CLUSTAL format seed alignment for MF_01540

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CYSI_ECOLC       -----------------------------MSE--KHPGPLVVEGKLTDAERMKLESNYLR
CYSI_SHIB3       -----------------------------MSE--KHPGPLVVEGKLTDAERMKLESNYLR
CYSI_ECO55       -----------------------------MSE--KHPGPLVVEGKLTDAERMKLESNYLR
CYSI_ECOSE       -----------------------------MSE--KHPGPLVVEGKLTDAERMKLESNYLR
CYSI_ECOLU       -----------------------------MSE--KHPGPLVVEGKLTDAERMKLESNYLR
CYSI_ECO5E       -----------------------------MSE--KHPGPLVVEGKLTDAERMKLESNYLR
CYSI_ECO57       -----------------------------MSE--KHPGPLVVEGKLTDAERMKLESNYLR
CYSI_ECO24       -----------------------------MSE--KHPGPLVVEGKLTDAERMKLESNYLR
CYSI_ECO8A       -----------------------------MSE--KHPGPLVVEGKLTDAERMKLESNYLR
CYSI_SHISS       -----------------------------MSE--KHPGPLVVEGKLTDAERMKLESNYLR
CYSI_SHIBS       -----------------------------MSE--KHPGPLVVEGKLTDAERMKLESNYLR
CYSI_SHIDS       -----------------------------MSE--KHPGPLVVEGKLTDAERMKLESNYLR
CYSI_ECOL6       -----------------------------MSE--KHPGPLVVEGKLTDAERMKLESNYLR
CYSI_ECOBW       -----------------------------MSE--KHPGPLVVEGKLTDAERMKHESNYLR
CYSI_ECOLI       -----------------------------MSE--KHPGPLVVEGKLTDAERMKHESNYLR
CYSI_ECOBR       -----------------------------MSE--KHPGPLVVEGKLTDAERMKLESNYLR
CYSI_ECOK1       -----------------------------MSE--KHPGPLVVEGKLTDAERMKLESNYLR
CYSI_ECO81       -----------------------------MSE--KHPGPLVVEGKLTDAERMKLESNYLR
CYSI_ECO45       -----------------------------MSE--KHPGPLVVEGKLTDAERMKLESNYLR
CYSI_ECOUT       -----------------------------MSE--KHPGPLVVEGKLTDAERMKLESNYLR
CYSI_ECOL5       -----------------------------MSE--KHPGPLVVEGKLTDAERMKLESNYLR
CYSI_ECO27       -----------------------------MSE--KHPGPLVVEGKLTDAERMKLESNYLR
CYSI_SHIFL       -----------------------------MSE--KHPGPLVVEGKLTDAERMKLESNYLR
CYSI_SHIF8       -----------------------------MSE--KHPGPLVVEGKLTDAERMKLESNYLR
CYSI_ECOSM       -----------------------------MSE--KHPGPLVVEGKLTDAERMKLESNYLR
CYSI_ECOHS       -----------------------------MSE--KHPGPLVVEGKLTDAERMKLESNYLR
CYSI_ECO7I       -----------------------------MNE--KHPGPLVVEGKLTDAERMKLESNYLR
CYSI_ESCF3       -----------------------------MNE--KHPGPLVVEGKLTDAERMKLESNYLR
CYSI_CITK8       -----------------------------MSE--KHPGPLVVEGKLADAERMKLESNYLR
CYSI_SALA4       -----------------------------MSE--KHPGPLVVEGKLSDAERMKLESNYLR
CYSI_SALTI       -----------------------------MSE--KYPGPLVVEGKLSDAERMKLESNYLR
CYSI_SALTY       -----------------------------MSE--KHPGPLVVEGKLSDAERMKLESNYLR
CYSI_SALCH       -----------------------------MSE--KHPGPLVVEGKLSDAERMKLESNYLR
CYSI_SALPC       -----------------------------MSE--KHPGPLVVEGKLSDAERMKLESNYLR
CYSI_SALNS       -----------------------------MSE--KHPGPLVVEGKLSDAERMKLESNYLR
CYSI_SALPA       -----------------------------MSE--KHPGPLVVEGKLSDAERMKRESNFLR
CYSI_SALPK       -----------------------------MSE--KHPGPLVVEGKLSDAERMKRESNFLR
CYSI_SALDC       -----------------------------MSE--KHPGPLVVEGKLSDAERMKLESNYLR
CYSI_SALG2       -----------------------------MSE--KHPGPLVVEGKLSDAERMKLESNYLR
CYSI_SALEP       -----------------------------MSE--KHPGPLVVEGKLSDAERMKLESNYLR
CYSI_SALHS       -----------------------------MSE--KHPGPLVVEGKLSDAERMKLESNYLR
CYSI_SALSV       -----------------------------MSE--KHPGPLVVEGKLSDAERMKLESNYLR
CYSI_SALPB       -----------------------------MSE--KHPGPLVVEGKLSDAERMKLESNYLR
CYSI_SALAR       -----------------------------MSE--KHPGPLVVEGKLSDAERMKRESNYLR
CYSI_ENT38       -----------------------------MSE--KHPGPLVVEGKLTDAERMKVDSNYLR
CYSI1_KLEP3      -----------------------------MSE--KHPGPLVVEGKLTDAERMKLESNYLR
CYSI_KLEP7       -----------------------------MSE--KHPGPLVVEGKLSDAERMKLESNYLR
CYSI_CROS8       -----------------------------MSE--KYPGPLVVEGKLSDAERMKRESNFLR
CYSI_ERWT9       ----------------------------MSDE--KYPGPLVVEGKLVDAERLKKQSNYLR
CYSI_PECAS       -----------------------MSEKYVFSE--KHPGPLVVEGKLTDAERMKTESNFLR
CYSI2_PECCP      -----------------------MSEKYVFSE--KHPGPLVVEGKLTDAERMKTESNFLR
CYSI_DICP7       -----------------------------MSE--RYSGPLVVEGKLADAERLKQESHYLR
CYSI_DICC1       -----------------------------MSE--RYSGPLVVEGKLADAERMKQESNYLR
CYSI_YERPE       -----------------------------MNE--KHPGPLVVSGKLSDGERMKSESNFLR
CYSI_YERPP       -----------------------------MNE--KHPGPLVVSGKLSDGERMKSESNFLR
CYSI_YERPA       -----------------------------MNE--KHPGPLVVSGKLSDGERMKSESNFLR
CYSI_YERPN       -----------------------------MNE--KHPGPLVVSGKLSDGERMKSESNFLR
CYSI_YERP3       -----------------------------MNE--KHPGPLVVSGKLSDGERMKSESNFLR
CYSI_YERPY       -----------------------------MNE--KHPGPLVVSGKLSDGERMKSESNFLR
CYSI_YERPS       -----------------------------MNE--KHPGPLVVSGKLSDGERMKSESNFLR
CYSI_YERPB       -----------------------------MNE--KHPGPLVVSGKLSDGERMKSESNFLR
CYSI_YERE8       -----------------------------MSE--KHPGPLVVTGKLSDGERMKSQSNFLR
CYSI_SERP5       -----------------------------MSD--KHPGPLVVEGKLADAERLKKESNFLR
CYSI_PHOLL       -----------------------------MND--KQHGPFIVEGKLADSERMKQESNFLR
CYSI_PROMH       -----------------------------MKS--QTQAPLVVEGKLSDSERMKKESNFLR
CYSI_BUCAI       ------------------------------MN--KKFKKIVTEKKLTDAERIKENSNYLR
CYSI_BUCA5       ------------------------------MN--KKFKKIVTEKKLTDAERIKENSNYLR
CYSI_BUCAT       ------------------------------MN--KKFKKIVTEKKLTDAERIKENSNYLR
CYSI_BUCAP       ------------------------------MK--KDYKKVFL--KNTKEERIKENSNYLR
CYSI_ZYMMO       -----------------------------MTQ--KHPQTLVVDAPLSDAERLKRESNFLR
CYSI_ACTPJ       -----------------------------MSD-KKIKGLEWQEKPLSDNERLKTDSNFLR
CYSI_ACTP2       -----------------------------MSD-KKIKGLEWQEKPLSDNERLKTDSNFLR
CYSI_ACTP7       -----------------------------MSD-KKTKGLEWQEKPLSDNERLKTDSNFLR
CYSI_ACTPL       -----------------------------MSD-KKIKGLEWQEKPLSDNERLKTDSNFLR
CYSI_ACTSZ       -----------------------------MTDSTKQKGLEWQKQGLSDNERLKAESNFLR
CYSI_MANSM       -----------------------------MSD-KKQKGLEWQDNPLSDNERLKEESNHLR
CYSI_NEIMB       -----------------------------MTVQTKTKGLAWQEKPLSDNERLKTESNFLR
CYSI_NEIM0       -----------------------------MTVQTKTKGLAWQEKPLSDNERLKTESNFLR
CYSI_NEIMF       -----------------------------MTVQTKTKGLAWQEKPLSDNERLKTESNFLR
CYSI_NEIMA       -----------------------------MTVQTKTKGLAWQEKPLSDNERLKTESNFLR
CYSI_AERHH       --------------------------------MSKQLIPGPVEGPLADNERLKRESDHLR
CYSI_TOLAT       --------------------------------MSEQ--------KLSDNERLKAESNFLR
CYSI_ALIF1       ---------------------------MSELIDVKTILSGTELGPLADNERLKRESKYLR
CYSI_ALIFM       ---------------------------MSELIDVKTILSGTELGPLADNERLKRESKHLR
CYSI_ALISL       ---------------------------MSEQIAVKTILSGTELGPLADNERLKRESKNLR
CYSI_VIBTL       ---------------------------MSKQVIEQEVL-GQVLGPLADNERLKRESKNLR
CYSI_VIBCB       --------------------------MSANQQSNSQEVLGEVLGPLSDNERLKRESNLLR
CYSI_VIBPA       --------------------------MTFSTENNKQIVLGEELGPLSDNERLKKQSNLLR
CYSI_VIBVU       --------------------------MTFSIENNKQVVLGEELGKLSDNERLKTQSNFLR
CYSI_VIBVY       --------------------------MTFSIENNKQVVLGEELGKLSDNERLKTQSNFLR
CYSI_VIBCH       --------------------------MSANQNPSVQEVLGEVLGPWSDNERLKRESHFLR
CYSI_VIBCM       --------------------------MSANQNPSVQEVLGEVLGPWSDNERLKRESHFLR
CYSI_VIBC3       --------------------------MSANQNPSVQEVLGEVLGPWSDNERLKRESHFLR
CYSI_PHOPR       ----------------------------------------MTEQKLSDNERLKRESNFLR
CYSI_ALTMD       --------------------------------MSNEKSPFIVEGKLADNERLKRESNNLR
CYSI_PSEA6       --------------------------------MTTDNK-FVVEGKLADNERLKGESNFLR
CYSI_PSEHT       ---------------------------------MSE---QDKNVKLSDNERMKRESNFLR
CYSI_SHEAM       ---------------------------MSQYPIKPE---LQVQGQLSDNERLKAESNHLR
CYSI_COLP3       ---------------------------MSNNFTKVENPVLIVEGKQADNERLKAESDYLR
CYSI_BAUCH       ------------------------------MNKKIPKA------ILSDNERLKVASNFLR
CYSI_SODGM       ------------------------------MSEQQPKA------KFSDNERLKGESRFLR
CYSI_BLOFL       -----------------------------MIMLKYNNK------LLSDNERIKKNSNFLR
CYSI_BLOPB       ------------------------------MNRKYDNNNDKNIPLLSDNERIKKESNFLR
CYSI2_KLEP3      ------------------------------MSND----------EFSDNERLKQQSQLLR
CYSI1_PECCP      ------------------------------MSDK----------KLSDNERLKTQSNYLR
CYSI_PSYIN       -----------------------------------------MSKKLHDNERIKIESNFLR
CYSI_SHEB5       ----------------------------------------MSEQKLALNEYLKTDSDYLR
CYSI_SHEB9       ----------------------------------------MSEQKLALNEYLKTDSDYLR
CYSI_SHEB2       ----------------------------------------MSEQKLALNEYLKTDSDYLR
CYSI_SHEB8       ----------------------------------------MSEQKLALNEYLKTDSDYLR
CYSI_SHEPC       ----------------------------------------MSEQKLALNEYLKTDSDYLR
CYSI_SHESW       ----------------------------------------MSEQKLALNEYLKTDSDYLR
CYSI_SHESA       ----------------------------------------MSEQKLALNEYLKTDSDYLR
CYSI_SHESR       ----------------------------------------MSEQKLALNEYLKTDSDYLR
CYSI_SHESM       ----------------------------------------MSEQKLALNEYLKTDSDYLR
CYSI_SHEON       ----------------------------------------MSEQKLALNEYLKTDSDYLR
CYSI_SHEDO       ----------------------------------------MSEQKLAVNEYLKTDSDYLR
CYSI_SHEFN       ----------------------------------------MSEQKLALNEYLKIDSDYLR
CYSI_SHEHH       ----------------------------------------MSEQKLAVNEYLKTDSDYLR
CYSI_SHEPA       ----------------------------------------MSEQKLAVNEYLKTDSDYLR
CYSI_SHEPW       ----------------------------------------MSEKKLAVNEYLKTDSDYLR
CYSI_SHESH       ------------------------------------MTVENVEEKLSINEHLKTDSDFLR
CYSI_SHEWM       --------------------------------MSDGKSVEK-EEALSVNEHLKTDSDFLR
CYSI_SHELP       ----------------------------------------MSDQKLSVNEYLKTDSNYLR
CYSI_THIRO       -----------------------------------------MSAPIHENERIKARSNCLR
CYSI_LEPBA       ---------------------------------------MAETKKETLAEKVKRLSRGLR
CYSI_LEPBP       ---------------------------------------MAETKKETLAEKVKRLSRGLR
CYSI_ACIF2       --------------------------------------MSINDKALSDVERIKAESQGLR
CYSI_ACIF5       --------------------------------------MSINDKALSDVERIKAESQGLR
CYSI_XANAC       --------------------------------------MSHS------VEDIKSESRRLR
CYSI_XANC5       --------------------------------------MSHS------VEDIKSESRRLR
CYSI_XANOM       --------------------------------------MSHS------VEDIKSESRRLR
CYSI_XANOP       --------------------------------------MSHS------VEDIKSESRRLR
CYSI_XANOR       --------------------------------------MSHS------VEDIKSESRRLR
CYSI_XANC8       --------------------------------------MTHS------VEDIKSTSRRLR
CYSI_XANCB       --------------------------------------MTHS------VEDIKSTSRRLR
CYSI_XANCP       --------------------------------------MTHS------VEDIKSTSRRLR
CYSI_XYLF2       -------------------------------------MSSSS------IEDIKGKSHRLR
CYSI_XYLFT       -------------------------------------MSSSS------IEDIKGKSHRLR
CYSI_XYLFM       -------------------------------------MSSSS------IEDIKGKSHRLR
CYSI_XYLFA       -------------------------------------MSSSS------IEDIKGKSHRLR
CYSI_MYXXD       --------------------------------------MSHQPKPLSEVEHIKTQSRLLR
CYSI_GEOKA       ------------------------------MAK--VELKAP-DGPPSDVERIKQESRYLR
CYSI_GEOTN       ------------------------------MAK--VVLKAP-DGPPSDVERIKRESRYLR
CYSI_ANOFW       ------------------------------MEK--FLLTAP-DGPPSDVERIKQESNYLR
CYSI_BACVZ       ------------------------------MVN--NILKAP-EGPPSDVEEIKEKSDYLR
CYSI_BACSU       ------------------------------MVT--KILKAP-DGSPSDVERIKKESDYLR
CYSI_BACHD       ------------------------------MGN--ERLKAP-EGPPSDVERIKEESNYLR
CYSI_BACLD       ------------------------------MGN--EILKAP-EGPPSDVERIKKESDYLR
CYSI_BACP2       ------------------------------MVK--TALTAP-EGPPSDVEEIKEKSDYLR
CYSI_BACSK       ------------------------------MAD--QKFAPTQDGPPSDVERIKEESNYLR
CYSI_LYSSC       ------------------------------MTE--KIVLPPQSGKPSDVERIKTESNYLR
CYSI_PAESJ       ------------------------------MAK--NHKVEPVGGPPSDVEHLKLESNYLR
CYSI_BREBN       ------------------------------MSE--NHLLSSNSAPHSDVEDIKRKSDYLR
CYSI_OCEIH       ------------------------------MTK--SNISKDN-GPLDEVEGIKERSNFLR
CYSI_STAEQ       ------------------------------MVNTNNHISDELDKNLDEMEFLKANSDFLR
CYSI_STAES       ------------------------------MVNTNNHISEELDKNLDEMEFLKANSDFLR
CYSI_STAHJ       ------------------------------MAKTNKQMSEELDKKLDALEYLKDESNYLR
CYSI_STAS1       ------------------------------MAETKVNFSD----KLDEMERIKAHSDYLR
CYSI_STACT       ------------------------------MAKNDNELYK----GLDDLERNKGESNYLR
CYSI_NITOC       ------------------------------MTH---DLQQK--SKLSAVEKIKAKSRYLR
CYSI_NITHX       -------------------------MNVKTEPDRSRDVSQP-LDKLGPDETLKANSDYLR
CYSI_NITWN       -------------------------MDAKTQPDRSRDVSQP-LDKLGPDETLKANSDYLR
CYSI_OLICO       -------------------------MDLKVKVDRSRDVSQP-LDKLGPDETLKANSDQLR
CYSI_BORPD       ------------------------------MQSTDNDLSQS-PPKLSADEQLKAASDQLR
CYSI_METSB       ------------------------MTNTLAGPDRSRDISQP-LEKLGPDEAMKVRSDYLR
CYSI_NITEC       ------------------------MADTLPPTDRSCDISQP-LERLSPDEALKAGSEYLR
CYSI_NITEU       ------------------------MANTLPPTDRSCDISQP-LERLSPDESLKAESDYLR
CYSI_METC4       MDDHKPIETPDGPAVDTPGIGARR-YETPPTELPITEAEAARAAGLAHNEHLKIASGYLR
CYSI_METEP       MDDHKPIETPDGPAVDTPGIGARR-YETPPTELPITEAEAARAAGLAHNEHLKIASGYLR
CYSI_METEA       MDDHKPIETPDGPAVDTPGIGARR-YETPPTELPITEAEAARAAGLAHNEHLKIASGYLR
CYSI_METPB       MDDHKPIDTPDGPAVDTPGIGAHR-YEAPPTDRPITEAEAARAAGLAHNEHLKIASRYLR
CYSI_METRJ       MDDHSPRDAAETPAPGPAATPAKRVYETPPTSRPITDAEAARAEKLAANEHIKIASGYLR
CYSI_METNO       MDDHKTASPP-----------RERSYETPPAERPITDAEAARAAALSANEHIKIASGYLR
CYSI_METS4       MDDTKTASPA-----------PARAYETPPAERPITDAEAARAAALSANEHIKIASGYLR
CYSI_CHRSD       -------------------------------MDIIAKLRDVSFDELHPNERLKVDSHYLY
