTHIQRLLMNVLLN
TMCAL_STAAN      MTTDSLKNIYTVTEGFENRLKSNIYEA---TDFHHFVKLLKTKRYTYTHIQRLLMNVLLN
TMCAL_STAAC      MTTDSLKNIYTVTEGFENRLKSNIYEA---TDFHHFVKLLKTKRYTYTHIQRLLMNVLLN
TMCAL_STAAS      MTTDSLKNIYTVTEGFENRLKSNIYEA---TDFHHFVKLLKTKRYTYTHIQRLLMNVLLN
TMCAL_STAAM      MTTDSLKNIYTVTEGFENRLKSNIYEA---TDFHHFVKLLKTKRYTYTHIQRLLMNVLLN
TMCAL_STAAW      MTTDSLKNIYTVTEGFENRLKSNIYEA---TDFHHFVKLLKTKRYTYTHIQRLLMNVLLN
TMCAL_STAAR      MTTESLKNIYTVTEGFENRLKSYINEA---TDFHHFVKSLKTKRYTYTHIQRLLMNVLLN
TMCAL_STAAB      MTTESLKNIYTVNEGFENRLKSTINEA---TDFHHFVKSLKTKRYTYTHIQRLLMNVLLN
TMCAL_STAES      QPKESLHSIYTINEGFENRLQTMIHRS---DSFESLLSNLKTKRYTQTYIQRVLMNVLLN
TMCAL_STAEQ      QPKESLHSIYTINEGFENRLQTMIHRS---DSFESLLSNLNTKRYTQTYIQRVLMNVLLN
TMCAL_STAS1      QDATSLAQIYTMSEGIENRILQTIEQA---TSFEHLMTLLKTKRYTYTHIQRLLMNILLN
TMCAL_STAHJ      RSSEELSHIYTMSEGFEHRLKSNIQNA---QDFDTYMSLIKTKRFTYTHIQRVLMQILLN
TMCAL_LACLM      D--DHLENIFQVNQELSVRLKNAIKSA---KNFDELVELVYTKRYTKARVRRLLTYILLN
TMCAL_LACLS      D--DHLENIFQVNQELSVRLKNAVKSA---KNFDELVELVYTKRYTKARVRRLLTYILLN
TMCAL_LACLA      D--EHLENIFQVNQELSVRLKKAVKSA---KNFDELVEQVYTKRYTKARVRRLLTYILLN
TMCAL_STRA5      H--SDLTQIYQVNEEIANRIKSQIRYV---ETVDELVDKVATKRYTKARIRRLLTYILIN
TMCAL_STRA1      H--SDLTQIYQVNEEIANRIKSQIRYV---ETVDELVDKVATKRYTKARIRRLLTYILIN
TMCAL_STRA3      H--SDLTQIYQVNEEIANRIKSQIRYV---ETVDELVDKVATKRYTKARIRRLLTYILIN
TMCAL_STRT2      N--PDLTSVFQVNEEIASRLKAAVREI---SSVEELVDKVATKRYTKARVRRILTYILVG
TMCAL_STRTD      N--PDLTSVFQVNEEIASRLKAAVREI---SSVEELVDKVATKRYTKARVRRILTYILVG
TMCAL_STRT1      N--PDLTSVFQVNEEIASRLKAAVREI---SSVEELVDKVATKRYTKARVRRILTYILVG
TMCAL_STRMU      Q--PDLTQLFQVNEELAIRIKKAIRQV---TSFDQLVETVATKRYTKARVRRILIYILIG
TMCAL_STRR6      N--PDLTTIYQVNQEMAVRIKEAIKTA---QSVEELVELVTTKRYTKARVRRLLTYILMQ
TMCAL_STRP2      N--PDLTTIYQVNQEMAVRIKEAIKTA---QSVEELVELVTTKRYTKARVRRLLTYILMQ
TMCAL_STRPN      N--PDLTTIYQVNQEMAVRIKEAIKTA---QSVEELVELVTTKRYTKARVRRLLTYILMQ
TMCAL_STRSV      C--PDLTNFYQVNQELAVRIRVALKSS---ETIEELVEQVATKRYTKARVRRLLTYILVG
TMCAL_STRS2      H--PDLSQVFQVNEELASRIRSAIGSV---ATVEELVEAVTTKRYTKARVRRVLTYILIN
TMCAL_STRP8      H--SDLTSIFQVNDELASRIKKAIKVS---QNIDHLVDTVATKRYTKARVRRILTYILVN
TMCAL_STRP3      H--SDLTSIFQVNDELASRIKKAIKVS---QNIDHLVDTVATKRYTKARVRRILTYILVN
TMCAL_STRPB      H--SDLTSIFQVNDELASRIKKAIKVS---QNIDHLVDTVATKRYTKARVRRILTYILVN
TMCAL_STRPC      H--SDLTSIFQVNDELASRIKKAIKVS---QNIDHLVDTVATKRYTKARVRRILTYILVN
TMCAL_STRP1      H--SDLTSIFQVNDELASRIKKAIKVS---QNIDHLVDTVATKRYTKARVRRILTYILVN
TMCAL_STRP6      H--SDLTSIFQVNDELASRIKKAIKVS---QNIDHLVDTVATKRYTKARVRRILTYILVN
TMCAL_STRPM      H--SDLTSIFQVNDELASRIKKAIKVS---QNIDHLVDTVATKRYTKARVRRILTYILVN