                                                                  *  *  *  * 

CYSI_ECOLC       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_SHIB3       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_ECO55       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_ECOSE       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_ECOLU       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_ECO5E       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_ECO57       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_ECO24       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_ECO8A       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_SHISS       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_SHIBS       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPHHAMLLRCRLPG
CYSI_SHIDS       GTIAEDLNDGLTGGFKGDN-VLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_ECOL6       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_ECOBW       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_ECOLI       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_ECOBR       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_ECOK1       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_ECO81       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_ECO45       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_ECOUT       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_ECOL5       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_ECO27       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_SHIFL       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_SHIF8       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_ECOSM       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_ECOHS       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_ECO7I       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_ESCF3       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_CITK8       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_SALA4       GTIVEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAAQKLEPRHAMLLRCRLPG
CYSI_SALTI       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAAQKLEPRHAMLLRCRLPG
CYSI_SALTY       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAAQKLEPRHAMLLRCRLPG
CYSI_SALCH       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAAQKLEPRHAMLLRCRLPG
CYSI_SALPC       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAAQKLEPRHAMLLRCRLPG
CYSI_SALNS       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAAQKLEPRHAMLLRCRLPG
CYSI_SALPA       GTIAEDLNDGLTGGFHGDN-FLLIRFHGMYQQDDRDIRAERAAQKLEPRHAMLLRCRLPG
CYSI_SALPK       GTIAEDLNDGLTGGFHGDN-FLLIRFHGMYQQDDRDIRAERAAQKLEPRHAMLLRCRLPG
CYSI_SALDC       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_SALG2       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_SALEP       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_SALHS       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAAQKLEPRHAMLLRCRLPG
CYSI_SALSV       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAAQKLEPRHAMLLRCRLPG
CYSI_SALPB       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAAQKLEPRHAMLLRCRLPG
CYSI_SALAR       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_ENT38       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI1_KLEP3      GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAAQKLEPRHAMLLRCRLPG
CYSI_KLEP7       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAAQKLEPRHAMLLRCRLPG
CYSI_CROS8       GTIAEDLHDGLTGGFNGDN-FLLIRFHGMYQQDDRDIRAERAAQKLEPRHAMMLRCRLPG
CYSI_ERWT9       GGIAEDLHDGLTGGFNGDN-FLLIRFHGMYQQDDRDIRAERAEQKLDARHAMMLRCRLPG
CYSI_PECAS       GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI2_PECCP      GTIAEDLNDGLTGGFKGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPG
CYSI_DICP7       GTIAEDLNDGLTGGFNGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMMLRCRLPG
CYSI_DICC1       GTITDDLNDGLTGGFNGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMMLRCRLPG
CYSI_YERPE       GTIAEDLNNGLTGGFSGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMMLRCRLPG
CYSI_YERPP       GTIAEDLNNGLTGGFSGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMMLRCRLPG
CYSI_YERPA       GTIAEDLNNGLTGGFSGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMMLRCRLPG
CYSI_YERPN       GTIAEDLNNGLTGGFSGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMMLRCRLPG
CYSI_YERP3       GTIAEDLNNGLTGGFSGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMMLRCRLPG
CYSI_YERPY       GTIAEDLNNGLTGGFSGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMMLRCRLPG
CYSI_YERPS       GTIAEDLNNGLTGGFSGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMMLRCRLPG
CYSI_YERPB       GTIAEDLNNGLTGGFSGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMMLRCRLPG
CYSI_YERE8       GTIAEDLNDGLTGGFNGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMMLRCRLPG
CYSI_SERP5       GTIAEDLKDGLTGGFTGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMMLRCRLPG
CYSI_PHOLL       GTISEDLTNGLTGGFEGDN-FLLIRFHGMYQQDDRDIRAERAEQKLEPRHAIMLRCRLPG
CYSI_PROMH       GTISDDLQNGLTGGFEGDN-FLLIRFHGMYQQDDRDIRAERAQQLLEPRHAMMLRCRLPG
CYSI_BUCAI       GTITDDLKNEITNGFTGDN-FSLIRFHGMYQQDDRDLRIERNEQKLEPRYAMMLRCRLPG
CYSI_BUCA5       GTITDDLKNEITNGFTGDN-FSLIRFHGMYQQDDRDLRIERNEQKLEPRYAMMLRCRLPG
CYSI_BUCAT       GTITDDLKNEITNGFTGDN-FSLIRFHGMYQQDDRDLRIERNEQKLEPRYAMMLRCRLPG
CYSI_BUCAP       GTIIDDLKDEITNGFTGDN-FSLIRFHGMYQ-DDRDLRLERNEQKLEPRYAMMLRCRLPR
CYSI_ZYMMO       GTIAEDLNDGLTGGFNGDN-STLIRFHGMYQQDDRDIRAERAEEKLEPRYAMMLRCRLPG
CYSI_ACTPJ       GTILDDLKDGLTGGFKGDN-FQLIRFHGMYEQDDRDIRAERLEEKLEPLKFMLLRCRLPG
CYSI_ACTP2       GTILDDLKDDLTGGFKGDN-FQLIRFHGMYEQDDRDIRAERLEEKLEPLKFMLLRCRLPG
CYSI_ACTP7       GTILDDLKDGLTGGFKGDN-FQLIRFHGMYEQDDRDIRAERLEEKLEPLKFMLLRCRLPG
CYSI_ACTPL       GTILEDLKDGLTGGFKGDN-FQLIRFHGMYEQDDRDIRAERLEEKLEPLKFMLLRCRLPG
CYSI_ACTSZ       GTILDDLEDGLTGGFKGDN-FQMIRFHGMYEQDDRDIRAERADEKLEARKFMLLRCRLPG
CYSI_MANSM       GTILDDLEDGLTGGFKGDN-FQLIRFHGMYEQDDRDIRAERQEEKLEPRKFMLLRCRLPG
CYSI_NEIMB       GTILDDLKDPLTGGFKGDN-FQLIRFHGMYEQDDRDIRAERAEAKLEPLKFMLLRCRLPG
CYSI_NEIM0       GTILDDLKDPLTGGFKGDN-FQLIRFHGMYEQDDRDIRAERAEAKLEPLKFMLLRCRLPG
CYSI_NEIMF       GTILDDLKDPLTGGFKGDN-FQLIRFHGMYEQDDRDIRAERAEAKLEPLKFMLLRCRLPG
CYSI_NEIMA       GTILDDLKDPLTGGFKGDN-FQLIRFHGMYEQDDRDIRAERAEAKLEPLKFMLLRCRLPG
CYSI_AERHH       GTIAQDLTDPLTGGFNGDN-FQLIRFHGMYQQDDRDIRPERTAQKLEPLHNVMLRARLPG
CYSI_TOLAT       GTIELDLKNDLTGGFTGDN-FQLIRLHGMYQQDDRDIRAERAQQKLEPLHNVMLRARMPG
CYSI_ALIF1       GTIVEDLQDRITGGFTKDN-FQLIRFHGMYQQDDRDIRAERAKQKLEPLHNVMLRARMPG
CYSI_ALIFM       GTIVEDLQDRITGGFTKDN-FQLIRFHGMYQQDDRDIRAERAKQKLEPLHNVMLRARMPG
CYSI_ALISL       GTIVEDLQDRITGGFTNDN-FQLIRFHGMYQQDDRDIRAERAKQKLEPLHNVMLRARMPG
CYSI_VIBTL       GTIEQDLEDRITGGFTADN-FQLIRFHGMYQQDDRDIRNERTKQKLEPLHNVMLRARMPG
CYSI_VIBCB       GTIEQDLQDRITGGFTADN-FQLIRFHGMYQQDDRDIRNERAKQKLEPLHNVMLRARMPG
CYSI_VIBPA       GTIAEDLQDRITGGFTADN-FQLIRFHGMYQQDDRDIRNERTKQKLEPLHNVMLRARMPG
CYSI_VIBVU       GTIEQDLQDRITGGFTADN-FQLIRFHGMYQQDDRDIRNERAKQKLEPLHNVMLRARMPG
CYSI_VIBVY       GTIEQDLQDRITGGFTADN-FQLIRFHGMYQQDDRDIRNERAKQKLEPLHNVMLRARMPG
CYSI_VIBCH       GTIEQDLQDRITGGFTADN-FQLIRFHGMYQQDDRDIRAERSKQKLEPLHNVMLRARMPG
CYSI_VIBCM       GTIEQDLQDRITGGFTADN-FQLIRFHGMYQQDDRDIRAERSKQKLEPLHNVMLRARMPG
CYSI_VIBC3       GTIEQDLQDRITGGFTADN-FQLIRFHGMYQQDDRDIRAERSKQKLEPLHNVMLRARMPG
CYSI_PHOPR       GTIADDLQDRITGGFTADN-FQLIRFHGMYQQDDRDIRAERAKQKLEPLHNVMLRARMPG
CYSI_ALTMD       GTITTDLKDDLTGGFTADN-FQLIRFHGMYQQDDRDIRAERAKQKLEPLHNVMLRARLPG
CYSI_PSEA6       GTIAEDLKDDLTGAFVGDN-FQLIRFHGMYQQDDRDLRAERAKQKLEPLQNVMLRARLPG
CYSI_PSEHT       GTIATDLKDEITGGFTADN-FQLIRFHGMYQQDDRDIRGERAKQKLEPLHNVMLRARMPG
CYSI_SHEAM       GTITTDLKDEITGGFTGDN-FMLVRFHGMYQQDDRDLRAERAEQKLEPLHNVMLRARMPG
CYSI_COLP3       GTIKDDLQDRMTGGFTSDN-FQLIRTHGMYQQDDRDIRAERQKQKLEPLHNVMLRARLPG
CYSI_BAUCH       GTIAQDLQDNITGGFKGDN-IQLIRFHGMYQQDDRDLRVERTCQKLEPLINMMLRCRLPG
CYSI_SODGM       GTIAQDLQDGLTGGFNGDN-FQLIRFHGMYQQDDRDLRAERAEEKLEPLINMMLRCRLPG
CYSI_BLOFL       GTIEKDLDNNLTGGFNVDN-AQLIRFHGMYQQDDRDVRLERMNQKLEPLINMMLRCRLPG
CYSI_BLOPB       GTIAQNLDNNLTGGFNTED-AQLIRFHGMYQQDDRDVRVERANQKLEPLINMMLRCRLPG
CYSI2_KLEP3      GTIKEDLHNELTGGFLGDN-FQLIRFHGMYQQDDRDIRQERAAQMLEPLHTVMLRVRLPG
CYSI1_PECCP      GTIQDDLADPLTGGFVADN-FQLIRFHGMYQQDDRDIRQERIAQKLEPLHTVMLRVRLPG
CYSI_PSYIN       GKLVEGLNDNTTGAFIPDD-VQLVKFHGLYQQDHRDYRAERKKQKLEPLYSFLLRARLPG
CYSI_SHEB5       GTIKEGLDSAVTGSFSDGD-QQLIKFHGFYQQDDRDLRNERKEQKLEPLYSFMLRARVPG
CYSI_SHEB9       GTIKEGLDSAVTGSFSDGD-QQLIKFHGFYQQDDRDLRNERKEQKLEPLYSFMLRARVPG
CYSI_SHEB2       GTIKEGLDSAVTGSFSDGD-QQLIKFHGFYQQDDRDLRNERKEQKLEPLYSFMLRARVPG
CYSI_SHEB8       GTIKEGLDSAVTGSFSDGD-QQLIKFHGFYQQDDRDLRNERKEQKLEPLYSFMLRARVPG
CYSI_SHEPC       GTIKEGLDSSVTGSFSDGD-QQLIKFHGFYQQDDRDLRNERKEQKLEPLYSFMLRARVPG
CYSI_SHESW       GTIKEGLDSSVTGSFSDGD-QQLIKFHGFYQQDDRDLRNERKEQKLEPLYSFMLRARVPG
CYSI_SHESA       GTIKEGLDSSVTGSFSDGD-QQLIKFHGFYQQDDRDLRNERKEQKLEPLYSFMLRARVPG
CYSI_SHESR       GTIKEGLDSSVTGSFSDGD-QQLIKFHGFYQQDDRDLRNERKEQKLEPLYSFMLRARVPG
CYSI_SHESM       GTIKEGLDSSVTGSFSDGD-QQLIKFHGFYQQDDRDLRNERKEQKLEPLYSFMLRARVPG
CYSI_SHEON       GTIKEGLDSSVTGSFSDGD-QQLIKFHGFYQQDDRDLRNERKEQKLEPLYSFMLRARVPG
CYSI_SHEDO       GTIQEGLDTQVTGSFSDGD-QQLIKFHGFYQQDDRDLRNERKEQKLEPLYSFMLRARVPG
CYSI_SHEFN       GDIQEGLDTQVTGSFSDGD-QQLIKFHGFYQQDDRDLRNERKEQKLEPLHSFMLRARVPG
CYSI_SHEHH       GTIQQGLNTAVTGAFSEGD-QQLIKFHGFYQQDDRDLRNERKEQKLEPLYSFMLRARVAG
CYSI_SHEPA       GTIQEGLDTAVTGAFSEGD-QQLIKFHGFYQQDDRDLRNERKEQKLEPLYSFMLRARVAG
CYSI_SHEPW       GTIQEGLDTAVTGAFSEGD-QQLIKFHGFYQQDDRDLRNERKEQKLEPLYSFMLRARVAG
CYSI_SHESH       GGIEEGLDTAVTGAFSEGD-QQLIKFHGFYQQDDRDLRNERKEQKLEPLYSFMLRARVAG
CYSI_SHEWM       GTIQEGLDTAVTGSFSEGD-QQLIKFHGFYQQDDRDLRNERKEQKLEPLYSFMLRARVAG
CYSI_SHELP       GTIEEGLDTSLTGAFNDAD-QQLIKFHGFYQQDDRDLRNERKEQKLEPLYSFMLRARVAG
CYSI_THIRO       GTLRESLADTLTGAISPED-TQISKFHGFYQQDHRDRRQARPEQYLEPYFGFMLRAPLPG
CYSI_LEPBA       GSLVDSLKDEHTGSLRSDD-QLLLKFHGMYQQDDRDRRDERALKKLERLYSFMIRLRIPG
CYSI_LEPBP       GSLVDSLKDEHTGSLRSDD-QLLLKFHGMYQQDDRDRRDERALKKLERLYSFMIRLRIPG
CYSI_ACIF2       GTLRESLHNPVTGALAEDD-VQVIKFHGIYQQDYRDLRAERHQQKLEPLYQFMARLRLPG
CYSI_ACIF5       GTLRESLHNPVTGALAEDD-VQVIKFHGIYQQDYRDLRAERHQQKLEPLYQFMARLRLPG
CYSI_XANAC       GSLEQSLADAVTGALREDD-QTLIKYHGSYQQDDRDIRDERRRQKLEPAYQFMIRTRTPG
CYSI_XANC5       GSLQQSLADAVTGALREDD-QTLIKYHGSYQQDDRDIRDERRRQKLEPAYQFMIRTRTPG
CYSI_XANOM       GSLEQSLADAVTGALREDD-QTLIKYHGSYQQDDRDIRDERRQQKLEPAYQFMIRTRTPG
CYSI_XANOP       GSLEQSLADAVTGALREDD-QTLIKYHGSYQQDDRDIRDERRQQKLEPAYQFMIRTRTPG
CYSI_XANOR       GSLEQSLADAVTGALREDD-QTLIKYHGSYQQDDRDIRDERRQQKLEPAYQFMIRTRTPG
CYSI_XANC8       GSLEQSLADPVTGALREDD-QTLIKYHGSYQQDDRDIRDERRRQKLEPAYQFMIRTRTPG
CYSI_XANCB       GSLEQSLADPVTGALREDD-QTLIKYHGSYQQDDRDIRDERRRQKLEPAYQFMIRTRTPG
CYSI_XANCP       GSLEQSLADPVTGALREDD-QTLIKYHGSYQQDDRDIRDERRRQKLEPAYQFMIRTRTPG
CYSI_XYLF2       GSLLESLANPTTGALGESD-QTLIKYHGSYQQDDRDLREERRRQKLEPAYQFMIRTRTPG
CYSI_XYLFT       GSLLESLANPTTGALGESD-QTLIKYHGSYQQDDRDLREERRRQKLEPAYQFMIRTRTPG
CYSI_XYLFM       GSLLESLANPTTGALRESD-QTLIKYHGSYQQDDRDLREERRRQKLEPAYQFMIRTRTPG
CYSI_XYLFA       GSLLESLANPTTGALHESD-QTLIKYHGSYQQDDRDLREERRRQKLEPAYQFMIRTRTPG
CYSI_MYXXD       GSLAESLEDPVTGGLATPD-TNLIKFHGSYQQDDRDVREERRQQKLEPDYSFMLRTRLPG
CYSI_GEOKA       GTLAETMEDPLSAGIPDDD-NRLMKFHGSYLQDDRDVRTERQKQKLEPTYQFMIRVRTPG
CYSI_GEOTN       GTLAETMEDPISAGIPDDD-NRLMKFHGSYLQDDRDVRTERQKQKLEPAYQFMIRVRTPG
CYSI_ANOFW       GTLKETMEDRITAGIPEDD-NRLMKFHGSYLQDDRDLRAERQKQKLEPAYQFMIRVRTPG
CYSI_BACVZ       GTLKEVMLDRISAGIPDDD-NRLMKHHGSYLQDDRDLRNERQKQKLEPAYQFMLRVRMPG
CYSI_BACSU       GTLKEVMLDRISAGIPDDD-NRLMKHHGSYLQDDRDLRNERQKQKLEPAYQFMLRVRMPG
CYSI_BACHD       GTLKESMLEPISAGISDDD-NRLMKHHGSYLQDDRDLRNERQKQKLEPAYQFMLRVRMPG
CYSI_BACLD       GTLKESMLEPLSAGISDDD-NRLMKHHGSYLQDDRDLRNERQKQKLEPAYQFMLRVRMPG
CYSI_BACP2       GTLKEVMLDPISAGIPDDD-NRLMKHHGSYLQDDRDLRNERQKQKLEPAYQFMLRVRLPG
CYSI_BACSK       GTLAESLNEPLSAGIPDDD-NRLMKFHGSYLQDDRDLREERRRQKLEPAYQFMVRVRLPG
CYSI_LYSSC       GTLERTMNDPLSSGIPEDD-NRLMKFHGSYLQDDRDLRNERQRQKLEPAYQFMVRVRTPG
CYSI_PAESJ       GSLTDSLANRITGGLPDLD-NRLLKFHGSYMQDDRDYRNEREKQKLEPYYQFMLRVVTPG
CYSI_BREBN       GSLAETLEDRISGSIPEDD-NRLMKFHGSYMQDDRDLRNERSKQKLEPAYQFMVRVRAAG
CYSI_OCEIH       GTIAEGLEDRITGAISDED-NKLLKFHGSYQQDDRDLRDERRRKKLEPAYQFMIRVRTPG
CYSI_STAEQ       GTIEQSLANPITGSITQDD-AKLLKFHGSYMQDDRDLRDERRKQKLEPAYSFMIRVRVPG
CYSI_STAES       GTIEQSLANPITGSITQDD-AKLLKFHGSYMQDDRDLRDERRKQKLEPAYSFMIRVRVPG
CYSI_STAHJ       GTIEQGLADPLTGAISDDD-TKLLKFHGSYQQDDRDLRDERRKQKLEPAYSFMIRVRLPG
CYSI_STAS1       GSIVQGLADRVTGAIAEED-TKLLKFHGSYMQDDRDIRDERRRQKLEPAYSFMIRVRAPG
CYSI_STACT       GTIVEGLNDPITGAIAEDD-TKLLKFHGSYMQDDRDLRQERRKQKLEPLYAFMIRVRIPG
CYSI_NITOC       GTIQEGLADLATGAVVEED-TKLLKFHGTYQQDDRDLRTERMRQKLEPAYSFMVRVRMPG
CYSI_NITHX       GTIKQSLADEITAAVTAND-AKLMKFFGIYQQDDRDIRDERRRQKLEAAFSFMVRVRLPG
CYSI_NITWN       GTIKQSLADEITSAVTAND-AKLMKFFGIYQQDDRDIRDERRRQKLEAAFSFMVRVRLPG
CYSI_OLICO       GTIAQSLADPITLAVDPSD-NKLMKFHGIYQQDDRDIRDERRRQKLEAAYSFMARVRLPG
CYSI_BORPD       GTILRSLADPLTGAVSDSD-AKLLKFHGIYQQDDREQRDERRRQKLEPAYQFMIRVRLPG
CYSI_METSB       GTINEGLLDAITGAVSGDDNAKLMKFHGVYVQDDRDLRDERRRQKLEPAYSFLIRLRLPG
CYSI_NITEC       GTIALGLLDRITSAVPGDD-IKLMKFHGIYQQDDRDVRDERRRQKLEPAFQFMIRVRLPG
CYSI_NITEU       GTIALGLLDRITSAVPGND-IKLMKFHGIYEQDDREIRDERRRQKLEPAFQFMIRVRLPG
CYSI_METC4       GGLADGLLKHATGAISEDD-GQLVKFHGMYMQDDRDIRAERTKKKLEKAYSFMIRLRIAG
CYSI_METEP       GGLADGLLKHATGAISEDD-GQLVKFHGMYMQDDRDIRAERTKKKLEKAYSFMIRLRIAG
CYSI_METEA       GGLADGLLKHATGAISEDD-GQLVKFHGMYMQDDRDIRAERTKKKLEKAYSFMIRLRIAG
CYSI_METPB       GGLADGLLKHATGAISEDD-GQLVKFHGMYMQDDRDIRAERTKKKLEKAFSFMIRLRIAG
CYSI_METRJ       GTLADGLLKHATGAISEDD-GQLVKFHGMYLQDDRDLRPERTKKKLDKAYSFMIRLRIAG
CYSI_METNO       GTLADGLLKHATGAISDDD-GQLVKFHGMYLQDDRDLRAERTKKKLEKAYSFMIRLRIAG
CYSI_METS4       GTLADGLLKHATGAISEDD-GQLVKFHGMYLQDDRDLRPERTRKKLEKAYSFMIRLRIAG
CYSI_CHRSD       GTLEESLADRATGAVSDAD-TQLTKFHGFYQQDDRDLRDDRRHRKLEPLYSFMVRLRLPG
                 * :   :    : ..   :   : : .* *  * *: *  *    *:    .: *   . 

CYSI_ECOLC       GVITTKQWQAIDKFAGENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_SHIB3       GVITTKQWQAIDKFAGENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_ECO55       GVITTKQWQAIDKFAGENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_ECOSE       GVITTKQWQAIDKFAGENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_ECOLU       GVITTKQWQAIDKFAGENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_ECO5E       GVITTKQWQAIDKFAGENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_ECO57       GVITTKQWQAIDKFAGENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_ECO24       GVITTKQWQAIDKFAGENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_ECO8A       GVITTKQWQAIDKFAGENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_SHISS       GVITTKQWQAIDKFAGENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_SHIBS       GVITTKQWQAIDKFAGENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_SHIDS       GVITTKQWQAIDKFAGENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_ECOL6       GVITTKQWQAIDKFAGENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_ECOBW       GVITTKQWQAIDKFAGENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_ECOLI       GVITTKQWQAIDKFAGENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_ECOBR       GVITTKQWQAIDKFAGENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_ECOK1       GVITTKQWQAIDKFAGENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_ECO81       GVITTKQWQAIDKFAGENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_ECO45       GVITTKQWQAIDKFAGENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_ECOUT       GVITTKQWQAIDKFAGENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_ECOL5       GVITTKQWQAIDKFAGENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_ECO27       GVITTKQWQAIDKFAGENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_SHIFL       GVITTKQWQAIDKFAGENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_SHIF8       GVITTKQWQAIDKFAGENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_ECOSM       GVITTKQWQAIDKFAGENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_ECOHS       GVITTKQWQAIDKFAGENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_ECO7I       GVITTKQWQAIDKFAGENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_ESCF3       GVITTKQWQAIDKFAGENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_CITK8       GVITTRQWQAIDKFAAENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_SALA4       GVITTTQWQAIDKFAADNTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_SALTI       GVITTTQWQAIDKFAADNTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_SALTY       GVITTTQWQAIDKFAADNTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_SALCH       GVITTTQWQAIDKFAADNTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_SALPC       GVITTTQWQAIDKFAADNTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_SALNS       GVITTTQWQAIDKFAADNTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_SALPA       GVITTTQWKAIDKFAADNTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_SALPK       GVITTTQWKAIDKFAADNTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_SALDC       GVITTTQWQAIDKFAADNTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_SALG2       GVITTTQWQAIDKFAADNTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_SALEP       GVITTTQWQAIDKFAADNTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_SALHS       GVITTTQWQAIDKFAADNTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_SALSV       GVITTTQWQAIDKFAADNTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_SALPB       GVITTTQWQAIDKFAADNTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_SALAR       GVITTKQWQVIDKFAADNTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_ENT38       GVITTKQWQAIDKFAHDNTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI1_KLEP3      GVITTTQWKAIDKFAADNTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_KLEP7       GVITTTQWKAIDKFAAENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH-SVGLDALAT
CYSI_CROS8       GIMTPQQWLAIDKFAEENTIYGSIRLTNRQTFQYHGLLKKNVKPAHQMLH-SVGLDALAT
CYSI_ERWT9       GIMTPRQWLAIDKFATDNTIYGSIRLTNRQTFQFHGILKGNVKPAHQMLH-EVGLDALAT
CYSI_PECAS       GVMTPQQWLRIDKFAGENTIYGSIRITNRQTFQYHGILKSNVKPVHQMLN-SIGLDALAT
CYSI2_PECCP      GVMTPEQWLRIDKFAGESTIYGSIRITNRQTFQYHGILKSNVKPVHQMLN-SIGLDALAT
CYSI_DICP7       GVMTPQQWLGIDKFAGENTLYGSIRITNRQTFQFHGILKSDLKSAHQLLH-ELGLDALAT
CYSI_DICC1       GVMTPQQWLAIDKFAGEKTLYGSIRITNRQTFQFHGILKGDLKSAHQLLH-EVGLDALAT
CYSI_YERPE       GIITPQQWLGIDKFAADNTLYGSIRITNRQTFQFHGILKGNVKPAHQLLN-ELGLDALAT
CYSI_YERPP       GIITPQQWLGIDKFAADNTLYGSIRITNRQTFQFHGILKGNVKPAHQLLN-ELGLDALAT
CYSI_YERPA       GIITPQQWLGIDKFAADNTLYGSIRITNRQTFQFHGILKGNVKPAHQLLN-ELGLDALAT
CYSI_YERPN       GIITPQQWLGIDKFAADNTLYGSIRITNRQTFQFHGILKGNVKPAHQLLN-ELGLDALAT
CYSI_YERP3       GIITPQQWLGIDKFAADNTLYGSIRITNRQTFQFHGILKGNVKPAHQLLN-ELGLDALAT
CYSI_YERPY       GIITPQQWLGIDKFAADNTLYGSIRITNRQTFQFHGILKGNVKPAHQLLN-ELGLDALAT
CYSI_YERPS       GIITPQQWLGIDKFAADNTLYGSIRITNRQTFQFHGILKGNVKPAHQLLN-ELGLDALAT
CYSI_YERPB       GIITPQQWLGIDKFAADNTLYGSIRITNRQTFQFHGILKGNVKPAHQLLN-ELGLDALAT
CYSI_YERE8       GIITPQQWLGIDKFAADNTLYGSIRITNRQTFQFHGILKGNVKPAHQLLN-QLGLDALAT
CYSI_SERP5       GIISPQQWLGIDKFAQESTLYGSIRITNRQTFQFHGILKGNVKPVHQLLG-RLGLDALAT
CYSI_PHOLL       GVITPQQWLGIDKFAEENTLYGSIRLTNRQTFQFHGILKGKVKLAHQLLN-QVGLDSLAT
CYSI_PROMH       GVITPKQWLSIDKFASENTLYGSIRITNRQTFQFHGILKGHVKPAHQMLA-STGLDALAT
CYSI_BUCAI       GVIKAKKWLKIDYFASKYTLYGTIRLTNRQTFQFHGILKKNLKDVHKMLH-SIGLDSLAT
CYSI_BUCA5       GVIKAKKWLKIDYFASKYTLYGTIRLTNRQTFQFHGILKKNLKDVHKMLH-SIGLDSLAT
CYSI_BUCAT       GVIKAKKWLKIDYFASKYTLYGTIRLTNRQTFQFHGILKKNLKDVHKMLH-SIGLDSLAT
CYSI_BUCAP       GIIKAKKWLKIDHFASKNTLYGTIRLNNLQTFQFHGILKKTLKDAHKMLN-KIGLDSLGT
CYSI_ZYMMO       GIISPEQWLKMDSFASEKTLYGSIRLTNRQTFQFHGILKKDLKTVHHLLH-ESGLDSLAT
CYSI_ACTPJ       GIIKPYQWIEIDKFAREHTRYQSIRLTNRQTFQYHGVPKGKLQPMHRLLH-SIGLDSIAT
CYSI_ACTP2       GIIKPYQWIEIDKFAREHTRYQSIRLTNRQTFQYHGVPKGKLQPMHRLLH-SIGLDSIAT
CYSI_ACTP7       GIIKPYQWIEIDKFAREHTRYQSIRLTNRQTFQYHGVPKGKLQPMHRLLH-SIGLDSIAT
CYSI_ACTPL       GIIKPYQWIEIDKFAREHTRYQSIRLTNRQTFQYHGVPKGKLQPMHRLLH-SIGLDSIAT
CYSI_ACTSZ       GIIKPAQWIEIDKFARDNNYYQSIRLTNRQTFQYHGVPKTKLQEMHRLLH-KLGLDSIAT
CYSI_MANSM       GIIKPEQWIEIDKFARDNNYYQSIRLTNRQTFQYHGVPKTKLQDMHRLLH-KLGLDSIAT
CYSI_NEIMB       GIIKPSQWIELDKFARENSHYRSIRLTNRQTFQFHGVPKAKLQTMHRLLH-KLGLDSIAT
CYSI_NEIM0       GIIKPSQWIELDKFARENSHYRSIRLTNRQTFQFHGVPKAKLQTMHRLLH-KLGLDSIAT
CYSI_NEIMF       GIIKPSQWIELDKFARENSHYRSIRLTNRQTFQFHGVPKAKLQTMHRLLH-KLGLDSIAT
CYSI_NEIMA       GIIKPSQWIELDKFARENSHYRSIRLTNRQTFQFHGVPKAKLQTMHRLLH-KLGLDSIAT
CYSI_AERHH       GIITPAQWQVIDKFAEDHSLYGSIRLTTRQTFQFHGVLKRDIKMMHQTLN-STGIDSIAT
CYSI_TOLAT       GIITPEQWLGIDKFAHDHTMYGSIRLTTRQTFQFHGVLKPNIKMMHQTLN-KYGIDSIAT
CYSI_ALIF1       GIITPKQWLAIDKFAEEHTSYGSLRLTTRQTFQFHGVLKPNIKLMHQTLN-SIGIDSIAT
CYSI_ALIFM       GIITPKQWLAIDKFAEEHTSYGSLRLTTRQTFQFHGVLKPNIKLMHQTLN-SIGIDSIAT
CYSI_ALISL       GIITPKQWLAIDKFAEENTSYGSLRLTTRQTFQFHGVLKPNIKLMHQTLN-SIGIDSIAT
CYSI_VIBTL       GIITPKQWLAIDKFADESTSYGSIRLTTRQTFQFHGVLKPNIKLMHQTLN-SIGIDSIAT
CYSI_VIBCB       GIITPKQWLAIDKFATEHSLYGSIRLTTRQTFQFHGVLKPNIKLMHQTLN-SIGIDSIAT
CYSI_VIBPA       GIITPTQWLAIDKFATEHSLYGSIRLTTRQTFQFHGVLKPNIKLMHQTLN-NIGIDSIAT
CYSI_VIBVU       GIITPKQWLAIDKFATEHSLYGSIRLTTRQTFQFHGVLKPNIKLMHQTLN-SIGIDSIAT
CYSI_VIBVY       GIITPKQWLAIDKFATEHSLYGSIRLTTRQTFQFHGVLKPNIKLMHQTLN-SIGIDSIAT
CYSI_VIBCH       GIITPHQWLAIDKFATEHTLYGSIRLTTRQTFQFHGVLKPNIKLMHQTLN-SIGIDSIAT
CYSI_VIBCM       GIITPHQWLAIDKFATEHTLYGSIRLTTRQTFQFHGVLKPNIKLMHQTLN-SIGIDSIAT
CYSI_VIBC3       GIITPHQWLAIDKFATEHTLYGSIRLTTRQTFQFHGVLKPNIKLMHQTLN-SIGIDSIAT
CYSI_PHOPR       GIITPTQWLAIDKFAEESSLYGSIRLTTRQTFQFHGVLKPNIKLMHQTLN-SIGIDSIAT
CYSI_ALTMD       GVITPDQWLAIDKFADDHTMYGSIRLTTRQTFQFHGVLKPQIKLMHQTLN-KVGIDSIAT
CYSI_PSEA6       GIIKPQQWLAIDKFAEEKSLYGSIRLTTRQTFQFHGVLKPNIKLMHQTLN-QVGIDSIAT
CYSI_PSEHT       GIIKPEQWLAIDKFAEEKTSYGSIRLTTRQTFQFHGVLKPNIKGMHQLLD-SVGIDSIAT
CYSI_SHEAM       GIIKPEQWLAIDEFAREHTMYGSIRLTTRQTFQFHGVFKPDIKPMHQMLN-KIGIDSIAT
CYSI_COLP3       GIINPTQWLAIDKFADDYTSYGSIRLTTRQTFQFHGVLKPNIKLMHQTLN-SVGLDSIAT
CYSI_BAUCH       GIITPQQWLGIDSFATKHTLYGSIRLTTRQTFQFHGVLKPNLKNMHKLLH-SLGLDSIAT
CYSI_SODGM       GVITPQQWLGIDAFAAEQTLYGSIRLTTRQTFQFHGVLKPKLKGMHQLLH-CLGLDSIAT
CYSI_BLOFL       GVITSQQWLNIDNFSEEQTLYSSIRLTTRQTFQLHGILKPKLKGIHQLLN-KLGLDSIAT
CYSI_BLOPB       GVIMPQQWLAIDDFSEKYTLYGTIRLTTRQTFQLHGLLKPNLKNVHRLLN-KLGLDSIAT
CYSI2_KLEP3      GIISPQQWLGIDEFASQHTLYGSIRITNRQALQLHGVLKRNIKPVHRLLH-QLGLDSRAT
CYSI1_PECCP      GIITPHQWLGIDAFAREHTLYGSIRITNRQTVQLHGVLKDDIKPVHKLLN-HLGLDSRAT
CYSI_PSYIN       GVVTPQQLLEIDRIASELTDAGSIRLTTRQTFQYHGIYKRNLKSVFQELKFKANIDSIFT
CYSI_SHEB5       GICSPQQWLGVDKIASTLTSSNSIRLTTRQTFQYHGIPKRNLKTIIQDLD-REALDSIAA
CYSI_SHEB9       GICSPQQWLGVDKIASTLTSSNSIRLTTRQTFQYHGIPKRNLKTIIQDLD-REALDSIAA
CYSI_SHEB2       GICSPQQWLGVDKIASTLTSSNSIRLTTRQTFQYHGIPKRNLKTIIQDLD-REALDSIAA
CYSI_SHEB8       GICSPQQWLGVDKIASTLTSSNSIRLTTRQTFQYHGIPKRNLKTIIQDLD-REALDSIAA
CYSI_SHEPC       GICSPQQWLGVDKIASTLTSSNSIRLTTRQTFQYHGIPKRNLKTIIQDLD-RQALDSIAA
CYSI_SHESW       GICTPQQWLGVDKIASTLTSSNSIRLTTRQTFQYHGIPKRNLKTIIQDLD-RQALDSIAA
CYSI_SHESA       GVCTPKQWLGVDEIASTLTSSNSIRLTTRQTFQYHGIPKRNLKTIIQGLD-REALDSIAA
CYSI_SHESR       GVCTPKQWLGVDEIASTLTSSNSIRLTTRQTFQYHGIPKRNLKTIIQGLD-REALDSIAA
CYSI_SHESM       GVCTPKQWLGVDEIASTLTSSNSIRLTTRQTFQYHGIPKRNLKTIIQGLD-REALDSIAA
CYSI_SHEON       GVCTPKQWLGVDEIASTLTSSNSIRLTTRQTFQYHGIPKRNLKTIIQGLD-REALDSIAA
CYSI_SHEDO       GICTPAQWLDVDKISSTLTTSNSIRLTTRQTFQYHGIPKRNLKTLIQGLD-KAALDSIAA
CYSI_SHEFN       GICTPAQWLEVDKISSTLTTSNSIRLTTRQTFQYHGIPKRNLKTLIQGLD-RAALDSIAA
CYSI_SHEHH       GVCSPEQWLAVDKIASNLTSANSIRLTTRQTFQYHGIPKRNLKTIIQDLD-REALDSIAA
CYSI_SHEPA       GVCSPEQWLAVDKIASNLTSSNSIRLTTRQTFQYHGIPKRNLKTIIQDLD-REALDSIAA
CYSI_SHEPW       GVCSPQQWLAVDDIASNLTSSNSIRLTTRQTFQYHGIPKRNLKTIIQDLD-REALDSIAA
CYSI_SHESH       GVCTPEQWLGVDEISSTLTSSNSIRLTTRQTFQYHGISKRNLRTLIQSLD-KKALDSIAA
CYSI_SHEWM       GVCSPEQWLGVDEISSTLTSSNSIRLTTRQTFQYHGISKRNLRTLIQGLD-SKALDSIAA
CYSI_SHELP       GVCTPKQWLGVDKIASTLTSSNSIRLTTRQTFQYHGIPKRNLKTLIQDLD-REALDSIAA
CYSI_THIRO       GVCTPAQWLAIDGMGRELGG-GSLRLTTRQSFQYHGILKRDIASVIRGIN-AVMIDSIGG
CYSI_LEPBA       GMIGPVHWEALHNVAGENST-GTIKITTRQTVQLHGILKSKIKPTIKAFD-SVFLDSIAA
CYSI_LEPBP       GMIGPVHWEALHNVAGENST-GTIKITTRQTVQLHGILKSKIKPTIKAFD-SVFLDSIAA
CYSI_ACIF2       GVLSGAQWLALGDIARTYGN-ASLRITSRQSIQFHGLLKPHLRPVLQALD-RALLDTVSA
CYSI_ACIF5       GVLSGAQWLALGDIARTYGN-ASLRITSRQSIQFHGLLKPHLRPVLQALD-RALLDTVSA
CYSI_XANAC       GVITPTQWLALDGIATRYAN-HSLRITTRQAFQFHGVIKRELKATMQAIN-ATLIDTLAA
CYSI_XANC5       GVITPTQWLALDGIATRYAN-HSLRVTTRQAFQFHGVIKRELKATMQAIN-ATLIDTLAA
CYSI_XANOM       GVITPAQWLALDGIATRYAN-HSLRITTRQAFQFHGVIKRELKATMQAIN-ATLIDTLAA
CYSI_XANOP       GVITPAQWLALDGIATRYAN-HSLRITTRQAFQFHGVIKRELKATMQAIN-ATLIDTLAA
CYSI_XANOR       GVITPAQWLALDGIATRYAN-HSLRITTRQAFQFHGVIKRELKATMQAIN-ATLIDTLAA
CYSI_XANC8       GVISPSQWLALDGIATRYAN-HSLRITTRQAFQFHGVIKRELKATMQAIN-ATLIDTLAA
CYSI_XANCB       GVISPSQWLALDGIATRYAN-HSLRITTRQAFQFHGVIKRELKATMQAIN-ATLIDTLAA
CYSI_XANCP       GVISPSQWLALDGIATRYAN-HSLRITTRQAFQFHGVIKRELKATMQAIN-ATLIDTLAA
CYSI_XYLF2       GVITPQQWLQLDAIATRYAN-HSLRVTTRQAFQFHGVIKRELKTTMQAIN-AALIDTLAA
CYSI_XYLFT       GVITPQQWLQLDAIATRYAN-HSLRVTTRQAFQFHGVIKRELKTTMQAIN-AALIDTLAA
CYSI_XYLFM       GVITPQQWLQLDAIATRYAN-HSLRVTTRQAFQFHGVIKRELKTTMQAIN-AALIDTLAA
CYSI_XYLFA       GVITPQQWLQLDAIATRYAN-HSLRVTTRQAFQFHGVIKRELKATMQAIN-AALIDTLAA
CYSI_MYXXD       GVCTPAQWLVMDALAREHAN-HTLRITTRQAFQLHGVIKDDLRPTIARIN-EAMMDTLAA
CYSI_GEOKA       GVATPEQWLVMDELARKYAN-GTLKLTTRQAFQLHGVLKWNVKKTMQAIN-GALMTTLAA
CYSI_GEOTN       GVATPEQWLVMDEIARKYAN-GTLKLTTRQAFQLHGVLKWNVKKTMQAIN-GALMTTLAA
CYSI_ANOFW       GVATPEQWLAMDELARKYAN-GTLKLTTRQAFQFHGVLKWNMKKTLQAIN-DALLTTLAA
CYSI_BACVZ       GVSTPEQWLVMDELAQKYGN-NTLKLTTRETFQMHGILKWNMKKTIQKIN-AALLDTIAA
CYSI_BACSU       GVSTPEQWLVMDDLSQKYGN-GTLKLTTRETFQMHGILKWNMKKTIQTIH-SALLDTIAA
CYSI_BACHD       GVATPEQWLVMDELAQKYGN-GTMKLTTRETFQLHGILKWNMKKTIQAIH-SALLDTIAA
CYSI_BACLD       GVATPEQWLVMDELARKYGN-GTLKLTTRETFQMHGILKWNMKKTIQSIH-SAMLDTIAA
CYSI_BACP2       GIATSKQWLVMDELAHKYGN-GTLKLTTRETFQLHGILKWNMKKTIQDIH-STMLDTIAA
CYSI_BACSK       GVATPKQWLAMDDLAHRYGN-GTLRLTTRQTFQMHGILKWNMKKNIQGIN-AALMDTIAA
CYSI_LYSSC       GAATPAQWLVMDEMARKYGN-GSLKLTTRQAFQVHGILKWNVKKYMQEIN-EVLLDSLAA
CYSI_PAESJ       GVATPEQWLLMDSLADKYGT-GSLKLTTRQAFQLHGVLKWNLKKTIQEIN-AAMLSTLAA
CYSI_BREBN       GVVTPEQWLMMDDIAQQFAN-GTIRLTTRQSFQLHGVIKWNMKQVIQEVN-EALLSTLAA
CYSI_OCEIH       GVTTPEQWLVMDDLAHKYAN-GSMRLTTRQTFQLHGIVKWDLKKTMQGMN-QALMTTIAA
CYSI_STAEQ       GKATPEQWIAMDDISNQYAN-HTIKLTTRQAFQFHGILKRNLKQSMKNIN-HAVLDSIAA
CYSI_STAES       GKATPEQWIAMDDISNQYAN-HTIKLTTRQAFQFHGILKRNLKQSMKNIN-HAVLDSIAA
CYSI_STAHJ       GTATPEQWLAMDDISNNYAN-QTLKLTTRQTFQFHGILKRNLKTSMKKIN-ESVLDTIAA
CYSI_STAS1       GASTAEQWIAMDDIANTYAN-GTIKLTTRQAFQFHGILKRNLKQTMKDIN-QSLLDTLAA
CYSI_STACT       GKVSTDQWLKLDALADNYAG-EQIRLTTRQTMQYHGILKRNLKKSMQSIH-DAVLDSIAA
CYSI_NITOC       GVCMPKQWLQLDELARKYAN-NSLRITTRQTFQFHSVVKRHLRSTIAGIN-EALLSTIAA
CYSI_NITHX       GVCSPSQWLKLDALGRAYGG-DTLRLTTRQTFQLHRIMKHNMRAVIQGLR-DVLLDTRAA
CYSI_NITWN       GVCSPGQWLKLDELARNYAG-DTLRLTTRQTFQFHRVMKHNLRSLIQGLR-DILLDTRAA
CYSI_OLICO       GVCSTSQWLKLDELGRAYAG-NTLRLTTRQTFQLHRVLKHHLRPALQGLR-EVVLDTKAA
CYSI_BORPD       GVCSAAQWLKLDELARAYGG-DSLRLTTRQTFQFHWVLKHNLQATLQGLH-EVLLDTIAA
CYSI_METSB       GVATAAQWLKLDELARAYGN-SSLRVTTRQTFQFHWVLKNDLKATIQGLH-EVLIDTIAA
CYSI_NITEC       GICTTERWLKISELACAHGN-ETLRMTTRQTFQFHWVLKHNIVPVIRGLH-EVLLDTVAA
CYSI_NITEU       GICTTERWLKISELACAHGN-ETLRMTTRQTFQFHWVLKQNIVPLIRGLH-EVLLDTVAA
CYSI_METC4       GVVTPKQWLILDNIATTYAG-SALRATTRQTFQYHGVIKSNLKRTMAAID-SALLDTIAA
CYSI_METEP       GVVTPKQWLILDNIATTYAG-SALRATTRQTFQYHGVIKSNLKRTMAAID-SALLDTIAA
CYSI_METEA       GVVTPKQWLILDNIATTYAG-SALRATTRQTFQYHGVIKSNLKRTMAAID-SALLDTIAA
CYSI_METPB       GVVTPKQWLILDNIATTYAG-NALRATTRQTFQYHGVIKSNLKRTMAAID-SALLDTIAA