TMCAL_STRPD      H--SDLTSIFQVNDELASRIKKAIKVS---QNIDHLVDTVATKRYTKARVRRILTYILVN
TMCAL_STRPF      H--SDLTSIFQVNDELASRIKKAIKVS---QNIDHLVDTVATKRYTKARVRRILIYILVN
TMCAL_STRPG      H--SDLTSIFQVNDELASRIKKAIKVS---QNIDHLVDTVATKRYTKARVRRILIYILVN
TMCAL_LACDB      ASIKELQQIYQMSEGLEYKFKAEIHLA---ENFADFLRRVKSKRYTYSRLRRLSLYTLLN
TMCAL_LACDA      ASIKELQQIYQMSEGLEYKFKAEIHLA---ENFADFLRRVKSKRYTYSRLRRLSLYTLLN
TMCAL_LACAC      SSIEDLRRIYQMSEGLEYKMKQEIHLA---RDFTEFLRRIKSKRYTYARLRRLSLYTLLN
TMCAL_LACJO      ASLEELQSIYQMSEGLEYKMKEEIHTA---EDFTSFLRQIKSKRYTYARLRRLCLYTLLN
TMCAL_LACGA      ASLEELRSIYQMSEGLEYKMKEEIHNA---EDFTSFLRQIKSKRYTYARLRRLCLYTLLN
TMCAL_LACSS      LSLAQLRQVYQMSEGLEYRFKKVIHKA---NSYTELLQALKTKRYTYARLQRVCLYVLLN
TMCAL_LACP3      AELNELRLVATMAEGLEYRFTQKIDDA---QDMTAFLKQVKSKRYTYARLRRLALAITLN
TMCAL_LACBA      APVTDMRQRYQITEGVEYRLKRAALEA---TTFADFMRIVKTKRYTYTRLQRQAAYLLLQ
TMCAL_LACPL      VDVARSGQYDQMAEGLEYRMQAMAQHA---TTFDDFIHQVKSKRYTYTRLQRVATAALLQ
TMCAL_LEUMM      DTVGQLGQIYQMAEGLEHRFAKTALNDSGPQSYQSFIKSTKSKRYTFTRIQRTLLYTLLN
TMCAL_OENOB      DGLGQIRSIYQVNEGMEYLIKQAIEKN--PSDFGELLALIKSKRYTFARLHRVLVYILLN
TMCAL_LACS1      SDIDELANIYGMAEGIQYRMKKKALELKVEATFDEWLKAVKSKRFTYTRLTRLSVATLVG
TMCAL_ENTFA      SSLEELQAIYQMTEGLEYRLKDQIQAA---GSFHELMERMKTKRYTWTRLQRLATYILLN
TMCAL_PEDPA      STPQELRHIKGVTEGFENRILNLVDKS---NSFTELMQKLKTKRYTYTRIQRSLTNILLN
TMCAL_MYCH2      TSAENLAKIWLISEGIENLFKKHINE----PNFEKFLNAVNSRRYTNSRIKRAMVYILFR
TMCAL_MYCH7      TSAENLAKIWLISEGIENLFKKHINE----PNFEKFLNAVNSRRYTNSRIKRAMVYILFR
TMCAL_MYCHJ      TSPENLAKIWLISEGIENLFKKHINE----PNFEKFLNAVNSRRYTNSRIKRAMVYILFR
TMCAL_MYCPU      KTAQELRQFKLVSEGIENLFKKHINE----KSYDDFVAKVNSKRYTSSRIKRIILYILLG
TMCAL_MYCMO      TSKEELAKISLISEGLENRFKKIVLEA---QDYDSFVNKANSKRYTSSRIKRIMLYILLD
TMCAL_MYCS5      TPASKLKKYLLVDEGIENLFKKNILLF---DNYHDFIDACVSRRYTRSKIMRTYLCILLK
TMCAL_FUSNN      KNCSELKNIQDLEIGLENRLYKYSLEN---LKFEDFFNEVLTKRITISRLQRILLHSLFN
                                .                          :: : : : :        

TMCAL_CLOAB      FDCYNTESLRN---SPCPYARILGFNEKGKYALKEF--------KKTSSIPLITKVNNYN
TMCAL_CLONN      MENFNLEYLRT---KKSPYGRVLGFNDTGRKILKEM--------KKKSSIPIYMKLPKTL
TMCAL_CLOTE      MDMINSDELRR---KPCPYARILGFNRKGQDILKLI--------KKSSNIPIINKIPKKI
TMCAL_CLOPE      VNK-DLLSLRK---SSPNYVRILGFNNKGREILKEI--------KKNSEINIVNKLSKAK
TMCAL_CLOP1      VNK-DLLSLRK---SSPNYVRILGFNNKGREILKEI--------KKNSEINIVNKLSKAK
TMCAL_CLOPS      VNK-DLLSLRK---YSPNYVRILGFNNKGREILKEI--------KKNSEINIVNKLSKAK
TMCAL_CLOD6      IKKSDMQLIKNI--DTIPYIRILAFNDKGREILKEI--------KNKSEIKIINKFSNIS
TMCAL_CALS4      IDKK---LFKEF--DGPNYIRVLGFSEKGKTILKEI--------KKKTELPIITKVAQYK
TMCAL_HUNT2      VTSKDLDMLSRF--DSPQYARILGFNSKGKQLLSQI--------KKKSSIPLVLKLSDFI
TMCAL_THEMA      VNK-EFVEKSNT--KGPQYIRILGFTEKGREILSLM--------RKKAKLPIVTNMSLYR
TMCAL_SYNWW      LSK-NQVELYDQ--HGPQYLHILGFSAKGQEILQKI--------KIKSKLKIFSRGSEMK
TMCAL_PELCD      VRGDLMASLLA---AGPLYLRLLGSSPRGRAFLGAA--------RKRRRLPMVTNLSRIY
TMCAL_BACSU      TKKQDMQKLLDNDK--APYIRLLGMTKKGQAYLSEK--------KKALSVPLVSKLS---
TMCAL_BACLD      TKKADVKRMLNETH--PAYIRLLGMTKKGQAYLAEK--------KKSLSAPLITKTG---
TMCAL_BACAN      TTKEEIYCANIEQH--APYIRLLGMSQKGQTYLSKN--------KKKIELPILTHTK---
TMCAL_BACHK      TTKEEIYCANIEQH--APYIRLLGMSQKGQTYLSKN--------KKKIELPILTHTK---
TMCAL_BACCZ      TTKEEIHCANIEQH--APYIRLLGMSQKGQTYLSKN--------KKKIELPILTHTK---
TMCAL_BACAH      TTKEEIHCANIEQH--APYIRLLGMSQKGQTYLSKN--------KKKIELPILTHTK---
TMCAL_BACC1      TTKEEIHCANIEQH--APYIRLLGMSQKGQTYLSKN--------KKKIELPILTHTK---
TMCAL_BACCR      TTKEDIRSANIEQH--APYIRLLGMSQKGQTYLSKN--------KKKIELPILTHTK---
TMCAL_BACHD      TTKEEIHSVLPRGTESLPYIRLLGMTSRGQMYLNGK--------KKQLTTPVITRPA---
TMCAL_BACSK      TTAEENAAIQQSGP---AYIRLLGMSETGKTYIREN--------KKTFSLPIVTRQGEL-
TMCAL_GEOKA      FTKEEQAKAANPTY-----IRLLGMSEAGRRYLKQV--------KKSAALPLVARASK--
TMCAL_GEOTN      FTKEEQNKAAAPTY-----IRLLGMNETGRRYLQQV--------KKELALPLIAKAAK--
TMCAL_OCEIH      TKKDE--NYVDESP---SYIRILGMNKQGQQYLNYH--------KKNFDVPIITSIA---
TMCAL_LISIN      A------QNTPPAE---PYIRVLGMSKTGQKYLSLH--------KKNISLPIVTTVS---
TMCAL_LISW6      A------RNIPSA----PYIRILGMNKTGQKYLSHH--------KKNISLPIVTTVS---
TMCAL_LISMO      A------KSKASS----PYIRILGMNKTGQKYLSLH--------KKNISLPIVTTVS---
TMCAL_LISMF      A------RSQTSS----PYIRILGMNKTGQQYLSLH--------KKNISLPIITTVS---
TMCAL_STAA8      IKPTDVTSNIHAVK-------VLAMNDRGRQYLKHL--------KTAFPERQYITNIN--
TMCAL_STAA3      IKPTDVTSNIHAVK-------VLAMNDRGRQYLKHL--------KTAFPERQYITNIN--
TMCAL_STAAN      IKPTDVTSNIHAVK-------VLAMNDRGRQYLKHL--------KTAFPERQYITNIN--
TMCAL_STAAC      IKPTDVTSNIHAVK-------VLAMNDRGRQYLKHL--------KTAFPERQYITNIN--
TMCAL_STAAS      IKPTDVTSNIHAVK-------VLAMNDRGRQYLKHL--------KTAFPERQYITNIN--
TMCAL_STAAM      IKPTDVTSNIHAVK-------VLAMNDRGRQYLKHL--------KTAFPERQYITNIN--
TMCAL_STAAW      IKPTDVTSNIHAVK-------VLAMNDRGRQYLKHL--------KTAFPERQYITNIN--
TMCAL_STAAR      IKPTDVTRNIHAVK-------VLAMNDRGRQYLKHL--------KTVFPERQYITNIN--
TMCAL_STAAB      IKPTDVTRNIRAVK-------VLAMNDRGRQYLKHL--------KTAFPERQYITNIN--
TMCAL_STAES      ITKDDVNKEINAVR-------VLGMSEKGRSYLKYL--------KANYPNRHYITNVN--
TMCAL_STAEQ      ITKDDVNKEINAVR-------VLGMSEKGRSYLKYL--------KANYPNRHYITNVN--
TMCAL_STAS1      FKKHDEPASINAVR-------ILGMSERGQQYLKQI--------KKSFPERNFVTQVN--