CYSI_METRJ       GVITPKQWLILDDIARTYAG-GALRATTRQTFQYHGVIKSNLKRTMAAID-GALLDTIAA
CYSI_METNO       GVVSPKQWLALDEIARTYAN-GTLRATTRQTFQYHGVIKSNLKRTMQAID-AVLLDTIAA
CYSI_METS4       GVVSPRQWLALDDIARTYAN-GTLRATTRQTFQYHGVIKSNLKRTLQAID-AVLLDTIAA
CYSI_CHRSD       GRVSPEQWLTLDDNARRYAN-GTLRITTRQTFQYHGVFKENLRGHLQALD-KAMMDTIAA
                 *     :   :   .        :: .. ::.* * : *  :      .     : :   

CYSI_ECOLC       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_SHIB3       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_ECO55       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_ECOSE       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_ECOLU       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_ECO5E       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_ECO57       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_ECO24       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_ECO8A       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_SHISS       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_SHIBS       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_SHIDS       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_ECOL6       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_ECOBW       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_ECOLI       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_ECOBR       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_ECOK1       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_ECO81       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_ECO45       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_ECOUT       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_ECOL5       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_ECO27       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_SHIFL       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_SHIF8       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_ECOSM       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_ECOHS       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_ECO7I       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_ESCF3       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_CITK8       ANDMNRNVLCTSNPYESELHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_SALA4       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_SALTI       ANDMNRNVLCTSNPYESELHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_SALTY       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_SALCH       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_SALPC       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_SALNS       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_SALPA       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_SALPK       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_SALDC       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_SALG2       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_SALEP       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVAITD-----
CYSI_SALHS       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_SALSV       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_SALPB       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_SALAR       ANDMNRNVLCTSNPYESQLHSEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_ENT38       ANDMNRNVLCTSNPYESELHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI1_KLEP3      ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQKKVATTD-----
CYSI_KLEP7       ANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQKKVATTD-----
CYSI_CROS8       ANDMNRNVLCTSNPVESQLHAEAYEWAKKLSEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_ERWT9       ANDVNRNVLCSSNPIESELHQEAYEWAKKLSEHLLPRTRAYAEIWLDQEKVATTD-----
CYSI_PECAS       ANDMNRNVLCTSNPIESELHQQAYEWAKTISEHLLPRTRAYAEIWMDQEKVATTD-----
CYSI2_PECCP      ANDMNRNVLCTSNPIESELHQQAYEWAKKISEHLLPRTRAYAEIWMDQEKVATTD-----
CYSI_DICP7       ANDVNRNVLCTSNPVESELHSQAYEWAKRISEHLLPRTRAYAEIWLDQEKVAATD-----
CYSI_DICC1       ANDVNRNVLCTSNPVESELHQQAYEWAKKISEHLLPRTRAYAEVWLDKEKVATTD-----
CYSI_YERPE       ANDVNRNVLCTSNPVESALHQEAYEWAKKISEHLLPRTRAYAEIWLDAEKVATTD-----
CYSI_YERPP       ANDVNRNVLCTSNPVESALHQEAYEWAKKISEHLLPRTRAYAEIWLDAEKVATTD-----
CYSI_YERPA       ANDVNRNVLCTSNPVESALHQEAYEWAKKISEHLLPRTRAYAEIWLDAEKVATTD-----
CYSI_YERPN       ANDVNRNVLCTSNPVESALHQEAYEWAKKISEHLLPRTRAYAEIWLDAEKVATTD-----
CYSI_YERP3       ANDVNRNVLCTSNPVESALHQEAYEWAKKISEHLLPRTRAYAEIWLDAEKVATTD-----
CYSI_YERPY       ANDVNRNVLCTSNPVESALHQEAYEWAKKISEHLLPRTRAYAEIWLDAEKVATTD-----
CYSI_YERPS       ANDVNRNVLCTSNPVESALHQEAYEWAKKISEHLLPRTRAYAEIWLDAEKVATTD-----
CYSI_YERPB       ANDVNRNVLCTSNPVESALHQEAYEWAKKISEHLLPRTRAYAEIWLDAEKVATTD-----
CYSI_YERE8       ANDVNRNVLCTSNPVESVLHQEAYEWAKKISEHLLPRTRAYAEIWLDAEKVATTD-----
CYSI_SERP5       ANDVNRNVLCTSNPVESELHQEAYEWAKKISEHLLPRTRAYAEVWLDQEKVATTD-----
CYSI_PHOLL       ANDVNRNVLCTSNPIQSELHQQAYEWAKKISEHLLPRTRAYAELWLDKEKVATTD-----
CYSI_PROMH       ANDVNRNVLCTSNPEQSSLHQEAYEWAKKLSEHLLPRTHAYAEIWLDKEKVATTD-----
CYSI_BUCAI       ANDVNRNVLCTSNPMESLIHQEAYEWARKISNFLLPHTKAYAEIWLDQKKIVTTE-----
CYSI_BUCA5       ANDVNRNVLCTSNPMESLIHQEAYEWARKISNFLLPHTKAYAEIWLDQKKIVTTE-----
CYSI_BUCAT       ANDVNRNVLCTSNPMESLIHQEAYEWARKISNFLLPHTKAYAEIWLDQKKIVTTE-----
CYSI_BUCAP       ANDVNRNVLCTSNPMESLIHQQCYEWVSKISNFLLPQTKAYAEIWLNQKKIATTD-----
CYSI_ZYMMO       ANDVNRNVLCTSNPVESDLHAEAYEWAKKISEHLLPQTHAYAEIWLDQEKLATTD-----
CYSI_ACTPJ       AADMNRNVLCTSNPIESELHQQAYEFAKKISEHLLPRSRGYLDVWVDGKKVESSDDLL--
CYSI_ACTP2       AADMNRNVLCTSNPIESELHQQAYEFAKKISEHLLPRSRGYLDVWVDGKKVESSDDLL--
CYSI_ACTP7       AADMNRNVLCTSNPIESELHQQAYEFAKKISEHLLPRSRGYLDVWVDGKKVESSDDLL--
CYSI_ACTPL       AADMNRNVLCTSNPIESELHQQAYEFAKKISEHLLPRSRGYLDVWVDGKKIESSDDLL--
CYSI_ACTSZ       ASDMNRNVLCSSNPVESELHQEAYEWAKKISEHLLPRTNGYLDVWIAGKKVQSSDSFL--
CYSI_MANSM       ASDMNRNVLCSSNPVESELHQEAYEWAKKISEHLLPRTNGYLDVWISGKKVQSSDSFL--
CYSI_NEIMB       AADMNRNVLCTSNPIESELHRQAYEYAKKISEHLLPRTRGYLDVWVDGKKVQSSDDFL--
CYSI_NEIM0       AADMNRNVLCTSNPIESELHRQAYEYAKKISEHLLPRTRGYLDVWVDGKKVQSSDDFL--
CYSI_NEIMF       AADMNRNVLCTSNPIESELHRQAYEYAKKISEHLLPRTRGYLDVWVDGKKVQSSDDFL--
CYSI_NEIMA       AADMNRNVLCTSNPIESELHRQAYEYAKKISEHLLPRTRGYLDVWVDGKKVQSSDDFL--
CYSI_AERHH       AGDVNRNVLCTSNPVESELHQEAYEWAKKISEHLLPKTRAYVEIWLDGEKLGGDEE----
CYSI_TOLAT       AGDVNRNVLCTSNPVESELHQEAYEWAKKISEHLLPKTRAYAEIWLDGEKLGPDEE----
CYSI_ALIF1       AGDVNRNVLCTTNPVESELHQEAYEWAKKISEHLLPKTRAYAEIWLDGEKLETTDE----
CYSI_ALIFM       AGDVNRNVLCTTNPVESELHQEAYEWAKKISEHLLPKTRAYAEIWLDGEKLETTDE----
CYSI_ALISL       AGDVNRNVLCTTNPVESELHQEAYEWAKKISEHLLPKTRAYAEIWLDGEKLETTDE----
CYSI_VIBTL       AGDVNRNVLCTTNPVESELHQEAYEWAKKISEHLLPKTRAYAEIWLDGEKLATTDE----
CYSI_VIBCB       AGDVNRNVLCTTNPVESELHQEAYEWAKKISEHLLPKTRAYAEIWLDGEKVESTEED---
CYSI_VIBPA       AGDVNRNVLCTTNPVESELHQEAYEWAKKISEHLLPKTRAYAEIWLDGEKVESTEED---
CYSI_VIBVU       AGDVNRNVLCTTNPVESELHQEAYEWAKKISEHLLPKTKAYAEIWLDGEKVETTEDD---
CYSI_VIBVY       AGDVNRNVLCTTNPVESELHQEAYEWAKKISEHLLPKTKAYAEIWLDGEKVETTEDD---
CYSI_VIBCH       AGDVNRNVLCTSNPVESELHLQAYEWAKKISEHLLPKTRAYAEIWLDGEKIEGPDE----
CYSI_VIBCM       AGDVNRNVLCTSNPVESELHLQAYEWAKKISEHLLPKTRAYAEIWLDGEKIEGPDE----
CYSI_VIBC3       AGDVNRNVLCTSNPVESQLHLQAYEWAKKISEHLLPKTRAYAEIWLDGEKIEGPDE----
CYSI_PHOPR       AGDVNRNVLCTTNPIESELHQEAYEWAKKISEHLLPKTRAYAEIWLDGEKVEGGDE----
CYSI_ALTMD       AGDVNRNVLCTSNPVESELHLHAYEWAKKISEHLLPKTRAYAEIWLDGEKVETTEKP---
CYSI_PSEA6       AGDVNRNVLCTSNPIESAVHQEAYEWATKISEHLLPKTRAYAEIWLDGEKKETTDH----
CYSI_PSEHT       AGDVNRNVLCTTNPVESELHQEAYEWAAKISEHLLPKTKAYAEIWLNGEKAETTE-----
CYSI_SHEAM       AGDVNRNVLCTSNPVESELHQQAYEWAAKISEHLLPKTRAYAEIWLGEEKVETTET----
CYSI_COLP3       AGDVNRNVLCTSNPVESALHQEAYEWATKISEHLLPKTRAYAEIWLDEEKVETTEADE--
CYSI_BAUCH       AGDMNRNVLCTSNPVESVLHQQVCNYAKMISEHFLPKTRAYAEIWLDGEKTETTEQ----
CYSI_SODGM       AGDVNRNVLCTSNPVESVLHRQAWEWAKKISEHLLPKTRAYAEIWLDGEKTETTDQ----
CYSI_BLOFL       AGDVNRNVICTANPMESKVHYQIWELSKKISEHLLPKSKAYAEIWLNEKKIESIDS----
CYSI_BLOPB       AGDVNRNVICTANPMESTLHYQVWELAKSISSYLLPKSNAYAEIWLDSKKTESTDS----
CYSI2_KLEP3      AGDVNRNVLCTSNPVESRLHHQAYEWAKKISEHLLPKTNAYAEVWLDGEKIAQPEE----
CYSI1_PECCP      AGDVNRNVLCTANPVESVLHRQSWEWAKKISEHLLPRTNAYAEVWLDKEKIIQPDD----
CYSI_PSYIN       AGDVNRNVICTSNPMQSELHAEVYDWSTKISEMLLPHSNAFAEIWLDGEKVHETE-----
CYSI_SHEB5       CGDVNRNVMCNPNPVESKLHEQAYAVAKQLSDHLLPHTRAYAEIWLDEEKLLSTED----
CYSI_SHEB9       CGDVNRNVMCNPNPVESKLHEQAYAVAKQLSDHLLPHTRAYAEIWLDEEKLLSTED----
CYSI_SHEB2       CGDVNRNVMCNPNPVESKLHEQAYAVAKQLSDHLLPHTRAYAEIWLDEEKLLSTED----
CYSI_SHEB8       CGDVNRNVMCNPNPVESKLHEQAYAVAKQLSDHLLPHTRAYAEIWLDEEKLLSTED----
CYSI_SHEPC       CGDVNRNVMCNPNPVESKLHEQAYAVAKKLSDHLLPHTRAYAEIWLDEEKLLTTED----
CYSI_SHESW       CGDVNRNVMCNPNPVESKLHEQAYAVAKKLSDHLLPHTRAYAEIWLDEEKLLTTED----
CYSI_SHESA       CGDVNRNVMCNPNPVESKLHAQAYEVAKKLSDHLLPHTRAYAEIWLDEEKLLTTED----
CYSI_SHESR       CGDVNRNVMCNPNPVESKLHAQAYEVAKKLSDHLLPHTRAYAEIWLDEEKLLTTED----
CYSI_SHESM       CGDVNRNVMCNPNPVESKLHAQAYEVAKKLSDHLLPHTRAYAEIWLDEEKLLTTED----
CYSI_SHEON       CGDVNRNVMCNPNPVESKLHAQAYEVAKKLSDHLLPHTRAYAEIWLDEEKLLTTED----
CYSI_SHEDO       CGDVNRNVMCNPNPVESKLHAQAYAVAKELSDHLLPHTRAYAEIWLDEEKLVG-------
CYSI_SHEFN       CGDVNRNVMCNPNPVESKLHAQAYAVAKHLSDHLLPHTRAYAEIWLDEEKLLGT------
CYSI_SHEHH       CGDVNRNVMCNPNPVESKLHQQAYAYAKQLSDNMLPHTKAYAEIWLDNEKLVTTEG----
CYSI_SHEPA       CGDVNRNVMCNPNPVESKLHQQAYAYAKQLSDNMLPHTKAYAEIWLDDEKLVTTEG----
CYSI_SHEPW       CGDVNRNVMCNPNPVESKLHQQAYAYAKQLSDNMLPHTKAYAEIWLDDEKLVTTEG----
CYSI_SHESH       CGDVNRNVMCNPNPVESRLHEQAYYWAKKLSDIYLPRTKAYAEIWLGDDKVATSEG----
CYSI_SHEWM       CGDVNRNVMCNPNPVESRLHEQAYYWAKQLSDQYLPRTKAYAEIWLGDDKVATSEG----
CYSI_SHELP       CGDVNRNVMCNPNPVESKLHQQAYYWAKKLSDNYLPRTKAYAEIWLGDDKVAVSES----
CYSI_THIRO       CGDVNRNVLCNPNPVESALHREVYDWAKRISEHLLPRTRAYHEIWLDGEQVGGGED----
CYSI_LEPBA       CGDVNRNVTCTSNPAASPLHKEVFGYAGEISRSLLPKTRAYYEIWLDENLLAEKEEP---
CYSI_LEPBP       CGDVNRNVTCTSNPAASPLHKEVFGYAGEISRSLLPKTRAYYEIWLDENLLAEKEEP---
CYSI_ACIF2       CGDVNRNVIASSAPQISAFHAEAYGWAQKIAEHLLPQSHAYHEIWLGGQQITAP------
CYSI_ACIF5       CGDVNRNVIASSAPQISAFHAEAYGWAQKIAEHLLPQSHAYHEIWLGGQQITAP------
CYSI_XANAC       CGDVNRNVQVAANPLLSQAHATLYADAARVSEHLLPNTRAYYEIWLDEERVSGSGS----
CYSI_XANC5       CGDVNRNVQVAANPLLSQAHATLYADAARVSEHLLPNTRAYYEIWLDEERVSGSGS----
CYSI_XANOM       CGDVNRNVQVAANPLLSQAHATLYADAACVSEHLLPNTRAYYEIWLDEERVSGSGN----
CYSI_XANOP       CGDVNRNVQVAANPLLSQAHATLYADAACVSEHLLPNTRAYYEIWLDEERVSGSGN----
CYSI_XANOR       CGDVNRNVQVAANPLLSQAHATLYADAACVSEHLLPNTRAYYEIWLDEERVSGSGN----
CYSI_XANC8       CGDVNRNVQVAANPLLSQAHATLYADAARVSEHLLPNTRAYYEIWLDEERVSGSGA----
CYSI_XANCB       CGDVNRNVQVAANPLLSQAHATLYADAARVSEHLLPNTRAYYEIWLDEERVSGSGA----
CYSI_XANCP       CGDVNRNVQVAANPLRSQAHATLYADAARVSEHLLPNTRAYYEIWLDEERVSGSGA----
CYSI_XYLF2       CGDVNRNVQVAANPLLSRAHADLYTDAAHLSEHLLPNTRAYYEIWLDEKKVAGAGE----
CYSI_XYLFT       CGDVNRNVQVAANPLLSRAHADLYTDAAHLSEHLLPNTRAYYEIWLDEKKVAGAGE----
CYSI_XYLFM       CGDVNRNVQVAANPLISRAHADLYTDAAHLSEHLLPNTRAYYEIWLDEKKVAGAGE----
CYSI_XYLFA       CGDVNRNVQVAANPLLSRAHADLYTDAAHLSEHLLPNTRAYYEIWLDEKKVAGAGE----
CYSI_MYXXD       CGDVNRNVLCNPNPVDSRVHETVYQWAVRISEHLLPKTRAYYEVWLGKEKVAGG------
CYSI_GEOKA       CGDVNRNVMCNPNPYQSEVHAEVYEWAKLISDHLLPRTRAYYEIWLDDEKVAGTPP----
CYSI_GEOTN       CGDVNRNVMCNPNPYQSEVHAEVYEWAKLLSDHLLPKTRAYYEIWLDDEKVAGTPQ----
CYSI_ANOFW       CGDVNRNVMCNPNPYQSEVHAEVYEWAKRLSDHLLPQTRAYYEIWLDEEKVADTPD----
CYSI_BACVZ       CGDVNRNVMCASNPHQSEIHAEVYEWSKKLSDDLLPRTRAYHEIWLDEERVAGTPD----
CYSI_BACSU       CGDVNRNVMCASNPYQSEIHSEVYEWSKKLSDDLLPRTRAYHEIWLDEERVAGTPE----
CYSI_BACHD       CGDVNRNVMCTSNPYQSEIHQEVYEWSKKLSDDLLPRTRAYHEIWLDEEKVAGTPE----
CYSI_BACLD       CGDVNRNVMCTSNPYQSEIHREVYEWSKKLSDDLLPRTRAYHEIWLDEEKVAGTPD----
CYSI_BACP2       CGDVNRNVMCTSNPYQSEVHHDVYELAKKLSDDLLPQTRAYHEIWLDEEKVAATPD----
CYSI_BACSK       CGDVNRNVMSTPNPYQSEVHGEVYDWAKKLSEALLPKTRAYHEIWLDEEKVAGTPQ----
CYSI_LYSSC       CGDVNRNVMCNVNPNQSALHEEVYNWSAKLSEHLLPRTRAYHELWLDGEKVIDSQD----
CYSI_PAESJ       CGDVSRNVMCNPNPYQSELHSEVFHWSQQLTSHLAPKTPAYHEIWLDGEKVVDGAE----
CYSI_BREBN       CGDVNRNVMCNPNPYESEVHQEVYEWAKKISNHLDPRTRAYHEIWLDEEKVVDSRD----
CYSI_OCEIH       CGDINRNVMCNVNPEQSDVHAEVYEWSKKVSDHLLPETNAYHEIWLEDKKIVDSRE----
CYSI_STAEQ       CGDVNRNTMCNPNPYQSQVHKEINDYATRISNHLLPRTNAYHEIWLDGEKVLDSS-----
CYSI_STAES       CGDVNRNTMCNPNPYQSQVHKEINDYATRISNHLLPRTNAYHEIWLDGEKVLDSS-----
CYSI_STAHJ       CGDVNRNTMCNPNPYQSHIHKEINNYATKISDHLLPKTNAYHEIWLDGEKVLDSS-----
CYSI_STAS1       CGDVNRNVMCNPNPYQSDVHSEINQIASAISRHLSPKTQAYHEIWLDGEKVLDTSD----
CYSI_STACT       CGDVTRNVMCNPNPYQSDIYAEVNRAADSISEHLLPKTTAYHEIWLDGEKVVDTKK----
CYSI_NITOC       CGDVNRNVVCHNNPYLSPLHKTVYEWSKRLSNHFLPQTQAYHEIWMGKEKVAGTLP----
CYSI_NITHX       CGDDTRGVMCTVNPDLSKLHAEVYALAKQASDHAVHRTGAYQEIWYEAERQ------DTD
CYSI_NITWN       CGDDTRGVMSTVNPDLSKLHAEVYALAKRASDHAVHRTGAYKEIWYEAERE------QTD
CYSI_OLICO       CGDDTRGVMATVNPLVSKVHADVYALAKQASEHALHRTGAYREIWYEEERDPSTVKSAPD
CYSI_BORPD       CGDDARGVMCTADPRLSALHAAVYDIARQASDHAIPRMRAYHEIWWGEQRVAS----SDA
CYSI_METSB       CGDVVRGVMASVNPSLSSLHAEVYDDARRVSEHAMPNMRAYHEIWYGEERV------ATS
CYSI_NITEC       CGDDSRGVMATVNPQFPALQAELAALAKTVSDHVIPKTRGYHEIWYGEERI------ASS
CYSI_NITEU       CGDDSRGVMATVNPQFPALQAELAALAKTVSDHVIPKTRAYHEIWYGEERI------ASS
CYSI_METC4       CGDVNRNVMAATNPAQAGAHKIALQLAKDISDTLLPKTGAWREIWLDGERVVGG-----E
CYSI_METEP       CGDVNRNVMAATNPAQAGAHKIALQLAKDISDTLLPKTGAWREIWLDGERVVGG-----E
CYSI_METEA       CGDVNRNVMAATNPAQAGAHKIALQLAKDISDTLLPKTGAWREIWLDGERVVGG-----E
CYSI_METPB       CGDVNRNVMAATNPAQAGAHKAALQLAKDISDTLLPKTGAWREIWLDGERVVGG-----E
CYSI_METRJ       CGDVNRNVMAATNPAQTGAHKAAYQLAKDISDSLLPKTSAWREIWLDGERVVGG-----E
CYSI_METNO       CGDVNRNVMAATNPAQTGAHKAAYQLAKTISDTLLPKTNAWREIWLDGERVVGG-----E
CYSI_METS4       CGDVNRNVMAATNPAQTGAHAAAYRLAKDISDSLLPKTNAWREIWLDGERVAGG-----E
CYSI_CHRSD       CGDVNRNVICTANPHRSPIHRQVHDLAHEISAHLLPRTRAYHEIFLGEERVAGGPR---E
                 . *  *..     *  .             :     .  .: :::   .           