TMCAL_STAHJ      INKSDFDDEIRGVR-------ILGMNQRGQQYLKYL--------KKQFPNRLYVTNIN--
TMCAL_LACLM      IPKEF---------NLPKEIHILGFSKAGQEILAQN--------RGK----IISKIGQK-
TMCAL_LACLS      IPKEF---------NLPKEIHILGFSKAGQEILAQN--------RGK----IISKIGQK-
TMCAL_LACLA      IPKQF---------DLPEQIHVLGFSKTGQEILAQN--------RGK----IISKIGQN-
TMCAL_STRA5      AVES----------PIPNAIHVLGFTQKGQQHLKSV--------KKSV--DIVTRIGSQ-
TMCAL_STRA1      AVES----------PIPNAIHVLGFTQKGQQHLKSV--------KKSV--DIVTRIGSQ-
TMCAL_STRA3      AVES----------PIPNAIHVLGFTQKGQQHLKSV--------KKSV--DIVTRIGSQ-
TMCAL_STRT2      AVDN----------SLPKSIHVLGFSQKGQFHLKSV--------KKSV--DIVARIGRK-
TMCAL_STRTD      AVDN----------SLPKSIHVLGFSQKGQFHLKSV--------KKSV--DIVARIGRK-
TMCAL_STRT1      AVDN----------SLPKSIHVLGFSQKGQFHLKSV--------KKSV--DIVARIGRK-
TMCAL_STRMU      ARET----------SLPQDVHILGFTAAGRTHLSHI--------KNKT--RIISRIGSQ-
TMCAL_STRR6      ARES----------DLPEAIHVLGFTEKGRQHLKSL--------KGQV--SLVSRIGKE-
TMCAL_STRP2      ARES----------DLPEAIHVLGFTEKGRQHLKSL--------KGQV--SLVSRIGKE-
TMCAL_STRPN      ARES----------DLPEAIHVLGFTEKGRQHLKSL--------KGQV--SLVSRIGKE-
TMCAL_STRSV      ARQE----------ELPSGVHILGFSEQGRQHLSQL--------KGKV--ELVSRIGKD-
TMCAL_STRS2      AVET----------PLPDAVHVLGFSARGQAYLKQV--------KERV--GLVTRIGKE-
TMCAL_STRP8      AKEP----------TLPKGIHILGFTSKGQAHLKKL--------KKSR--PLITRIGAE-
TMCAL_STRP3      AKEP----------TLPKGIHILGFTSKGQAHLKKL--------KKSR--PLITRIGAE-
TMCAL_STRPB      AKEP----------TLPKGIHILGFTSKGQAHLKKL--------KKSR--PLITRIGAE-
TMCAL_STRPC      AKEP----------TLPKGIHILGFTSKGQAHLKKL--------KKSR--PLITRIGAE-
TMCAL_STRP1      AKEP----------TLPKGIHILGFTSKGQAHLKKL--------KKSR--PLITRIGAE-
TMCAL_STRP6      AKEP----------TLPKGIHILGFTSKGQAHLKKL--------KKSR--PLITRIGAE-
TMCAL_STRPM      AKEP----------TLPKGIHILGFTSKGQAHLKKL--------KKSR--PLITRIGAE-
TMCAL_STRPD      AKEP----------TLPKGIHILGFTSKGQAHLKKL--------KKSR--PLITRIGAE-
TMCAL_STRPF      AKEP----------TLPKGIHILGFTSKGQAHLKKL--------KKSR--PLITRIGAE-
TMCAL_STRPG      AKEP----------TLPKGIHILGFTSKGQAHLKKL--------KKSR--PLITRIGAE-
TMCAL_LACDB      VTEADV-----LNSYDHVSTMLLAYSKRGRKYLKQQ--------RKDFEIDIVSKVDRK-
TMCAL_LACDA      VTEADV-----LNSYDHVSTMLLAYSKRGRKYLKQQ--------RKDFEIDIVSKVDRK-
TMCAL_LACAC      VTYDDM-----LDSFNHESLMLLGFSKKGRQYLKQN--------RKNIQTEIISKVDKR-
TMCAL_LACJO      VTENEI-----KDSYQDVSTLLLGYSSRGRNYLKKI--------RKDVQVPIISKVDKK-
TMCAL_LACGA      VTEKEM-----QASYQDVSTLLLGYNSRGRNYLKKI--------RKDVELPIISKVDKK-
TMCAL_LACSS      IQPADI-----QQGLQRTYIRLLGFNEIGQQHLHQL--------KKTTDLPIISKVSAKM
TMCAL_LACP3      MTATAV-----NQARQHPQLHVLGFTPTGRQYLNSV--------KHDLDWPLLTKVSADM
TMCAL_LACBA      ALPEEM-----RPQP--QYLRVLGYSKQGQAYLHQI--------KKHVALPLVSRANRD-
TMCAL_LACPL      LTQAEV-----QKAQAHNYLRVLGFTPKGQAYLHQV--------KKQLPLPLYTKINQD-
TMCAL_LEUMM      IKVDQM-----QAAMQDPYLRILGFTSTGQQYLNEI--------KKQVTLPLISKVDSS-
TMCAL_OENOB      IKVDQM-----NLAMQNPYHRLLGFTEKGRQYLHEK--------KGRFNFPTISHVDQK-
TMCAL_LACS1      MKVNDV-----SLYNKFPYVHLLGFTKNGQKALNIM--------KKNSEIPLLAKISQQ-
TMCAL_ENTFA      MTKEEV-----ETVWQNSYLHVLGFTPKGQAYLKET--------KAQIQLPVISKVSKE-
TMCAL_PEDPA      IQATP---------FNLTKTRLLATNQLGRIFIREA--------ALGS--VVMTKVTKE-
TMCAL_MYCH2      IEDPSQ----FDEEKIQLDCWKNQGF----------------------------------
TMCAL_MYCH7      IEDPSQ----FDEEKIQLDCWKNQGF----------------------------------
TMCAL_MYCHJ      IEDPSQ----FDEEKIQLDCWKNQGF----------------------------------
TMCAL_MYCPU      IKN---------------------------------------------------------
TMCAL_MYCMO      IKK---------------------------------------------------------
TMCAL_MYCS5      IKK---------------------------------------------------------
TMCAL_FUSNN      LTENIT----EKVKNEVPFVKILGFSTKGQKYLNYLKKSKNYNERKILTSN---------
                                                                             

TMCAL_CLOAB      FD-----------------ALSLDINATKAYSLINKS-------VNPLDDYYRKIIIV--
TMCAL_CLONN      ND-----------------TLKLDIQSTYAYSMINKS-------VSYDSDFKTSPIYLK-
TMCAL_CLOTE      DS-----------------TLNLDINATKCYSLLNKK-------VNPLDDFLKKPVLK--
TMCAL_CLOPE      ADP----------------LLEFDIKATNIYSFLNPS-------VKINSDYLISPIIFR-
TMCAL_CLOP1      SDS----------------LLEFDIKATNIYSFLNPS-------VKINSDYLISPIIFR-
TMCAL_CLOPS      TDP----------------LLEFDIKATNIYSFLNPS-------VKINSDYLISPIIFR-
TMCAL_CLOD6      FSLDDTIF---------KTLISYDIKATNIYNSIYYKNNKDL--VKGPMDFYTHPIYVK-
TMCAL_CALS4      SKIED------------SRMFERDLFATDVYTLAYKNF--AI--SK--LDFFHPIIKL--
TMCAL_HUNT2      KSCDPVL----------KRKLELEILATDLYVMCYKNP--AF--RKAGQEFTQNIIIM--
TMCAL_THEMA      KVLEKTDLP--VDKQLFLEQIDLDVKATNFYSMFFPSV--EQ--RCGERDFSIHPIFLRT
TMCAL_SYNWW      QARDKNP------GTALAEMIKLDCQATDVYSLLFPNP--AT--RRAGRDFTTSPVPGT-
TMCAL_PELCD      SQLKRTYGPRSEDYRLALAMLELDLRATRNYSLLLPGW--SG--VSRERDFFEAPLDIHS
TMCAL_BACSU      SFSH--------------PALDLDVKASRIYSLPIEEPL---RTEFDLQEYGHAPIRYDE
TMCAL_BACLD      SFSH--------------PSLQLDIKAGQVYSAPLKEPV---RTMLTEQEYSLSPIRYDE
TMCAL_BACAN      TFDH--------------PTLHIERKANSVYFSIMKEPL---RTQLLKRDATHHPIRYDE
TMCAL_BACHK      TFDH--------------PTLHIERKANSVYFSIMKEPL---RTQLLKRDATHHPIRYDE
TMCAL_BACCZ      TFDH--------------PTLHIERKANSVYFSIMKEPL---RTQLLKRDATHHPIRYDE
TMCAL_BACAH      TFDH--------------PTLHIERKANSVYFSIMKEPL---RTQLLKRDATHHPIRYDE
TMCAL_BACC1      TFDH--------------PTLHIDRKANSVYFSIIQEPL---RTQLLKQDATHHPIRYDE