CYSI_ECOLC       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_SHIB3       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_ECO55       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_ECOSE       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_ECOLU       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_ECO5E       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_ECO57       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_ECO24       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_ECO8A       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_SHISS       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_SHIBS       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_SHIDS       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_ECOL6       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_ECOBW       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_ECOLI       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_ECOBR       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_ECOK1       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_ECO81       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_ECO45       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_ECOUT       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_ECOL5       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_ECO27       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_SHIFL       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_SHIF8       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_ECOSM       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_ECOHS       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_ECO7I       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_ESCF3       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_CITK8       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAVAEN--GKLVGFNLLVGGG
CYSI_SALA4       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_SALTI       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_SALTY       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_SALCH       ----EEPILGATYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_SALPC       ----EEPILGATYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_SALNS       ----EEPILGATYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_SALPA       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNLVAIAEN--GKLVGFNLLVGGG
CYSI_SALPK       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNLVAIAEN--GKLVGFNLLVGGG
CYSI_SALDC       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_SALG2       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_SALEP       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_SALHS       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_SALSV       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_SALPB       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_SALAR       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMSFVAIAEN--GKLVGFNLLVGGG
CYSI_ENT38       ----VEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI1_KLEP3      ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_KLEP7       ----EEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_CROS8       ----EEPILGATYLPRKFKTTVVVPPQNDVDLHANDMNFVAIAEN--GKLVGFNLLVGGG
CYSI_ERWT9       ----EEPILGETYLPRKFKTTVVVPPHNDVDLHANDMNFVAIAEN--GRLVGFNLLVGGG
CYSI_PECAS       ----EEPILGSTYLPRKFKTTVVVPPQNDVDLHANDLNFVAIADN--GRLVGFNVLVGGG
CYSI2_PECCP      ----EEPILGSTYLPRKFKTTVVVPPQNDVDLHANDLNFIAIADN--GRLVGFNVLVGGG
CYSI_DICP7       ----EEPILGPTYLPRKFKTTVVIPPQNDVDLHANDMNFVAIADN--GRLVGFNVLVGGG
CYSI_DICC1       ----EEPILGPTYLPRKFKTTVVIPPQNDVDLHANDLNFVAISDN--GQLVGFNVLVGGG
CYSI_YERPE       ----EEPILGATYLPRKFKTTVVIPPQNDVDLHANDLNFVAVADK--GKLIGFNVLVGGG
CYSI_YERPP       ----EEPILGATYLPRKFKTTVVIPPQNDVDLHANDLNFVAVADK--GKLIGFNVLVGGG
CYSI_YERPA       ----EEPILGATYLPRKFKTTVVIPPQNDVDLHANDLNFVAVADK--GKLIGFNVLVGGG
CYSI_YERPN       ----EEPILGATYLPRKFKTTVVIPPQNDVDLHANDLNFVAVADK--GKLIGFNVLVGGG
CYSI_YERP3       ----EEPILGATYLPRKFKTTVVIPPQNDVDLHANDLNFVAVADK--GKLIGFNVLVGGG
CYSI_YERPY       ----EEPILGATYLPRKFKTTVVIPPQNDVDLHANDLNFVAVADK--GKLIGFNVLVGGG
CYSI_YERPS       ----EEPILGATYLPRKFKTTVVIPPQNDVDLHANDLNFVAVADK--GKLIGFNVLVGGG
CYSI_YERPB       ----EEPILGATYLPRKFKTTVVIPPQNDVDLHANDLNFVAVADK--GKLIGFNVLVGGG
CYSI_YERE8       ----EEPILGATYLPRKFKTTVVIPPQNDVDLHANDLNFVAVADK--GKLVGFNVLVGGG
CYSI_SERP5       ----EEPILGATYLPRKFKTTVVIPPQNDVDLHANDMNFVAIAKN--GKLVGFNLLVGGG
CYSI_PHOLL       ----EEPILGSTYLPRKFKTTVVIPPQNDVDLHANDLNFIAIAEG--SKLVGFNVLVGGG
CYSI_PROMH       ----EEPILGETYLPRKFKTSVVIPPYNDVDLHANDMNFIAIAEN--GHLVGFNVLVGGG
CYSI_BUCAI       ----KEPILGKTYLPRKFKTTVVIPPYNDVDLYANDMNFVAITKN--EKIIGFNILIGGG
CYSI_BUCA5       ----KEPILGKTYLPRKFKTTVVIPPYNDVDLYANDMNFVAITKN--EKIIGFNILIGGG
CYSI_BUCAT       ----KEPILGKTYLPRKFKTTVVIPPYNDVDLYANDMNFVAITKN--EKIIGFNILIGGG
CYSI_BUCAP       ----QEPILGKTYLPRKFKTTVVVPPYNDVDLYANDMNFIAITKN--NKIVGFNVLIGGG
CYSI_ZYMMO       ----QEPILGATYLPRKFKTTVVIPPQNDVDIYANDLNFIAISEN--DQLVGFNVLIGGG
CYSI_ACTPJ       -KIEDEPILGKTYLPRKFKTAVAIPPLNDVDVYANDLNFIAIQDE-NGQLCGFNVLVGGG
CYSI_ACTP2       -KIEDEPILGKTYLPRKFKTAVAIPPLNDVDVYANDLNFIAIQDE-NGQLCGFNVLVGGG
CYSI_ACTP7       -KIEDEPILGKTYLPRKFKTAVAIPPLNDVDVYANDLNFIAIQDE-NGQLCGFNVLVGGG
CYSI_ACTPL       -KIEDEPILGKTFLPRKFKTAVAIPPLNDVDVYANDLNFIAIQDD-NGQLCGFNVLVGGG
CYSI_ACTSZ       -GQEDEPILGKTYLPRKYKTAVVLPPLNDVDMYGNDMNFVGIQDE-AGKLVGFNVLVGGG
CYSI_MANSM       -GQEDEPILGNRYLPRKYKTAVVLPPLNDVDLYSNDMNFVGIKDEKTGKLAGFNVLVGGG
CYSI_NEIMB       -Q-EDEPILGKTYLPRKFKTAVVIPPLNDVDCYGNDLDFVAVSDG-NGQLAGFNVLAGGG
CYSI_NEIM0       -Q-EDEPILGKTYLPRKFKTAVVIPPLNDVDCYGNDLDFVAISDG-NGQLAGFNVLAGGG
CYSI_NEIMF       -Q-EDEPILGKTYLPRKFKTAVVIPPLNDVDCYGNDLDFVAVSDG-NGQLAGFNVLAGGG
CYSI_NEIMA       -Q-EDEPILGKTYLPRKFKTAVVIPPLNDVDCYGNDLDFVAISDG-NGQLAGFNVLAGGG
CYSI_AERHH       ------PILGSNYLPRKFKTTVVIPPHNDVDIHANDLNFVAIS--DHGKLVGFNVLVGGG
CYSI_TOLAT       ------PILGSTYLPRKFKTTVVIPPHNDIDVHANDLNFVAIA--EDGKLVGFNVLVGGG
CYSI_ALIF1       -----EPILGSNYLPRKFKTTVVIPPQNDVDVHANDLNFIAIA--DNGKLVGFNVLVGGG
CYSI_ALIFM       -----EPILGSNYLPRKFKTTVVIPPQNDVDVHANDLNFIAIA--DNGKLVGFNVLVGGG
CYSI_ALISL       -----EPILGSNYLPRKFKTTVVIPPQNDVDVHANDLNFIAIA--NNGKLVGFNVLVGGG
CYSI_VIBTL       -----EPILGSNYLPRKFKTTVVIPPQNDVDVHANDLNFIAIA--KDGKLVGFNVLVGGG
CYSI_VIBCB       -----EPILGKNYLPRKFKTTVVIPPQNDVDVHANDLNFVAIA--DNGKLVGFNVLVGGG
CYSI_VIBPA       -----EPILGKTYLPRKFKTTVVIPPQNDVDVHANDLNFVAIA--DNGKLVGFNVLVGGG
CYSI_VIBVU       -----EPILGKTYLPRKFKTTVVIPPQNDVDVHANDLNFVAIA--EKGKLIGFNVLVGGG
CYSI_VIBVY       -----EPILGKTYLPRKFKTTVVIPPQNDVDVHANDLNFVAIA--ENGKLIGFNVLVGGG
CYSI_VIBCH       -----EPILGSNYLPRKFKTTVVIPPHNDVDVHANDLNFVAIG--ENGQLVGFNVLVGGG
CYSI_VIBCM       -----EPILGSNYLPRKFKTTVVIPPHNDVDVHANDLNFVAIG--ENGQLVGFNVLVGGG
CYSI_VIBC3       -----EPILGSNYLPRKFKTTVVIPPHNDVDVHANDLNFVAIG--ENGQLIGFNVLVGGG
CYSI_PHOPR       -----EPILGSNYLPRKFKTTVVIPPQNDVDVHANDLNFIAIA--DNGKLVGFNVLVGGG
CYSI_ALTMD       -V---EPILGDNYLPRKFKTTVVIPPQNDVDVHANDLNFVAIA--ENGQLVGFNVLVGGG
CYSI_PSEA6       -----EPILGANYLPRKFKTTVAIPPLNDVDVHANDLNFIAIS--KDGKLVGFNVLVGGG
CYSI_PSEHT       -----EPILGSNYLPRKFKTTVTIPPNNEVDVHANDLNFVAIA--ENGKLIGFNVLVGGG
CYSI_SHEAM       -----EPVLGDSYLPRKFKTTVVIPPHNDVDVHANDLNFVAIA--ENGQLVGFNVLVGGG
CYSI_COLP3       -I---EPILGSNYLPRKFKTTVVIPPNNDIDVHANDLNFVAIS--EGGELIGFNVLVGGG
CYSI_BAUCH       -----EPILGANYLPRKFKISIVVPPLNDVDLHANDLNFIAIS--NLGQLVGFNVLVGGG
CYSI_SODGM       -----EPILGPTYLPRKFKTTVVVPPLNDVDLHANDLNFVAIS--DNGQLVGFNVLVGGG
CYSI_BLOFL       -----EPILSSVYLPRKFKIAIAVPPVNDVDVYANDLGLVAIK-DNTGNLIGFNVLIGGG
CYSI_BLOPB       -----EPILSATYLPRKFKIAIAIPPINDVDVHANDLSFIAIKSENTDQIIGFNVLVGGG
CYSI2_KLEP3      -----EPILGNNYLPRKFKTAVVIPPQNDVDLHANDLNFIAIG--DNGQLTGFNVLVGGG
CYSI1_PECCP      -----EPILGKSYLPRKFKTAVVIPPQNDVDIHANDLSFVAIG--DGDQLVGFNVLMGGG
CYSI_PSYIN       ----QEPIYGETMLPRKFKTTVVLPPFNDVDVHANDLNFVAIVEN--EKIVGFNVLVGGG
CYSI_SHEB5       --ETVEPVYGKTYLPRKFKMAVAVPPDNDVDVYTNDLGFIAVAEN--GELVGFNLTAGGG
CYSI_SHEB9       --ETVEPVYGKTYLPRKFKMAVAVPPDNDVDVYTNDLGFIAVAEN--GELVGFNLTAGGG
CYSI_SHEB2       --ETVEPVYGKTYLPRKFKMAVAVPPDNDVDVYTNDLGFIAVAEN--GELVGFNLTAGGG
CYSI_SHEB8       --ETVEPVYGKTYLPRKFKMAVAVPPDNDVDVYTNDLGFIAVAEN--GELVGFNLTAGGG
CYSI_SHEPC       --ETVEPVYGKTYLPRKFKMAVAVPPDNDVDVYTNDLGFIAVAEN--GELVGFNLTAGGG
CYSI_SHESW       --ETVEPVYGKTYLPRKFKMAVAVPPDNDVDVYTNDLGFIAVAEN--GELVGFNLTAGGG
CYSI_SHESA       --ETVEPVYGKTYLPRKFKMAVAVPPDNDVDVYTNDLGFIAVAEN--GELVGFNLTAGGG
CYSI_SHESR       --ETVEPVYGKTYLPRKFKMAVAVPPDNDVDVYTNDLGFIAVAEN--GELVGFNLTAGGG
CYSI_SHESM       --ETVEPVYGKTYLPRKFKMAVAVPPDNDVDVYTNDLGFIAVAEN--GELVGFNLTAGGG
CYSI_SHEON       --ETVEPVYGKTYLPRKFKMAVAVPPDNDVDVYTNDLGFIAVAEN--GELVGFNLTAGGG
CYSI_SHEDO       --ETVEPVYGNTYLPRKFKMAVSVPPDNDVDVYTNDLGFIAIAED--GQLVGFNLVAGGG
CYSI_SHEFN       --ETVEPVYGKTYLPRKFKMAVAVPPHNDVDVYTNDLGFIAVSEA--GELIGFNLVAGGG
CYSI_SHEHH       --EEVEPVYGQTYLPRKFKMAVAVPPDNDVDVYTNDLGFIAVAEG--DELVGFNMVAGGG
CYSI_SHEPA       --EEVEPVYGKTYLPRKFKMAVAVPPDNDVDVYTNDLGFVAVAEG--DELVGFNMVAGGG
CYSI_SHEPW       --EEVEPVYGKTYLPRKFKMAVAVPPDNDVDVYTNDLGFVAVAEE--GELVGFNMVAGGG
CYSI_SHESH       --DEVEPIYGKTYLPRKFKMAVAVPPDNDVDVYTNDLGLIAVAQE--GELVGFNLVAGGG
CYSI_SHEWM       --DDVEPVYGKTYLPRKFKMAVAVPPDNDVDVYTNDLGFVAVAEE--GELVGFNLVAGGG
CYSI_SHELP       --EEVEPVYGKTYLPRKFKMAVAVPPDNDVDVYTNDLGFIAVAED--GELVGFNMVAGGG
CYSI_THIRO       ----VEPIYGRTYLPRKFKTAVGVPPHNDVDVYANDLGFAAVADG--SRLIGFNV-SAGG
CYSI_LEPBA       ----EDPLYKDVYLPRKFKIAIAIPPYNDVDLFTNDIGLIAIIEN--GQLLGFNVAVGGG
CYSI_LEPBP       ----EDPLYKDVYLPRKFKIAIAIPPYNDVDLFTNDIGLIAIIEN--GQLLGFNVAVGGG
CYSI_ACIF2       ---EEDLLYGSTYLPRKFKIAIAVPPHNDVDVLTQDLGFIAIH-EE-GRLAGFNVCVGGG
CYSI_ACIF5       ---EEDLLYGSTYLPRKFKIAIAVPPHNDVDVLTQDLGFIAIH-EE-GRLAGFNVCVGGG
CYSI_XANAC       ---EDEPIYGERYLPRKFKIGFAAPPLNDVDVFANDLGFIAIL-RD-GQLLGYNVSIGGG
CYSI_XANC5       ---EEEPIYGERYLPRKFKIGFAAPPLNDVDVFANDLGFIAIL-RD-GQLLGYNVSIGGG
CYSI_XANOM       ---EDEPIYGDRYLPRKFKIGFAAPPLNDVDVFANDLGFIAIL-RD-GRLLGYNVSIGGG
CYSI_XANOP       ---EDEPIYGDRYLPRKFKIGFAAPPLNDVDVFANDLGFIAIL-RD-GRLLGYNVSIGGG
CYSI_XANOR       ---EDEPIYGDRYLPRKFKIGFAAPPLNDVDVFANDLGFIAIL-RD-GRLLGYNVSIGGG
CYSI_XANC8       ---EDEPIYGDRYLPRKFKIGFAAPPHNDVDVFANDLGFIAIL-RE-GQLLGYNVSIGGG
CYSI_XANCB       ---EDEPIYGDRYLPRKFKIGFAAPPHNDVDVFANDLGFIAIL-RE-GQLLGYNVSIGGG
CYSI_XANCP       ---EDEPIYGDRYLPRKFKIGFAAPPHNDVDVFANDLGFIAIL-RE-GQLLGYNVSIGGG
CYSI_XYLF2       ---EEEPIYGPHYLPRKFKIGFAAPPINDVDVFANDLGFIAVI-VD-NTLLGYNVTIGGG
CYSI_XYLFT       ---EEEPIYGPHYLPRKFKIGFAAPPINDVDVFANDLGFIAVI-VD-NTLLGYNVTIGGG
CYSI_XYLFM       ---EEEPIYGPHYLPRKFKIGFAAPPINDVDVFANDLGFIAVI-VD-KTLLGYNVTIGGG
CYSI_XYLFA       ---EEEPIYGPHYLPRKFKIGFAAPPINDVDVFANDLGFIAVI-VD-NTLLGYNVAIGGG
CYSI_MYXXD       ---EDEPIYGATYLPRKFKAAVAVPPLNDVDVFAQDLGFIAII-EG-DALVGFNVSVGGG
CYSI_GEOKA       VDGEEEPIYGPTYLPRKFKIGIAVPPSNDVDVFSQDIGFIAIV-ED-GKLAGFNVAIGGG
CYSI_GEOTN       VDGEEEPIYGPTYLPRKFKIGIAVPPSNDVDVFSQDIGLIAIV-ED-GKLAGFNVAIGGG
CYSI_ANOFW       VE--QEPIYGALYLPRKFKIGIAVPPSNDVDVFSQDLGFIAIV-EH-GKLAGFNVAIGGG
CYSI_BACVZ       --TETEPMYGPLYLPRKFKIGIAVPPSNDIDVYSQDLGFIAIV-EE-GRLIGFNVAIGGG
CYSI_BACSU       --EEVEPMYGPLYLPRKFKIGIAVPPSNDIDVFSQDLGFIAIV-ED-GKLIGFNVAIGGG
CYSI_BACHD       A-EEVEPMYGPLYLPRKFKIGIAVPPSNDIDVFSQDLGFIAIV-ED-DKLVGFNVAIGGG
CYSI_BACLD       A-DEVEPMYGPLYLPRKFKIGIAVPPSNDIDVFSQDLGFIAIV-ED-DKLIGFNVAIGGG
CYSI_BACP2       --TEVEPMYGPLYLPRKFKIGVAVPPANDIDVFSQDLGFIAII-EN-EQLIGFNVAIGGG
CYSI_BACSK       Q-DEVEPMYGPLYLPRKFKIGVAVPPANDVDIFSQDIGFIAIL-EE-GKLTGFNVACGGG
CYSI_LYSSC       --DEIEPIYGAQYLPRKFKIAIAIPPSNDVDVFSQDIGLIAIV-ED-EKLIGFNVAVGGG
CYSI_PAESJ       Q-GEVEPIYGPVYLPRKFKIGIAVPPSNDVDVYSQDLGYIAILGED-GKLAGFNVCVGGG
CYSI_BREBN       E-VEQEPIYGPVYLPRKFKIGIAVPPANDVDVFSQDLGFIAIH-EE-GRLLGFNVAVGGG
CYSI_OCEIH       ---ESEPIYGSTYLPRKFKIGIAVPPSNDIDIYSQDLGFIAIV-EE-GKLLGFNVAVGGG
CYSI_STAEQ       --EEKEPIYGNTYLPRKFKIGIAVPPSNDIDVYSQDIGLIAIV-EQ-DELIGFNVTIGGG
CYSI_STAES       --EEKEPIYGNTYLPRKFKIGIAVPPSNDIDVYSQDIGLIAIV-EQ-DELIGFNVTIGGG
CYSI_STAHJ       --EEIEPMYGKKYLPRKFKIGIALPPSNDIDVYSQDIGLIGIV-ED-ETLVGFNVTVGGG
CYSI_STAS1       --EEPEPIYGKTYLPRKFKIGIAVPPSNDIDVYSQDIGLIAIL-EN-EQLVGFNVAVGGG
CYSI_STACT       --EDHEPMYGKTYLPRKFKIGIAVPPSNDIDVYSQDIGLIGIV-EN-DELIGYNVSVGGG
CYSI_NITOC       --ENEEPIYGETYLPRKFKIGITIPPNNEIDVFSQDLGLIAIA-KG-SRLVGFNICVGGG
CYSI_NITHX       --GPEEPFYGRTYMPRKFKIGFAIPPSNDIDVYGQDLGFIAIARR--GKLKGFNVAIGGG
CYSI_NITWN       --GPEEPFYGRTYMPRKFKIGFAIPPSNDIDVYGQDLGFIAIAHR--GKLKGFNVAIGGG
CYSI_OLICO       --GSEEPFYGRTYMPRKFKIGFAVPPSNDIDVYAQDLGFIAIVKR--GKLAGFNVAIGGG
CYSI_BORPD       --GPEEPFYGQTYLPRKFKIGFVIPPVNDIDVYAQDLGFIAIAGDD-GALQGFNVAIGGG
CYSI_METSB       --EPEEPFLGKQYLPRKFKIGLVIPPYNDIDVYTQDLGFIAIAEN--GRLIGYNIVIGGG
CYSI_NITEC       --EPEEPFYGRTYMPRKFKIGFVIPPNNDIDIYAQDLGYIAIAGKD-GKIAGFNIAIGGG
CYSI_NITEU       --EPEEPFYGQTYMPRKFKIGFVIPPNNDIDIYAQDLGYIAIIGEN-GKIAGFNVAIGGG