TMCAL_BACCR      TFDH--------------VALDIEKKANSVYFSIMHEPL---RTQLLKQDITHHPIRYDE
TMCAL_BACHD      KVDD--------------RMMNLDLRAAFSYYASFPPSL---QQKRLKEEFHRTPIRIDH
TMCAL_BACSK      RRYG--------------QAGEQELRISQCYWLPLPPQA---LKQEVTREFQQKPINWEK
TMCAL_GEOKA      LNGD--------------SLYEQEKRAAAVYAAAFPEPL---YSAALKEEYATAPIYVSG
TMCAL_GEOTN      LNGD--------------PLYEQEKRATAVYTAAFPEPL---YSAALKEEYATAPIYFSG
TMCAL_OCEIH      NTTH--------------SMLAIEERATKAYYSIIPAKL---QRKMFKQELQGPIII---
TMCAL_LISIN      KAEP--------------SLLKEDLRATDIYTLINGLED---YQA---GDFHTPPILTL-
TMCAL_LISW6      KAAP--------------GLLEEDLRATNIYTLVKGLEN---YQA---GDFHIPPILKSQ
TMCAL_LISMO      KAPP--------------GLLEEELRATNIYTLVKKLEN---YQA---GDFHIPPILTL-
TMCAL_LISMF      KAPA--------------GLLEEELRATNIYTLAKGLEN---YQA---GDFHIPPILTL-
TMCAL_STAA8      KSNA--------------HYFTNEIKATHIYNAISGQQ---------QTDFNTPVIQQYR
TMCAL_STAA3      KSNA--------------HYFTNEIKATHIYNAISGQQ---------QTDFNTPVIQQYR
TMCAL_STAAN      KSNA--------------HYFTNEIKATHIYNAISGQQ---------QTDFNTPVIQQYR
TMCAL_STAAC      KSNA--------------HYFTNEIKATHIYNAISGQQ---------QTDFNTPVIQQYR
TMCAL_STAAS      KSNA--------------HYFTNEIKATHIYNAISGQQ---------QTDFNTPVIQQYR
TMCAL_STAAM      KSNA--------------HYFTNEIKATHIYNAISGQQ---------QTDFNTPVIQQYR
TMCAL_STAAW      KSNA--------------HYFTNEIKATHIYNAISGQQ---------QTDFNTPVIQQYR
TMCAL_STAAR      KSNA--------------HYFTNEIKATHIYNAISGQQ---------QTDFNTPVIQQYR
TMCAL_STAAB      KSNA--------------HYFTNEIKATHIYNAISGQQ---------QTDFNTPVIQQYR
TMCAL_STAES      QKTA--------------HYFKNEIKATHVYNLLSNQS---------QTDFNTPLVRI--
TMCAL_STAEQ      QKTA--------------HYFKNEIKATHVYNLLSNQS---------QTDFNTPLVRI--
TMCAL_STAS1      KQNA--------------NLFTNEIHATKIYNLISGQT---------ANDFNTPVIRI--
TMCAL_STAHJ      KESA--------------SLLKNEIKATHIYNLISGQR---------ANDFNTPVIINKK
TMCAL_LACLM      ------------------PWDELTQKADEIYQLGNVDFK--------EQNFGRKPIIKRE
TMCAL_LACLS      ------------------PWDELTQKADEIYQLGNVDFK--------EQNFGRKPIIKRE
TMCAL_LACLA      ------------------PWDNLTQKADEIYQLGNVQFE--------EQNFGRKPIRSSI
TMCAL_STRA5      ------------------TWDSLTQRADSVYQMGNANIA--------EQTWGRIPFYQPV
TMCAL_STRA1      ------------------TWDSLTQRADSVYQMGNANIA--------EQTWGRIPFYQPV
TMCAL_STRA3      ------------------TWDSLTQRADSVYQMGNANIA--------EQTWGRIPFHQSV
TMCAL_STRT2      ------------------PWDMLTQQADNVYQLGNPELC--------EQNFGRVPIRVK-
TMCAL_STRTD      ------------------PWDMLTQQADNVYQLGNPELC--------EQNFGRVPIRVK-
TMCAL_STRT1      ------------------PWDMLTQQADNVYQLGNPELC--------EQNFGRVPIRVK-
TMCAL_STRMU      ------------------PWDALTQQADQVYQLGNPKIA--------EQTWGRVPIRIDN