CYSI_METC4       DAAEVEPVYGKTYLPRKFKTVVAVPPSNEVDIFAHDLGFIAILDKK-NRVTGWNVTVGGG
CYSI_METEP       DAAEVEPVYGKTYLPRKFKTVVAVPPSNEVDIFAHDLGFIAILDKK-NRVTGWNVTVGGG
CYSI_METEA       DAAEVEPVYGKTYLPRKFKTVVAVPPSNEVDIFAHDLGFIAILDKK-NRVTGWNVTVGGG
CYSI_METPB       DEAEVEPVYGKTYLPRKFKTVVAVPPSNEVDIFAHDLGFIAILDKK-NRVTGWNVTVGGG
CYSI_METRJ       DEAEVEPVYGRTYLPRKFKTVVAVPPSNEVDIFAHDLGFIAILDKK-NQVTGWNVTVGGG
CYSI_METNO       D-EAVEPIYGKTYLPRKFKIVVAVPPSNEVDIFAHDLGFIAILDKK-NKLKGWNVTVGGG
CYSI_METS4       D-EAAEPVYGRTYLPRKFKTVVAVPPSNEVDVFAHDLGFIAILDKK-NALKGWNVTVGGG
CYSI_CHRSD       AEDEVEPLYTRHYLPRKFKVALAIPPENDVDVFAHDVGFIADV-QA-GELKGFNVCIGGG
                        .     :***:*  .  ** *::*   :*:.  .        : *:*:  .**

CYSI_ECOLC       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_SHIB3       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_ECO55       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_ECOSE       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_ECOLU       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_ECO5E       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_ECO57       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_ECO24       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_ECO8A       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_SHISS       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_SHIBS       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_SHIDS       LSIEHGNKKTYARAASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_ECOL6       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_ECOBW       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_ECOLI       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_ECOBR       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_ECOK1       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_ECO81       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_ECO45       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_ECOUT       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_ECOL5       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_ECO27       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_SHIFL       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_SHIF8       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_ECOSM       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_ECOHS       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_ECO7I       LSIEHGNRKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_ESCF3       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_CITK8       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_SALA4       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGL
CYSI_SALTI       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGL
CYSI_SALTY       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGL
CYSI_SALCH       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_SALPC       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_SALNS       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_SALPA       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_SALPK       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_SALDC       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGL
CYSI_SALG2       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGL
CYSI_SALEP       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGL
CYSI_SALHS       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGL
CYSI_SALSV       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGL
CYSI_SALPB       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGL
CYSI_SALAR       LSIEHGNKKTYARTASEFGFLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGL
CYSI_ENT38       LSIEHGNKKTYARTASEFGYIPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI1_KLEP3      LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_KLEP7       LSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_CROS8       LSIEHGNKKTYARTATEFGYIPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGP
CYSI_ERWT9       LSIDHGNKATYARTASEFGYLPLSKILDVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGP
CYSI_PECAS       LSIAHGDKETYPRTASELGYISIEHTLAIAEAVVTTQRDWGNRTNRKNAKTKYTLERVGV
CYSI2_PECCP      LSIAHGDKATYPRTASELGYISIEHTLAIAEAVVTTQRDWGNRTNRKNAKTKYTLERVGV
CYSI_DICP7       LSIAHGDKATYPRTASELGYISVDHTLAIAEAVVTTQRDWGNRTNRKNAKTKYTLERVGI
CYSI_DICC1       LSIAHGDKTTYPRTASELGYIPLAQTLAVAEAVVTTQRDWGNRTNRKNAKTKYTLERVGV
CYSI_YERPE       LSIAHGDKNTYPRKASEFGYIPLKHTLAIAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_YERPP       LSIAHGDKNTYPRKASEFGYIPLKHTLAIAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_YERPA       LSIAHGDKNTYPRKASEFGYIPLKHTLAIAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_YERPN       LSIAHGDKNTYPRKASEFGYIPLKHTLAIAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_YERP3       LSIAHGDKNTYPRKASEFGYIPLKHTLAIAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_YERPY       LSIAHGDKNTYPRKASEFGYIPLKHTLAIAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_YERPS       LSIAHGDKNTYPRKASEFGYIPLKHTLAIAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_YERPB       LSIAHGDKNTYPRKASEFGYIPLKHTLAIAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_YERE8       LSIAHGDKNTYPRKASEFGYIPLQHTLAIAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_SERP5       LSIEHGNKKTYARQASEFGYIPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGV
CYSI_PHOLL       LAMTHGDKNTYPSMASEFGYIPLEHTLAIAEAVVTTQRDWGNRTERKNAKTKYTLERVGV
CYSI_PROMH       LAMTHGDKKTFPRLASEFGYIPIDKTLAVAEAIVTTQRDWGNRTERKNAKTKYTLERVGI
CYSI_BUCAI       LSFIHGNKNTWPFLATEIGYISVENTLSIAKAIVTTQRDWGNRTDRANAKTRYTINNFGL
CYSI_BUCA5       LSFIHGNKNTWPFLATEIGYISVENTLSIAKAIVTTQRDWGNRTDRANAKTRYTINNFGL
CYSI_BUCAT       LSFIHGNKNTWPFLATEIGYISVENTLSIAKAIVTTQRDWGNRTDRANAKTRYTINNFGL
CYSI_BUCAP       LSINHGNKNTWPFLAVELGYITLEKTLSVAESIVTTQRDWGNRTDRKNAKTRYTIAKVGL
CYSI_ZYMMO       LSITIGDKTTHPGVAKDIGYIEKEKVLAVAEAVVTTQRDWGNRSNRKNARLRYTLERVGL
CYSI_ACTPJ       LSFEHGNTKTYPNVAYSLGFVPLEHTLAAAEGVVKTQRDFGNRSDRKNARVRYTVQNMTL
CYSI_ACTP2       LSFEHGNTKTYPNVAYSLGFVPLEHTLAAAEGVVKTQRDFGNRSDRKNARVRYTVQNMTL
CYSI_ACTP7       LSFEHGNTKTYPNVAYSLGFVPLEHTLAAAEGVVKTQRDFGNRSDRKNARVRYTIQNMTL
CYSI_ACTPL       LSFEHGNTKTYPNVAYSLGFVPLEHTLAAAEGVVKTQRDFGNRSDRKNARVRYTIQNMTL
CYSI_ACTSZ       LSFEHGNTKTYPNVALELGYIPVEQTLKAAECIVTTQRDFGNRADRKNARLRYTLQNMTL
CYSI_MANSM       LSFEHGNTKTYPNIALELGYVPVEDTLKAAESIVTTQRDFGNRADRKNARLRYTIQNMTL
CYSI_NEIMB       LSMEHGNTKTYPNISLELGFVPPEHALKAAEAVVTTQRDFGNRSDRKNARTRYTIQNMGL
CYSI_NEIM0       LSMEHGNTKTYPNISLELGFVPPEHALKAAEAVVTTQRDFGNRSDRKNARTRYTIQNMGL
CYSI_NEIMF       LSMEHGNTKTYPNISLELGFVPPEHALKAAEAVVTTQRDFGNRSDRKNARTRYTIQNMGL
CYSI_NEIMA       LSMEHGNTKTYPNISLELGFVPPEHALKAAEAVVTTQRDFGNRSDRKNARTRYTIQNMGL
CYSI_AERHH       LAMTHGDTSTYPRKASDFGFVPLSHVLEVAAAVVSTQRDWGNRVNRKNAKTKYTLERVGV
CYSI_TOLAT       LAMTHGNKETFPRKADDFGFIRKEDTLKFAEAVVTTQRDWGNRVNRQNAKTKYTLERVGV
CYSI_ALIF1       LAMTHGDTATYPRKADDFGFVPLDKTLDVAAAVVTTQRDWGNRSNRKNAKTKYTLDRVGS
CYSI_ALIFM       LAMTHGDTATYPRKADDFGFVPLKKTLEVAAAVVTTQRDWGNRSNRKNAKTKYTLDRVGS
CYSI_ALISL       LAMTHGDTATYPRRADDFGFVPLEKTLEVAAAVVTTQRDWGNRSNRKNAKTKYTLDRVGV
CYSI_VIBTL       LAMTHGDTSTYARKADDFGFVPLEKTLDVAAAVVTTQRDWGNRSNRKNAKTKYTLDRVGI
CYSI_VIBCB       LAMTHCDTSTYPRRADDFGFIPLEKTLDVAAAVVTTQRDWGNRSNRKNAKTKYTLDRVGS
CYSI_VIBPA       LAMTHGDTSTYPRRADDFGFIPLEKTLDVAAAVVTTQRDWGNRSNRKNAKTKYTLDRVGT
CYSI_VIBVU       LAMTHGDTSTYPRRADDFGYIPLEKTLDVAAAVVTTQRDWGNRSNRKNAKTKYTLDRVGT
CYSI_VIBVY       LAMTHGDTSTYPRRADDFGYIPLEKTLDVAAAVVTTQRDWGNRSNRKNAKTKYTLDRVGT
CYSI_VIBCH       LAMTHGDTSTYPRRADDFGFIPLEKTLEVAAAVVSTQRDWGNRSNRKNAKTKYTLDRVGV
CYSI_VIBCM       LAMTHGDTSTYPRRADDFGFIPLEKTLEVAAAVVSTQRDWGNRSNRKNAKTKYTLDRVGV
CYSI_VIBC3       LAMTHGDTSTYPRRADDFGFIPLEKTLEVAAAVVSTQRDWGNRSNRKNAKTKYTLDRVGV
CYSI_PHOPR       LAMTHGDKTTYPRRADDFGFIPLVNTLEVAAAVVTTQRDWGNRSNRKNAKTKYTLDRVGV
CYSI_ALTMD       LAMTHGDKSTYPRKASDFGFIPLENTLDVAAAVVTTQRDWGNRVNRKNAKTKYTLERVGV
CYSI_PSEA6       LAMTHGDHATFPRKASDFGFIKVEDTLAIAEAVVSTQRDWGNRVNRKNAKTKYTLERVGV
CYSI_PSEHT       LAMTHGDTATYPRKADDFGFIPLEHTLKIAEHVVSVQRDWGNRSNRKNAKTKYTLDRVGV
CYSI_SHEAM       LAMTHGDKSTYPRRAEDLGFIGLEHVLKVAEHVVTVQRDYGDRVNRKNAKTKYTLDRIGV
CYSI_COLP3       LAMTHGDKATYPRCADDFGFIPKEHTLAIAAAVVTTQRDWGNRVNRKNAKTKYTLDRVGV
CYSI_BAUCH       LAMTHNDKSTYPRTASELGYISVVDTIKIAEAVITTQRDLGDRSNRKHAKTKYTIERVGV
CYSI_SODGM       LAMTHGDKSTYPRKASEFGFIALDDTLKIAEAVVTTQRDWGNRSNRKNAKTKYTLESEGV
CYSI_BLOFL       LAMTYGDKSTYPRMASEFGYINLQDILKIVESVITVQRDWGDRYNRRHAKTKYTLVKVGI
CYSI_BLOPB       LAMTYGDITTYPRKASAFGYISTKDVLKIAETVVTVQRDWGNRSDRRHAKTKYTLTRVGV
CYSI2_KLEP3      LAMTHGDQSTYPRLATELGYIPLNATLAVATAVVATQRDLGNRANRRNAKTKYTIDRLGI
CYSI1_PECCP      LAMTQGDTSTYPRLATEFGFIPLAHTLAIAEAVVSTQRDWGNRENRRNAKTKYTLERVGA
CYSI_PSYIN       LGITHGDKTTFPRKADDFGFIAAEDILEIAKAVVTTQRDLGGRTSRSHARTKYTLETHGV
CYSI_SHEB5       MGSTHGEVETFPRLADDFGFIKTEDVMKFAEAVMTVQRDWGNRVNRKRSRLKYTIVDHGY
CYSI_SHEB9       MGSTHGEVETFPRLADDFGFIKTEDVMKFAEAVMTVQRDWGNRVNRKRSRLKYTIVDHGY
CYSI_SHEB2       MGSTHGEVETFPRLADDFGFIKTADVMKFAEAVMTVQRDWGNRVNRKRSRLKYTIVDHGY
CYSI_SHEB8       MGSTHGEVETFPRLADDFGFIKTEDVMKFAEAVMTVQRDWGNRVNRKRSRLKYTIVDHGY
CYSI_SHEPC       MGSTHGEVETFPRLADDFGFIKTEDVMKFAEAVMTVQRDWGNRSNRKRSRLKYTIVDHGY
CYSI_SHESW       MGSTHGEVETFPRLADDFGFIKTEDVMKFAEAVMTVQRDWGNRSNRKRSRLKYTIVDHGY
CYSI_SHESA       MGSTHGEVETFPRLADDFGFIKTEDVMKFAEAVMTVQRDWGNRTNRKRSRLKYTIVDHGY
CYSI_SHESR       MGSTHGEVETFPRLADDFGFIKTEDVMKFAEAVMTVQRDWGNRTNRKRSRLKYTIVDHGY
CYSI_SHESM       MGSTHGEVETFPRLADDFGFIKTEDVMKFAEAVMTVQRDWGNRTNRKRSRLKYTIVDHGY
CYSI_SHEON       MGSTHGEVETFPRLADDFGFIKTEDVMKFAEAVMTVQRDWGNRTNRKRSRLKYTIVDHGY
CYSI_SHEDO       MGSTHGEVETFPRLADDFGFIKTADVIKFAEAVMTVQRDWGNRVVRKRARLKYTIVDHGF
CYSI_SHEFN       MGSTHGEVETFPRLADDFGFIKTDDVTKFAEAVMTVQRDWGNRVVRKRARLKYTIVDHGY
CYSI_SHEHH       MGSTHGEVSTFPRLADDFGYIKAEDSLKFAEAVMTIQRDWGNRENRKLSRLKYTIVKHGF
CYSI_SHEPA       MGSTHGEVSTFPRLADDFGYIKAEDTLKFAEAVMTIQRDWGNRENRKLSRLKYTIVKHGF
CYSI_SHEPW       MGSTHGEVATFPRLADDFGYIKAEDTLKFAEAVMTVQRDWGNRENRKLSRLKYTIVKHGY
CYSI_SHESH       MGSTHGEVETFPRLADDFGFIKAEDTLKFAEAILKVQRDWGNRSNRKQSRLKYTIVKHGY
CYSI_SHEWM       MGSTHGEVQTFPRLADDFGFIKAEDTLKFAEAVLKVQRDWGNRSNRKLSRLKYTIVKYGY
CYSI_SHELP       MGSTHGEVATFPRLGDDFGFIKAEDCLKFAEAVLKVQRDWGNRSDRKQSRLKYTIVKHGF
CYSI_THIRO       TGRNTGIPATFPRLADVLGFVEPERTLAVAEAVVTTQRHFGDRLDRTQARLKYTIERMGL
CYSI_LEPBA       LGTTHGNPDTYPRVGTVFGFIPKKDILRVVYEIVTVQRDFGNREDRKLSRLKYTLDRLGV
CYSI_LEPBP       LGTTHGNPDTYPRVGTVFGFIPKKDILRVVYEIVTVQRDFGNREDRKLSRLKYTLDRLGV
CYSI_ACIF2       LGRSHNKPDTYSRLADVCGFCAPGQVLAIAEAVLITQRDHGDRSNRSHARLKYTVDRMGL
CYSI_ACIF5       LGRSHNKPDTYSRLADVCGFCAPGQVLAIAEAVLITQRDHGDRSNRSHARLKYTVDRMGL
CYSI_XANAC       MGASHGDAETWPRVANVIGFVTREQLLDIATAVVTTQRDFGNRAVRKRARFKYTIDDHGL
CYSI_XANC5       MGASHGDAETWPRVANVIGFVTRDQLLDIATAVVTTQRDFGNRAVRKRARFKYTIDDHGL
CYSI_XANOM       MGASHGDAQTWPRVANVIGFVTRDQLLDIATAVVTTQRDFGNRAVRKRARFKYTIDDHGL
CYSI_XANOP       MGASHGDAQTWPRVANVIGFVTRDQLLDIATAVVTTQRDFGNRAVRKRARFKYTIDDHGL
CYSI_XANOR       MGASHGDAQTWPRVANVIGFVTRDQLLDIATAVVTTQRDFGNRAVRKRARFKYTIDDHGL
CYSI_XANC8       MGASHGDAETWPRVANVIGFVTGDQLLDIATAVVTTQRDLGNRAVRKRARFKYTIDDHGL
CYSI_XANCB       MGASHGDAETWPRVANVIGFVTGDQLLDIATAVVTTQRDLGNRAVRKRARFKYTIDDHGL
CYSI_XANCP       MGASHGDAETWPRVANVIGFVTGDQLLDIATAVVTTQRDLGNRAVRKRARFKYTIDDHGL
CYSI_XYLF2       MGTTHGDPDTWPRVGNIIGFITRADLITISTAIVTTQRDFGNRTLRKRARFKYTIDDRGL
CYSI_XYLFT       MGTTHGDPDTWPRVGNIIGFITRADLITISTAIVTTQRDFGNRTLRKRARFKYTIDDRGL
CYSI_XYLFM       MGTTHGDPDTWPRIGNIIGFITRADLITISTAIVTTQRDFGNRTLRKRARFKYTIDDRGL
CYSI_XYLFA       MGTTHGDPDTWPRVGNIIGFITRADLIAISTAIVTTQRDFGNRTLRKRARFKYTIDDRGL
CYSI_MYXXD       MGATHGDAATYPRLADVVGFIPPEQTLAVAEEVVKIHRDFGDRTNRKHARLKYVLEERGV
CYSI_GEOKA       MGMTHGDKTTYPQLAKVIGFCKPDQVVEVAEKIMTVQRDYGNRSSRKHARFKYTIDRLGL
CYSI_GEOTN       MGMTHGDKTTYPQLAKVIGFCTPDQVVEVAEKIMTVQRDYGNRSVRKNARFKYTIDRLGL
CYSI_ANOFW       MGMTHGDRTTYPQLAKVIGFCKPEQVIDVAEKVVTIQRDYGNRSVRKHARFKYTIDRLGL
CYSI_BACVZ       MGMTHGDTATYPQLSKVIGFCKPEQLYDVAEKTITIQRDYGNRSVRKNARFKYTVDRLGL
CYSI_BACSU       MGMTHGDTATYPQLAKVIGFCRPEQMYDVAEKTITIQRDYGNRSVRKNARFKYTVDRLGL
CYSI_BACHD       MGMTHGDKATYPQLAKVIGFCKPEQIYDVAEKIITIQRDYGNRSVRKNARFKYTVDRLGL
CYSI_BACLD       MGMTHGDKATYPQLAKVIGFCKPEQLYDVAEKTITIQRDYGNRSVRKNARFKYTVDRLGL
CYSI_BACP2       MGMTHGDTATYPQLAKVIGFCTPEQVVEIAKQVITIQRDYGNRSVRKNARFKYTVDRLGL
CYSI_BACSK       MGMTHGDTKTYPQLGRIIGFCEPQQIMDVAEKLITIQRDYGNRSVRKYARFKYTIDRRGL
CYSI_LYSSC       MGMTHGDHATYPQLAREIGFITPDKLLETAEKIITIQRDYGNRSVRKNARFKYTIDARGL
CYSI_PAESJ       MGMTHGDTATYPQLAKVIGFVTPDQVLDLAEKVVTIQRDYGNRSVRKYARFKYTIDRHGL
CYSI_BREBN       MGMTHGDPKTYPQVARVIGFVTPEQVLEVAEKTVMIQRDYGDRAVRKHARFKYTIDDRGI
CYSI_OCEIH       MGMTHGDTNTYPQISRVIGFCVPEKVTEVAEKVVTIQRDFGNRSNRKNARFKYTIDSRGI
CYSI_STAEQ       MGMTHGITETYPQLGRLIGFIPKEKVVDVCEKILTIQRDYGNRENRKNARFKYTVDRLGE
CYSI_STAES       MGMTHGITETYPQLGRLIGFIPKEKVVDVCEKILTIQRDYGNRENRKNARFKYTVDRLGE
CYSI_STAHJ       MGMTHGNTDTYPQVGRLAGFVPKEQVVDVCEKILTIQRDYGNRENRKNARFKYTVDRLGV
CYSI_STAS1       MGMKHGNTATYPQVGRLIGYIPKEEVVDVCEKILTVQRDYGNREERTNARFKYTVDRLGV
CYSI_STACT       MGMKHDDLRTYPQVGKVIGFIPKDKAEEVCEKILTIQRDYGDRSDRMQARFKYTVDRKGL
CYSI_NITOC       MGMTHSEPSTYPRLGDVIGFCTPSQLLEVAENILKIQRDFGNRCDRKQARLKYTIDSRSI
CYSI_NITHX       LGRTDQSPKTYPRLATVIGYIDADKLFPTIDAVMSVQRDYGDRLDRLHARFKYTIDEKGL
CYSI_NITWN       LGRTDQSPKTYPRLASVIGYIDADKLFPTIDAVMSVQRDYGDRLDRLHARFKYTIDEKGI
CYSI_OLICO       LGRTDQAPKTYPRLASVIGYVGVDKLFQTIDAVMSVQRDYGDRVDRLHARFKYTIDDKGL
CYSI_BORPD       MGRTDQAPATYPRLADVIGFVPPEAVIATCDAVMGVQRDYGNRKDRARARFKYTIDEHGL
CYSI_METSB       MGRTDQAPETYPRLGDVIGFIPKEQILAATDAVVGTQRDFGDRTVRAHARFKYTIDTHGL
CYSI_NITEC       MGRTDKVPHTYPRTASVIGFITPDRLISVTEAVMGVQRDYGNRADRSRARFKYTIDDKGL
CYSI_NITEU       MGRTDKAPHTYPRTASVIGFITPDRLISVTEAVMGVQRDYGNRADRSRARFKYTIDDKGL
CYSI_METC4       MGMTHGEADTFPRTADVLGFVQPEDALKAAEAVMTVQRDWGNRKNRKNARLKYTIERFGL
CYSI_METEP       MGMTHGETDTFPRTADVLGFVQPEDALKAAEAVMTVQRDWGNRKNRKNARLKYTIERFGL
CYSI_METEA       MGMTHGESDTFPRTADVLGFVQPEDALKAAEAVMTVQRDWGNRKNRKNARLKYTIERFGL
CYSI_METPB       MGMTHGETDTFPRTADVLGFVKPEDALKAAEAVMTVQRDWGNRKNRKNARLKYTIERFGL
CYSI_METRJ       MGMTHGEPDTFPRTADVMGFVKPEDALKVAEAVMTVQRDWGNRKNRKNARLKYTIERYGL
CYSI_METNO       MGMTHGETDTFPRTADVMAFCEPEDALKVAEAVMTVQRDWGNRKSRKNARLKYTIERYGL
CYSI_METS4       MGMTHGEPDTFPRTADLLGFCEPADALKVAEAVMTVQRDWGNRKSRKNARLKYTIERYGL
CYSI_CHRSD       MGMTHGEPATFPRLSDIVGYCTPDRVVAVAEAIMLVQRDNGNRHDRKQARLKYTVEALGV
                  .       * .  .   .:             :  :*. *.*  *  :: :*.:     

CYSI_ECOLC       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-DNWHLTLFIENGRILDYPG---
CYSI_SHIB3       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-DNWHLTLFIENGRILDYPG---
CYSI_ECO55       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-DNWHLTLFIENGRILDYPG---
CYSI_ECOSE       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-DNWHLTLFIENGRILDYPG---
CYSI_ECOLU       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-DNWHLTLFIENGRILDYPG---
CYSI_ECO5E       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-DNWHLTLFIENGRILDYPG---
CYSI_ECO57       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-DNWHLTLFIENGRILDYPG---
CYSI_ECO24       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-DNWHLTLFIENGRILDYPG---
CYSI_ECO8A       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-DNWHLTLFIENGRILDYPG---
CYSI_SHISS       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-DNWHLTLFIENGRILDYPG---
CYSI_SHIBS       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-DNWHLTLFIENGRILDYPG---
CYSI_SHIDS       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-DNWHLTLFIENGRILDYPG---
CYSI_ECOL6       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-DNWHLTLFIENGRILDYPG---
CYSI_ECOBW       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-DNWHLTLFIENGRILDYPA---
CYSI_ECOLI       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-DNWHLTLFIENGRILDYPA---
CYSI_ECOBR       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-DNWHLTLFIENGRILDYPA---
CYSI_ECOK1       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-DNWHLTLFIENGRILDYPG---
CYSI_ECO81       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-DNWHLTLFIENGRILDYPG---
CYSI_ECO45       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-DNWHLTLFIENGRILDYPG---
CYSI_ECOUT       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-DNWHLTLFIENGRILDYPG---
CYSI_ECOL5       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-DNWHLTLFIENGRILDYPG---
CYSI_ECO27       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-DNWHLTLFIENGRILDYPG---
CYSI_SHIFL       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-DNWHLTLFIENGRILDYPG---
CYSI_SHIF8       ETFKAEVERRAGIKFEPSRPYEFTGRGDRIGWVKGID-DNWHLTLFIENGRILDYPG---
CYSI_ECOSM       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-DNWHLTLFIENGRILDYPG---
CYSI_ECOHS       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-DKWHLTLFIENGRILDYPG---
CYSI_ECO7I       ETFKAEVERRAGIKFEPIRPYEFTGRSDRIGWVKGID-DKWHLTLFIENGRILDYPG---
CYSI_ESCF3       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-DKWHLTLFIENGRILDYPG---
CYSI_CITK8       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-NKWHLTLFIENGRILDYPG---
CYSI_SALA4       ETFKAEVERRAGITFEPIRPYEFTGRGDRIGWVKGID-DKWHLTLFIESGRILDYPG---
CYSI_SALTI       ETFKAEVERRAGITFEPIRPYEFTGRGDRIGWVKGID-DKWHLTLFIENGRILDYPG---
CYSI_SALTY       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-DKWHLTLFIENGRILDYPG---
CYSI_SALCH       DTFKEEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-NNWHLTLFIENGRILDYPG---
CYSI_SALPC       DTFKEEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-NNWHLTLFIENGRILDYPG---
CYSI_SALNS       DTFKEEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-DKWHLTLFIENGRILDYPG---
CYSI_SALPA       DTFKEEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-NNWHLTLFIENGRILDYSG---
CYSI_SALPK       DTFKEEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-NNWHLTLFIENGRILDYSG---
CYSI_SALDC       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-NNWHLTLFIENGRILDYPG---
CYSI_SALG2       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-NNWHLTLFIENGRILDYPG---
CYSI_SALEP       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-NNWHLTLFIENGRILDYPG---
CYSI_SALHS       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-NNWHLTLFIENGRILDYPG---
CYSI_SALSV       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-NNWHLTLFIENGRILDYPG---
CYSI_SALPB       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-NNWHLTLFIENGRILDYPG---
CYSI_SALAR       ETFKAEVERRAGITFEPIRPYEFTGRGDRIGWVKGID-DNWHLTLFIENGRILDYPG---
CYSI_ENT38       ETFKAEVERRAGITFEPIRAYEFTGRGDRIGWVKGID-NKWHLTLFIENGRILDYPG---
CYSI1_KLEP3      ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-DKWHLTLFIENGRILDYPG---
CYSI_KLEP7       ETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGID-DKWHLTLFIENGRILDYPG---
CYSI_CROS8       DVFKAEVERRAGVTFEPVRPYEFTGRGDRIGWVKGID-DKWHLTLFIENGRILDFPD---
CYSI_ERWT9       EVFKAEVERRAGMTFEPIRPYEFTTRGDRFGWVKGID-HKWHLTLFIENGRLLDYPD---
CYSI_PECAS       DNFKQEVEARAGVKFEAVRPYEFTERGDRIGWVKGID-NKWHLTLFIENGRILDYPG---
CYSI2_PECCP      DNFKQEVEARAGVKFEAVRPYEFTGRGDRIGWVKGID-NKWHLTLFIENGRILDYPG---
CYSI_DICP7       DTFRQEVERRAGVTFEPVRPYEFTGRGDRIGWVKGID-KKWHLTLFIENGRILDYPG---
CYSI_DICC1       DTFKQEVERRAGMTFETVRPYAFTGRGDRIGWVKGID-NKWHLTLFIENGRLLDYPG---
CYSI_YERPE       ETFKAEVEKRAGVSFSAIKPYQFIGRGDRIGWVKGVD-KKWHLTLFVENGRLLDYPG---
CYSI_YERPP       ETFKAEVEKRAGVSFSAIKPYQFIGRGDRIGWVKGVD-KKWHLTLFVENGRLLDYPG---
CYSI_YERPA       ETFKAEVEKRAGVSFSAIKPYQFIGRGDRIGWVKGVD-KKWHLTLFVENGRLLDYPG---
CYSI_YERPN       ETFKAEVEKRAGVSFSAIKPYQFIGRGDRIGWVKGVD-KKWHLTLFVENGRLLDYPG---
CYSI_YERP3       ETFKAEVEKRAGVSFSAIKPYQFTGRGDRIGWVKGVD-KKWHLTLFIENGRLLDYPG---
CYSI_YERPY       ETFKAEVEKRAGVSFSAIKPYQFTGRGDRIGWVKGVD-KKWHLTLFIENGRLLDYPG---
CYSI_YERPS       ETFKAEVEKRAGVSFSAIKPYQFTGRGDRIGWVKGVD-KKWHLTLFIENGRLLDYPG---
CYSI_YERPB       ETFKAEVEKRAGVSFSAIKPYQFTGRGDRIGWVKGVD-KKWHLTLFIENGRLLDYPG---
CYSI_YERE8       EVFKAEVEKRAGVSFGAIKPYQFTGRGDRIGWVKGID-KKWHLTLFIENGRLLDYPG---
CYSI_SERP5       DTFRAEVEKRAGITFEPIRPYEFTGRGDRIGWVKGID-NQWHLTLFIENGRLLDYPG---
CYSI_PHOLL       ETFKAEVERRAGVKFEAIRPYEFTGRGDQIGWLKGID-DKWHLTLFIENGRLLDYPG---
CYSI_PROMH       ETFKQEVERRSGVMFDMIRPYQFTHRGDQIGWLKGVD-NKWYLTLFIESGRLIDKPN---
CYSI_BUCAI       NEFKKEIEKRANVNLKPVREYSFISRGDRFGWIKDIN-NNWSLTLFIQNGRIYDDND---
CYSI_BUCA5       NEFKKEIEKRANVNLKPVREYSFISRGDRFGWIKDIN-NNWSLTLFIQNGRIYDDND---
CYSI_BUCAT       NEFKKEIEKRANVNLKPVREYSFISRGDRFGWIKDIN-NNWSLTLFIQNGRIYDDNN---
CYSI_BUCAP       SVFKKEVEKRANMTFETIKPYYFISRGDRFGWTKNIN-NDWSLTVFIQNGRIYDNDK---
CYSI_ZYMMO       DVFKAEVEKRAGVTFEASRPFTLTGRGDRFGWVKGID-NQWHLTLFVENGRLLDYPH---
CYSI_ACTPJ       DGFRAEVERCMNIKFEPTRPYEFTERGDRIGWVKGID-NNWHLTLFIESGRITDKPE---
CYSI_ACTP2       DGFRAEVERCMNIKFEPTRPYEFTERGDRIGWVKGID-NNWHLTLFIESVRITDKPE---
CYSI_ACTP7       DGFRAEVERCMNIKFEPTRPYEFTERGDRIGWVKGID-NNWHLTLFIESGRITDKPE---
CYSI_ACTPL       DGFRAEVERCMNIKFEPTRPYEFTERGDRIGWVKGID-NNWHLTLFIESGRITDKPE---
CYSI_ACTSZ       DGFREEVERRMGFKFESIRPFEFTERGDRIGWVKGID-DKWHLTCFIESGRITDKPG---
CYSI_MANSM       EGFREEVERRMGRRFEAIRPFEFTERGDRIGWVKGID-KKWHLTCFIESGRLVDKPD---
CYSI_NEIMB       DNFRAEVERRMGMPFEPVRPFKFTGRGDRIGWVKGID-GNWHLTLFIESGRLVDEGG---
CYSI_NEIM0       DNFRAEVERRMGMPFEPIRPFKFTGRGDRIGWVKGID-GNWHLTLFIESGRLVDEGG---
CYSI_NEIMF       DNFRAEVERRMGMPFEPIRPFKFTGRGDRIGWVKGID-GNWHLTLFIESGRLVDEGG---
CYSI_NEIMA       DNFRAEVERRMGMPFEPIRPFKFTGRGDRIGWVKGID-GNWHLTLFIESGRLVDEGG---
CYSI_AERHH       EAFKAEVESRAGIQFGPVRPYEFTSRGDRFGWVEGID-GKHHLTLFIENGRLLDFPG---
CYSI_TOLAT       DAFKAEVEKRTGIKFEESRPYVFTSRGDRFGWVEGID-GKQHLTLFIENGRILDFPG---
CYSI_ALIF1       DVFKGEVEKRAGVQFEKSRPYELTERGDRIGWVEGID-GKHHLALFIENGRLLDYPG---
CYSI_ALIFM       DVFKAEVEKRAGVQFEESRPYELTERGDRIGWVEGID-GKHHLALFIENGRLLDYPG---
CYSI_ALISL       DVFKAEVEKRAGIQFEASRPYELTERGDRIGWVDGID-GKHHLALFIENGRLLDYPG---
CYSI_VIBTL       DVFKAEVEKRAGVEFAESRPYEFTGRGDRIGWAEGID-GKHHLALFIENGRLLDFPG---
CYSI_VIBCB       DVFKAEVEKRAGVKFEQSRPYEFTERGDRIGWVEGID-GKHHLALFIENGRLLDFPG---
CYSI_VIBPA       DVFKAEVEKRAGIQFEASRPYEFTERGDRIGWVEGID-GKFHLALFIENGRLLDYPG---
CYSI_VIBVU       DVFKAEVEKRAGIKFEVSRPYEFTERGDRIGWVEGID-GKHHLTLFIENGRLLDYPG---
CYSI_VIBVY       DVFKAEVEKRAGIKFEVSRPYEFTERGDRIGWVEGID-GKHHLTLFIENGRLLDYPG---
CYSI_VIBCH       EVFKAEVEKRAGITFAPSRAYEFTSRGDRIGWVEGID-GKHHLTLFIENGRILDFPG---
CYSI_VIBCM       EVFKAEVEKRAGITFAPSRAYEFTSRGDRIGWVEGID-GKHHLTLFIENGRILDFPG---
CYSI_VIBC3       EVFKAEVEKRAGITFAPSRAYEFTSRGDRIGWVEGID-GKHHLTLFIENGRILDFPG---
CYSI_PHOPR       DVFKAEVEKRAGITFEASRPYEFTDRGDRIGWVEGID-GKHHLALFIENGRLLDTPG---
CYSI_ALTMD       DNFKAEVEKRAGVTFQESRPYEFTDRGDRFGWVEGID-GKYHLTVFIENGRILDYPG---
CYSI_PSEA6       ENFKAEVEKRSGVTFGESQAYEFTERGDRIGWVEGID-GKHHLTLFIENGRILDYPG---
CYSI_PSEHT       DVFKAEVEKRAGVEFASSRPYKFTHRGDRIGWVEGID-GKHHLTLFIQSGRILDYPD---
CYSI_SHEAM       DAFKSEVEQRVGVAFGPSRPYEFTHRGDRFGWVEGID-GKHHLTLFIENGRLLDYPG---
CYSI_COLP3       DTFKAEVERRAGIKFSESRSYEFTHRGDSFGWVEGID-GKNHLTLFIENGRILDFNGANS
CYSI_BAUCH       EFFKKEVEVRAGIKFKHIRPYSFTERGDRFGWVQGID-NQWHLTLFIENGRIIDDS----
CYSI_SODGM       GAFREEVEVRAGVQFAPIRPYAFTERGDRFGWVKGID-NQWHLTLFIENGRILDYP----
CYSI_BLOFL       DILKKEIENRSGLKFSPMYPYKFTERGDKFGWIRGINQDYWHLTLFIENGRVCNTS----
CYSI_BLOPB       TTFKSEVERRSGVQFHPIRPYVFTDRGDRFGWVQGID-DYWHLTLFIENGRISNNDP---
CYSI2_KLEP3      EVFKAEVELRAGLAFQPLRPYAFSSRGDRIGWVEGID-GKHHLTLFIPSGRLIDKP----
CYSI1_PECCP      DVFKAEVERRSGVTFSPLKPYVFSERGDRIGWVEGID-GKYHLTLFIPSGRLLDKP----
CYSI_PSYIN       EKFKGEVESRSGIKFLPSRPYEFTERGDRIGWIKGTD-KKWHLTVFIENGRILDYPG---
CYSI_SHEB5       EKFKAEVELRAGVKFEPKRDVVIGDRGDRYGWVEGVD-GKWHLTLFIESGRIKDLPG---
CYSI_SHEB9       EKFKAEVELRAGVKFEPKRDVVIGDRGDRYGWVEGVD-GKWHLTLFIESGRIKDLPG---
CYSI_SHEB2       EKFKAEVELRAGVKFEPKRDVVIGDRGDRYGWVEGVD-RKWHLTLFIESGRIKDLPG---
CYSI_SHEB8       EQFKAEVELRAGVKFEPKRDVVIGDRGDRYGWVEGVD-GKWHLTLFIESGRIKDLPG---
CYSI_SHEPC       EKFKAEVEARAGVKFEPKREVVIGDRGDRYGWVEGVD-GKWHLTLFIESGRIKDLPG---
CYSI_SHESW       EKFKAEVEARAGVKFEPKRDVVIGDRGDRYGWVEGVD-GKWHLTLFIESGRIKDLPG---
CYSI_SHESA       EKFKAEVEARAGVKFEPKRDVVIGDRGDRYGWVEGVD-GKWHLTLFIESGRIKDVPG---
CYSI_SHESR       EKFKAEVEARAGVKFEPKRDVVIGDRGDRYGWVEGVD-GKWHLTLFIESGRIKDVPG---
CYSI_SHESM       EKFKAEVEARAGVKFEPKRDVVIGDRGDRYGWVEGVD-GKWHLTLFIESGRIKDVPG---
CYSI_SHEON       EKFKAEVEVRAGVKFEPKRDVVIGDRGDRYGWVEGVD-GKWHLTLFIESGRIKDMPG---
CYSI_SHEDO       DAFKAEVENRAGVKFAPKRDVVIGDRGDRYGWVEGID-SKWHLTLFIESGRIKDLPG---
CYSI_SHEFN       DAFKAEVEKRAGVKFEPKRDVIIGDRGDRYGWVEGID-NKFHLTLFIESGRIKDMPG---
CYSI_SHEHH       ETFKAEIEARTGIKFEPRRDVVIGDRGDRYGWKQGVD-DNWHLTLFIEGGRVKDLPG---
CYSI_SHEPA       ESFKAEIEARTGIKFEPKRDVVIGDRGDRYGWKQGVD-DNWHLTLFIEGGRVKDFPG---
CYSI_SHEPW       DAFKAEVEKRTGIKFEPKRDVVIGDRGDRYGWKQGVD-DNWHLTLFIEGGRVKDLPG---
CYSI_SHESH       DAFKAEVEKRAGVTFEPKRDVVIGDRGDRYGWIKGVD-NRWHLTLFIEGGRIKDLPG---
CYSI_SHEWM       EAFKAEVEKRAGVKFEPKRDVVIGDRGDRYGWIKGVD-NKWHLTLFIEGGRIKDLPG---
CYSI_SHELP       EAFKAEVEQRAGVKFEPKREVVIGDRGDRYGWIKGVD-NNWHLTLFIEGGRIKDLPG---
CYSI_THIRO       DAFRDEVERRAGIRFAPARPIGFTDQGDRTAWVRGQD-GRWHLTLYIESGRLIDGPG---
CYSI_LEPBA       EFYKREVEKRAGISFESAKDFQFTTRSDDFGWKQDAA-GNWHYTVFVENGRVCDEHG---
CYSI_LEPBP       EFYKREVEKRAGISFESAKDFQFTTRSDDFGWKQDAA-GNWHYTVFVENGRVCDEHG---
CYSI_ACIF2       DRFMEEVQQRTGFSLAPPRPFHFETSGDRFGWLENDD-GTACLTLFIPGGRVADGD----
CYSI_ACIF5       DRFMEEVQQRTGFSLAPPRPFHFETSGDRFGWLENDD-GTACLTLFIPGGRVADGD----
CYSI_XANAC       DTIVAEIARRAGFALQPAQPFAFDHNGDRYGWVEGED-GLWHLTLSLPAGRIADTDT---
CYSI_XANC5       DTIVAEIARRAGFALQPAQPFAFDHNGDRYGWVEGED-GRWHLTLSLPAGRIADTDT---
CYSI_XANOM       DTIVAEIARRAGFALQPAQPFAFEHNGDRYGWVEGED-GLWHLTLSLPAGRIADTDT---
CYSI_XANOP       DTIVAEIARRAGFALQPAQPFAFEHNGDRYGWVEGED-GLWHLTLSLPAGRIADTDT---
CYSI_XANOR       DTIVAEIARRAGFALQPAQPFAFEHNGDRYGWVEGED-GLWHLTLSLPAGRIADTDT---
CYSI_XANC8       DTIVAEIERRAGFSLQPAQPFAFAHNGDRYGWVEGEQ-GDWHLTLSLPAGRIADTDT---