TMCAL_STRR6      ------------------PWDAMTQKVDQIYQLGKPSIA--------EQNFGRVPIRIET
TMCAL_STRP2      ------------------PWDAMTQKVDQIYQLGKPSIA--------EQNFGRVPIRIET
TMCAL_STRPN      ------------------PWDAMTQKADQIYQLGKPSIA--------EQNFGRVPIRIET
TMCAL_STRSV      ------------------PWDSLTQQADKVYQLGNPALR--------EQNFGRVPIMKGK
TMCAL_STRS2      ------------------PWDSLTQQADLVYQLGADAMA--------EQTYGRVPVRVE-
TMCAL_STRP8      ------------------TWDEMTQKADSIYQLGHQDIP--------EQSFGRIPIIIKN
TMCAL_STRP3      ------------------TWDEMTQKADSIYQLGHQDIP--------EQSFGRIPIIIKN
TMCAL_STRPB      ------------------TWDEMTQKADSIYQLGHQDIP--------EQSFGRIPIIIKN
TMCAL_STRPC      ------------------TWDEMTQKADSIYQLGHQDIP--------EQSFGRIPIIIKN
TMCAL_STRP1      ------------------TWDEMTQKADSIYQLGHQDIP--------EQSFGRIPIIIKN
TMCAL_STRP6      ------------------TWDEMTQKADSIYQLGHQDIP--------EQSFGRIPIIIKN
TMCAL_STRPM      ------------------TWDEMTQKADSIYQLGHQDIP--------EQSFGRIPIIIKN
TMCAL_STRPD      ------------------TWDEMTQKADSIYQLGHQDIP--------EQSFGRIPIIIKN
TMCAL_STRPF      ------------------TWDEMTQKADSIYQLGHQDIP--------EQSFGRIPIIIKK
TMCAL_STRPG      ------------------TWDEMTQKADSIYQLGHQDIP--------EQSFGRIPIIIKN
TMCAL_LACDB      NAQE--------------GTLGLQVRVDRLFEQIVGADQ----------NFGRRPLEVN-
TMCAL_LACDA      NAQE--------------GTLGLKVRVDRLFEQIVGADQ----------NFGRRPLEVN-
TMCAL_LACAC      SAKS--------------GSLALQVRTDRLFEQVMGVDQ----------NFGQRPIEV--
TMCAL_LACJO      NAAS--------------GTLGLQVKVDRLFEQIIGEDQ----------NFGRKPIEVK-
TMCAL_LACGA      NAAS--------------GTLGLQVRVDRLFEQIMGEDQ----------NFGRRPIEVK-
TMCAL_LACSS      GAET--------------GLLGLEVRVDRLCEQFGWQSQ----------NFARQPIFYHG
TMCAL_LACP3      LAPD--------------GVLAMTHRADRLITTIGGVEQ----------NYGRRPLM---
TMCAL_LACBA      -WQK--------------GVGSLDDRLGALRTLVTGIPQ----------DYGRIPIKKPD
TMCAL_LACPL      -LRQ--------------HALNLDYRAGRVYQLINGQSQ----------DLYRQPWRLPV
TMCAL_LEUMM      -LAK--------------SNLRLDYKAGKVWQLLANEGA---P----TQDVTRMPLYWEK
TMCAL_OENOB      -TAN--------------KSLAIDYKAGLVYNQIMDYKS--------TQDIKRTPIQS--
TMCAL_LACS1      -DKD--------------DFYHVDYRAGKIYQSQNYKEQ----------DLKRAPLIF--
TMCAL_ENTFA      --NR--------------AMLSLDIRANQLYQMGDSSLK--------EQNFGRFPLRFSP
TMCAL_PEDPA      -DFE--------------NNYAITKRADDLYQLVSPYQW---G----KGPIIKKNVKE--
TMCAL_MYCH2      ------------------------------------------------------------
TMCAL_MYCH7      ------------------------------------------------------------
TMCAL_MYCHJ      ------------------------------------------------------------
TMCAL_MYCPU      ------------------------------------------------------------
TMCAL_MYCMO      ------------------------------------------------------------
TMCAL_MYCS5      ------------------------------------------------------------
TMCAL_FUSNN      ------------------RNLKEILNEEEAKLFNFNELCSQIYRIKSSYINIGYPIIKKD
                                                                             

TMCAL_CLOAB      --------
TMCAL_CLONN      --------
TMCAL_CLOTE      --------
TMCAL_CLOPE      --------
TMCAL_CLOP1      --------
TMCAL_CLOPS      --------
TMCAL_CLOD6      --------
TMCAL_CALS4      --------
TMCAL_HUNT2      --------
TMCAL_THEMA      EM------
TMCAL_SYNWW      --------
TMCAL_PELCD      AI------
TMCAL_BACSU      DEQHFLNV
TMCAL_BACLD      DSRIFLRK
TMCAL_BACAN      TTAKFL--
TMCAL_BACHK      TTAKFL--
TMCAL_BACCZ      TTAKFL--
TMCAL_BACAH      TTAKFL--
TMCAL_BACC1      TTAKFL--
TMCAL_BACCR      TTTKFL--
TMCAL_BACHD      KPEPKKEA
TMCAL_BACSK      RS------
TMCAL_GEOKA      IERK----
TMCAL_GEOTN      MERK----
TMCAL_OCEIH      --------
TMCAL_LISIN      --------
TMCAL_LISW6      T-------
TMCAL_LISMO      --------
TMCAL_LISMF      --------
TMCAL_STAA8      --------
TMCAL_STAA3      --------
TMCAL_STAAN      --------
TMCAL_STAAC      --------
TMCAL_STAAS      --------
TMCAL_STAAM      --------
TMCAL_STAAW      --------
TMCAL_STAAR      --------
TMCAL_STAAB      --------
TMCAL_STAES      --------
TMCAL_STAEQ      --------
TMCAL_STAS1      --------
TMCAL_STAHJ      N-------
TMCAL_LACLM      K-------
TMCAL_LACLS      K-------
TMCAL_LACLA      R-------
TMCAL_STRA5      SQSDL---
TMCAL_STRA1      SQSDL---
TMCAL_STRA3      SQSDL---
TMCAL_STRT2      --------
TMCAL_STRTD      --------
TMCAL_STRT1      --------
TMCAL_STRMU      TV------
TMCAL_STRR6      N-------
TMCAL_STRP2      N-------
TMCAL_STRPN      N-------
TMCAL_STRSV      --------
TMCAL_STRS2      --------
TMCAL_STRP8      ERLN----
TMCAL_STRP3      ERLN----
TMCAL_STRPB      ERLN----
TMCAL_STRPC      ERLN----
TMCAL_STRP1      ERLN----
TMCAL_STRP6      ERLN----
TMCAL_STRPM      ERLN----
TMCAL_STRPD      ERLN----
TMCAL_STRPF      ERLN----
TMCAL_STRPG      ERLN----
TMCAL_LACDB      --------
TMCAL_LACDA      --------
TMCAL_LACAC      --------
TMCAL_LACJO      --------
TMCAL_LACGA      --------
TMCAL_LACSS      KDEAHC--
TMCAL_LACP3      --------
TMCAL_LACBA      SE------
TMCAL_LACPL      TIG-----
TMCAL_LEUMM      --------
TMCAL_OENOB      --------
TMCAL_LACS1      --------
TMCAL_ENTFA      DT------
TMCAL_PEDPA      --------
TMCAL_MYCH2      --------
TMCAL_MYCH7      --------
TMCAL_MYCHJ      --------
TMCAL_MYCPU      --------
TMCAL_MYCMO      --------
TMCAL_MYCS5      --------
TMCAL_FUSNN      --------