CYSI_XANCB       DTIVAEIERRAGFSLQPAQPFAFAHNGDRYGWVEGEQ-GDWHLTLSLPAGRIADTDT---
CYSI_XANCP       DTIVAEIERRAGFSLQPAQPFAFAHNGDRYGWVEGEQ-GDWHLTLSLPAGRIADTDT---
CYSI_XYLF2       DCIVGEIQQRAGITLQPARPFVFEHNGDRYGWIEGED-GHWHLTLSLPAGRIADTEG---
CYSI_XYLFT       DCIVGEIQQRAGITLQPARPFVFEHNGDRYGWIEGED-GHWHLTLSLPAGRIADTEG---
CYSI_XYLFM       DCIVGEIQQRAGITLQPARPFVFEHNGDRYGWIEGED-GHWHLTLLLPAGRIADTEG---
CYSI_XYLFA       DCIVGEIQQRAGITLQPARPFVFEHNGDRYGWIEGED-RHWHLTLSLPAGRIADTES---
CYSI_MYXXD       PWFTAELEKRLGFPLQPARPFAFEHNGDRFGWTEGHD-GRWHLTLHLDSGRVADRPG---
CYSI_GEOKA       EAVKEEIERRLGWRLGEARPYHFEHSGDRYGWVEGVN-GTWHFTLFVEGGRVKDYDD---
CYSI_GEOTN       EVVKEEIERRLGWKLGEARPYHFEHNGDRYGWVEGVN-GTWHFTLYVEGGRVKDDDD---
CYSI_ANOFW       DAIKAELERRLGWELEEARPYRFEHNGDRYGWVEGVN-GTWHFTLFIEGGRVKDTDD---
CYSI_BACVZ       ENVKAELENRLGWQLDEAKPYHFDHNGDRYGWVKGVK-GKWHFTMFIEGGRVTDYEN---
CYSI_BACSU       ENVKEELENRLGWSLEEAKPYHFDHNGDRYGWVEGIE-DKWHFTLFVEGGRITDYDD---
CYSI_BACHD       ETVKNELENRLGWSLDEAKPYHFDHNGDRYGWVKGVK-GRWHFTLFVEGGRVTDYAD---
CYSI_BACLD       ETVKNELENRLGWSLAEAKPYHFEHNGDRYGWVKGVK-GRWHFTMFVEGGRVTDYDD---
CYSI_BACP2       ENVKEELEGRLGFALLEARDYHFDHNGDRYGWVKGIN-GRWHYTMFVEGGRIIDYDD---
CYSI_BACSK       DWLKNELHARLGWELGEARPFQFDHNGDRYGWTKGVK-GRWHLTLFIQNGRIQDTDD---
CYSI_LYSSC       EWFNEELTRRLGWSIQEARPYTFERTGDEFGWIKGAE-GKWHYTLFIQNGRIKDFQD---
CYSI_PAESJ       PWFMDELQDRLGWELAPAREFHFEHTGDRYGWIKGKD-GKWNLNLYVQAGRVVDTED---
CYSI_BREBN       EWFIHELEQRLGWELEQVRPYHFEHNGDRYGWVKGSD-DNWHFTLFIQNGRVKDEDN---
CYSI_OCEIH       DWFIDELNERLGWELEGKRHYEFDSNGDSYGWIEGKD--YWHLTLFIQNGRIKDVED---
CYSI_STAEQ       TWVTEELNRRLGWEIKAPRDFEFEHNGDRLGWIEG-I-NNWNFTLFIQNGRVKDTED---
CYSI_STAES       TWVTEELNRRLGWEIKAPRDFEFEHNGDRLGWIEG-I-NNWNFTLFIQNGRVKDTED---
CYSI_STAHJ       DKVVEELNTRLGWEIEEPRDFEFEHNGDRLGWIEGDK-GVWNYTLFIQNGRVKDTED---
CYSI_STAS1       DWIRNEINNRLGWQLENKRPYHFEHNGDRYGWTEG-S-GKWHYTLFVQNGRVKDTED---
CYSI_STACT       DWIKQELNDRLGWELEEAKSFEFEDNGDRLGWTEG-S-GKHHYTLFIQNGRIKDTED---
CYSI_NITOC       DWFKAELNQRLGWDLEPARPFHFESNGDHFGWVEDSK-GRWHLTLFLLSGRIKDTLD---
CYSI_NITHX       DWIKAEAERRLGFALEPAQPYTFTSNGDPLGWVKGED-GREHCTLFIQNGRVINTPD---
CYSI_NITWN       DWIKAETERRLGFALKPEQPYTFTSNGDPLGWVKGED-GREHCALFIQNGRVINTPD---
CYSI_OLICO       DWIKAEIERRLGFELAPAALYTFTSNSDPLGWVKGED-GHWHCTLFIQNGRVINHPG---
CYSI_BORPD       DAVKAEIERRLGFALQPARPFRFDSNGDALGWQTGED-GRHHVTLFIQNGRLVNLPG---
CYSI_METSB       DFIQGEIERRLGYALEPARPFEFVSNGDAYGWAKGEN-GRYHYTLFIENGRIVNRED---
CYSI_NITEC       DWIKLAIEDRAG-LLEPARPYHFTSNADIYGWVESDD-GYHHFTLFVENGRLNR------
CYSI_NITEU       DWIKLAIEDRAG-PLESARPYDFTSNADIYGWIESGD-GFHHFTLFIENGRLNR------
CYSI_METC4       DAFRAEVEKRIGKKLGAPKPFTFDGNGDRYGWVEGDD-GRHHLTLYVPSGRIKDIEGG--
CYSI_METEP       DAFRAEVEKRIGKKLGAPKPFTFDGNGDRYGWVEGDD-GRHHLTLYVPSGRIKDIEGG--
CYSI_METEA       DAFRAEVEKRIGKKLGAPKPFTFDGNGDRYGWVEGED-GRHHLTLYVPSGRIKDIEGG--
CYSI_METPB       DAFRAEVEKRIGKKLEAPKPFTFENNGDRYGWVEGED-GRHHLTLYVPSGRIKDIDGG--
CYSI_METRJ       DAFRAEVEKRVGKKLGAPKPFTFTGNGDRYGWVEGDD-GRHHLTLYVPSGRIKDIDGG--
CYSI_METNO       AAFRAEVERRVGRKLQDPKPFRFESNGDRYGWVEGED-GRHHLTLYLPSGRIKDVEGG--
CYSI_METS4       AAFRAEVERRVGKPLREPKPFQFTGNGDRYGWVEGED-GRHHLTLYVPSGRIRDVEGG--
CYSI_CHRSD       DGFRQEVEARLGEALSPARELTLTHNGDRLGWYQGED-GLWHYGLFVQNGRLADSDGG--
                            .  :       :   .*  .*  .           :   *:        

CYSI_ECOLC       --RPLKTGLLEIAKIHKGDFRITANQNLIIAGVPESEKAKIEKIAKESGLMN---AVTPQ
CYSI_SHIB3       --RPLKTGLLEIAKIHKGDFRITANQNLIIAGVPESEKAKIEKIAKESGLMN---AVTPQ
CYSI_ECO55       --RPLKTGLLEIAKIHKGDFRITANQNLIIAGVPESEKAKIEKIAKESGLMN---AVTPQ
CYSI_ECOSE       --RPLKTGLLEIAKIHKGDFRITANQNLIIAGVPESEKAKIEKIAKESGLMN---AVTPQ
CYSI_ECOLU       --RPLKTGLLEIAKIHKGDFRITANQNLIIAGVPESEKAKIEKIAKESGLMN---AVTPQ
CYSI_ECO5E       --RPLKTGLLEIAKIHKGDFRITANQNLIIAGVPESEKAKIEKIAKESGLMN---AVTPQ
CYSI_ECO57       --RPLKTGLLEIAKIHKGDFRITANQNLIIAGVPESEKAKIEKIAKESGLMN---AVTPQ
CYSI_ECO24       --RPLKTGLLEIAKIHKGDFRITANQNLIIAGVPESEKAKIEKIAKESGLMN---AVTPQ
CYSI_ECO8A       --RPLKTGLLEIAKIHKGDFRITANQNLIIAGVPESEKAKIEKIAKESGLMN---AVTPQ
CYSI_SHISS       --RPLKTGLLEIAKIHKGDFRITANQNLIITGVPESEKAKIEKIAKESGLMN---AVTPQ
CYSI_SHIBS       --RPLKTGLLEIAKIHKGDFRITANQNLIIAGVPESEKAKIEKIAKESGLMN---AVTPQ
CYSI_SHIDS       --RPLKTGLLEIAKIHKGDFRITANQNLIIAGVPESEKAKIEKIAKESGLMN---AVTPQ
CYSI_ECOL6       --RPLKTGLLEIAKIHKGDFRITANQNLIIAGVPESEKAKIEKIAKESGLMN---AVTPQ
CYSI_ECOBW       --RPLKTGLLEIAKIHKGDFRITANQNLIIAGVPESEKAKIEKIAKESGLMN---AVTPQ
CYSI_ECOLI       --RPLKTGLLEIAKIHKGDFRITANQNLIIAGVPESEKAKIEKIAKESGLMN---AVTPQ
CYSI_ECOBR       --RPLKTGLLEIAKIHKGDFRITANQNLIIAGVPESEKAKIEKIAKESGLMN---AVTPQ
CYSI_ECOK1       --RPLKTGLLEIAKIHKGDFRITANQNLIIAGVPESEKAKIEKIAKESGLMN---AVTPQ
CYSI_ECO81       --RPLKTGLLEIAKIHKGDFRITANQNLIIAGVPESEKAKIEKIAKESGLMN---AVTPQ
CYSI_ECO45       --RPLKTGLLEIAKIHKGDFRITANQNLIIAGVPESEKAKIEKIAKESGLMN---AVTPQ
CYSI_ECOUT       --RPLKTGLLEIAKIHKGDFRITANQNLIIAGVPESEKAKIEKIAKESGLMN---AVTPQ
CYSI_ECOL5       --RPLKTGLLEIAKIHKGDFRITANQNLIIAGVPESEKAKIEKIAKESGLMN---AVTPQ
CYSI_ECO27       --RPLKTGLLEIAKIHKGDFRITANQNLIIAGVPESEKAKIEKIAKESGLMN---AVTPQ
CYSI_SHIFL       --RPLKTGLLEIAKIHKGDFRITANQNLIIAGVPESEKAKIEKIAKESGLMN---AVTPQ
CYSI_SHIF8       --RPLKTGLLEIAKIHKGDFRITANQNLIIAGVPESEKAKIEKIAKESGLMN---AVTPQ
CYSI_ECOSM       --RPLKTGLLEIAKIHKGDFRITANQNLIIAGVPESEKAKIEKIAKESGLMN---AVTPQ
CYSI_ECOHS       --RPLKTGLLEIAKIHKGDFRITANQNLIIAGVPESEKAKIEKIAKESGLMN---AVTPQ
CYSI_ECO7I       --RPLKTGLLEIAKIHKGDFRITANQNLIIAGVPESEKAKIEKIAKESGLMN---AVTPQ
CYSI_ESCF3       --RPLKTGLLEIAKIHKGDFRITANQNLIIAGVPESEKAKIEKIAKESGLMN---AVTPQ
CYSI_CITK8       --RPLKTGLLEIAKIHKGEFRITANQNLIIAGVPESQKAKIEKLARNHGLMN---AVTSQ
CYSI_SALA4       --RPLKTGLLEIAKIHQGEFRITANQNLIIASVPESQKAKIETLARDHGLMN---AVKPQ
CYSI_SALTI       --RPLKTGLLEIAKIHQGEFRITANQNLIIASVPESQKAKIEKLARDHGLMN---AVSAQ
CYSI_SALTY       --RPLKTGLLEIAKIHQGEFRITANQNLIIASVPESQKAKIETLARDHGLMN---AVKPQ
CYSI_SALCH       --RPLKTGLLEIAKIHQGEFRITANQNLIIASVPESQKAKIEKLARDHGLMN---AVSAQ
CYSI_SALPC       --RPLKTGLLEIAKIHQGEFRITANQNLIIASVPESQKAKIEKLARDHGLMN---AVSAQ
CYSI_SALNS       --RPLKTGLLEIAKIHQGEFRITANQNLIIASVPESQKAKIETLARDHGLMN---AVSAQ
CYSI_SALPA       --RPLKTGLLEIAKIHQGEFRITANQNLIIASVPESQKAKIETLARDHGLMN---AVKPQ
CYSI_SALPK       --RPLKTGLLEIAKIHQGEFRITANQNLIIASVPESQKAKIETLARDHGLMN---AVKPQ
CYSI_SALDC       --RPLKTGLLEIAKIHQGEFRITANQNLIIASVPESQKAKIETLARDHGLMN---AVSAQ
CYSI_SALG2       --RPLKTGLLEIAKIHQGEFRITANQNLIIASVPESQKAKIETLARDHGLMN---AVSAQ
CYSI_SALEP       --RPLKTGLLEIAKIHQGEFRITANQNLIIASVPESQKAKIETLARDHGLMN---AVSAQ
CYSI_SALHS       --RPLKTGLLEIAKIHQGEFRITANQNLIIASVPESQKAKIETLARDHGLMN---AVSAQ
CYSI_SALSV       --RPLKTGLLEIAKIHQGEFRITANQNLIIASVPESQKVKIETLARDHGLMN---AVSAQ
CYSI_SALPB       --RPLKTGLLEIAKIHQGEFRITANQNLIIASVPESQKAKIEKLARDHGLMN---AVSAQ
CYSI_SALAR       --RPLKSGLLEIAKIHQGEFRITANQNLIVASVPESQKMKVEKLALDYGLMN---AVSPQ
CYSI_ENT38       --RPLKTGLLEIAKIHKGEFRITANQNLIIAGVPESQKAKIEKLAREHTLMD---GVKPQ
CYSI1_KLEP3      --RPLKTGLLEIAKIHKGEFRITANQNLIVASVPEDQKARIEKLARDHGLMN---AVTPQ
CYSI_KLEP7       --RPLKTGLLEIAKVHQGEFRITANQNLIVASVPEDQKARIEKLARDHGLMN---AVTPQ
CYSI_CROS8       --KPLKTGLKEIARIHKGDFRLTANQNLIVAGVPEGDKAKIEQIARAHGLMA---GVTPQ
CYSI_ERWT9       --RPLKTGLAEIAKIHQGDFRLTANQNLIVAGVPESEKENIERLALSHGLME---NVSHQ
CYSI_PECAS       --RPLKTGLAEIAKIHKGDFRLTANQNLIVAGVPARSKAKIDALAREHGLIDD--SVSEQ
CYSI2_PECCP      --RPLKTGLAEIAKIHKGDFRLTANQNLIIAGVPARSKAKIDALAREHGLIDD--SVSEQ
CYSI_DICP7       --RPLKTGMAEIAKIHKGDFRLTANQNLIVAGVASRDKASIEALARQYALMDD--SVTEQ
CYSI_DICC1       --RPLKTGMAEIAKIHKGDFRLTANQNLIVAGVATRDKAKIEALARQYGLIDD--SVTEQ
CYSI_YERPE       --RSLKTGVAEIAKIHQGDFRLTANQNLIVAGVPEKDKARIEALAREHGLMDD--NVTSQ
CYSI_YERPP       --RSLKTGVAEIAKIHQGDFRLTANQNLIVAGVPEKDKARIEALAREHGLMDD--NVTSQ
CYSI_YERPA       --RSLKTGVAEIAKIHQGDFRLTANQNLIVAGVPEKDKARIEALAREHGLMDD--NVTSQ
CYSI_YERPN       --RSLKTGVAEIAKIHQGDFRLTANQNLIVAGVPEKDKARIEALAREHGLMDD--NVTSQ
CYSI_YERP3       --RSLKTGVAEIAKIHQGDFRLTANQNLIVAGVPEKDKARIEALAREHGLMDD--NVTSQ
CYSI_YERPY       --RSLKTGVAEIAKIHQGDFRLTANQNLIVAGVPEKDKARIEALAREHGLMDD--NVTSQ
CYSI_YERPS       --RSLKTGVAEIAKIHQGDFRLTANQNLIVAGVPEKDKARIEALAREHGLMDD--HVTSQ
CYSI_YERPB       --RSLKTGVAEIAKIHQGDFRLTANQNLIVAGVPEKDKARIEALAREHGLMDD--HVTSQ
CYSI_YERE8       --RSLKTGVAEIAKIHQGDFRLTANQNLIVAGVPEKDKARIEALAREHGLMDD--SVSPQ
CYSI_SERP5       --RPLKTGVAEIARIHKGDFRLTANQNLIVAGVPESEKAKIEALARDHGLIDD--GVSVQ
CYSI_PHOLL       --KPLKSGVAEIAKIHKGDFRLTANQNLIIAGIPESEKQRIETIACRHGLIDD--KTTVQ
CYSI_PROMH       --APLKTGVAEIAKVHLGDFRLTANQNLIVAGVPEAQKEQIEAIARQYGLIND--EVTPL
CYSI_BUCAI       --KLFKSGLLKIANIHDGNFRITSNQNIIISEVSEKNKNKIEKIALSSGLIN---KSTNL
CYSI_BUCA5       --KLFKSGLLKIANIHDGNFRITSNQNIIISEVSEKNKNKIEKIALSSGLIN---KSTNL
CYSI_BUCAT       --KLFKSGLLKIANIHDGNFRITSNQNIIISEVSEKNKNKIEKIALSSGLIN---KSTNL
CYSI_BUCAP       --QLVKSGLLKIANLHTGNFRLTANQNIVISEILDKNKKKIEEIAISHGLIK---KVSSL
CYSI_ZYMMO       --RPLKSGIAEIAKVHKGDFRLTANQNLIVAGVSEEDKDTIEKIARDHGLLE---NISEL
CYSI_ACTPJ       --KPLMTGVLELAKVHKGDFRITANQNLIVANVAEQDKAQIEAIARQYGLIQE---ISKL
CYSI_ACTP2       --KPLMTGVLELAKVHKGDFRITANQNLIVANVAEQDKAQIEAIARQYGLIQE---ISKL
CYSI_ACTP7       --KPLMTGVLELAKVHKGDFRITANQNLIVANVAEQDKAQIEAIARQYGLIQE---ISKL
CYSI_ACTPL       --KPLMTGVLELAKVHKGDFRITANQNLIVANVAEQDKAQIEAIARQYGLIQE---ISKL
CYSI_ACTSZ       --KPLMTGMLELAKVHTGDFRITANQNIIIANVAEEDKQRIEDIAREYGLIGN---ISKL
CYSI_MANSM       --LPLMTGMLELAKVHKGDFRITANQNIIIANVAEEDKRQIEDIARQYGLIRK---ITKL
CYSI_NEIMB       --KQLLTGVLEIAKIHKGDFRITANQNLIVANVAEADKAKIEEFARTYGLIRN--DVSKL
CYSI_NEIM0       --KQLLTGVLEIAKIHKGDFRITANQNLIVANVAEADKAKIEELARTYGLIRN--DVSKL
CYSI_NEIMF       --KQLLTGVLEIAKIHKGDFRITANQNLIVANVAEADKAKIEELARTYGLIRN--DVSKL
CYSI_NEIMA       --KQLLTGVLEIAKIHKGDFRITANQNLIVANVPEGGKARIEQLARSYGLIHD--GVSKL
CYSI_AERHH       --KPLKTGMLEIAKVHQGDFRLTANQNLIIAGVPAGEKARIEALARQYGLLDD--GVSEQ
CYSI_TOLAT       --KPLKTGLAEIAKIHKGDFRMTANQNLIIAGVPKKDKAKIEKIARAHGLIDD--AITEQ
CYSI_ALIF1       --KPLKTGVAEIAKVHQGDFRMTANQNLIVAGVPSEQKDHIEQIARAHGLIDD--THSEQ
CYSI_ALIFM       --KPLKTGVAEIAKVHQGDFRMTANQNLIVAGVPSEQKDHIEQIARAHGLIDD--THSEQ
CYSI_ALISL       --KPLKTGVAEIAKIHQGDFRMTANQNLIVAGVPAEQKDQIEQIAREHGLIDD--GHSEQ
CYSI_VIBTL       --KALKTGVAEIAKIHKGDFRMTANQNLIVAGVLKSQKAQIEKLARQYGLMDD--AVSEQ
CYSI_VIBCB       --KPLKTGVAEIAKIHKGDFRMTANQNLIVAGVPKSQKAKIEKIAREHGLMDD--GVSEQ
CYSI_VIBPA       --KPLKTGVAEIAKIHKGDFRMTANQNLIVAGVPKSEKAKIEKIAREHGLMDD--NVSEQ
CYSI_VIBVU       --KPLKTGVAEIAKIHKGDFRMTANQNLIVAGVSKSNKAKIEKLAREHGLMDE--GVSEQ
CYSI_VIBVY       --KPLKTGVAEIAKIHKGDFRMTANQNLIVAGVSKSNKAKIEKLAREHGLMDE--GVSEQ
CYSI_VIBCH       --KPLKTGVAEIAKVHQGDFRMTANQNLIVAGVPADQKPHIEQLAREHGLIDD--GVSEQ
CYSI_VIBCM       --KPLKTGVAEIAKVHQGDFRMTANQNLIVAGVPADQKPHIEQLAREHGLIDD--GVSEQ
CYSI_VIBC3       --KPLKTGVAEIAKVHQGDFRMTANQNLIVAGVPADQKQQIEQLARSHGLIDD--GVSEQ
CYSI_PHOPR       --KPLKTGVAEIAKIHKGDFRMTANQNLIVAGVPAADKNKIEKIARDHGLIDD--GVSEQ
CYSI_ALTMD       --KTLKTGCAEIAKIHKGDFRLTANQNLIIAGVPPQDKDKIEALAREHGLIAP--SISNQ
CYSI_PSEA6       --KPLKTGCAEIAKIHDGDFRLTANQNLIVAGVSEQNKAKVEEIARAHGLIED--DLSAQ
CYSI_PSEHT       --KPLKTGCRKIAEVHQGDMRMTANQNLIIAGVAANQKAVIEEIARNHGLIDD--KDTEQ
CYSI_SHEAM       --KPLKTGVAEIAKVHKGDLRMTANQNLIIAGVAAEDKAQIEQLAREHGLLDN--VTTQ-
CYSI_COLP3       DSKALKTGMREIAKIHKGDFRLTANQNLIVAGVSAEDKTIIEQLAREHGLIND--GVSNQ
CYSI_BAUCH       -HRKLKTGMLEIARIHQGDFRITANQNIIIAGVEKKHKATIELLARQYGLINN--NITLQ
CYSI_SODGM       -DRTLKTGLAEIARRHKGDFRLTANQNLIIAGVDKKDKAAIEALARRHGLIND--DATPQ
CYSI_BLOFL       -NILIKKGLSEIAKVHSGFFRITTNQNLIISEIHQDKKDIIEDLLKQYGLLGD--FVTSQ
CYSI_BLOPB       -HKLLKRGIAEVAQIHSGSFRLTANQNLIISGVSKDNKLMIESTLRKYGVIND--DITPQ
CYSI2_KLEP3      -GKPLKSGLAAIAAVHTGDFRLTPNQNIIIAGVSERNRAQIDALAQRYSLIDD--TVSPQ
CYSI1_PECCP      -GLPNKSGIAAIARVHNGDFRLTANQNIIIAGVASDDKAQIDALARQYGLLDS--SLSSQ
CYSI_PSYIN       --KPLKSGLVEIAKVHQGDFRMTANQNLIIASVPESEKEKIEALARKCGLIND--AHSKQ
CYSI_SHEB5       --QTLQTGLREIAKIHKGDFRMTSNQNMIIAGVAAEDKATIEGLARKHGLLGQ--VLTQT
CYSI_SHEB9       --QTLQTGLREIAKIHKGDFRMTSNQNMIIAGVAAEDKATIEGLARKHGLLGQ--VLTQT
CYSI_SHEB2       --QTLQTGLREIAKIHKGDFRMTSNQNMIIAGVAAEDKATIEGLARKHGLLGQ--VLTQT
CYSI_SHEB8       --QTLQTGLREIAKIHKGDFRMTSNQNMIIAGVAAEDKATIEGLARKHGLLGQ--VLTQT
CYSI_SHEPC       --QTLQTGLREIAKIHKGDFRMTSNQNMIIAGVAAEDKATIEGLARKHGLLGQ--VLTQT
CYSI_SHESW       --QTLQTGLREIAKIHKGDFRMTSNQNMIIAGVAAEDKATIEGLARKHGLLGQ--VLTQT
CYSI_SHESA       --KSLQTGMREIAKIHKGDFRMTSNQNMIIAGVAPEDKATIEGLARKHGLLGQ--VLTQT
CYSI_SHESR       --KSLQTGMREIAKIHKGDFRMTSNQNMIIAGVAPEDKATIEGLARKHGLLGQ--VLTQT
CYSI_SHESM       --KSLQTGMREIAKIHKGDFRMTSNQNMIIAGVAPEDKATIEGLARKHGLLGQ--VLTQT
CYSI_SHEON       --KSLQTGMREIAKIHKGDFRMTSNQNMIIAGVAPEDKATIEGLARKRGLLGQ--VLTQT
CYSI_SHEDO       --QTLQTGLREIAKIHKGDFRMTSNQNMIIAGVAAEDKAEIEGLARKHGLMGQ--VLTGT
CYSI_SHEFN       --QTLQTGLREIAKIHKGDFRMTSNQNMIIAGVAAQDKAEIEGLARKHGLLGQ--VLSGT
CYSI_SHEHH       --QPLQTGLREIAKIHRGDFRMTSNQNMIIAGVASADKEQIEGLARQYGLLGK--LITET
CYSI_SHEPA       --QPLQTGLREIAKVHQGDFRMTSNQNIIIAGVPSADKALIEGLARQHGLLGK--LITET
CYSI_SHEPW       --QPLQTGLREIAKIHQGDFRMTSNQNIIIAGVPAADKDKIEALARQHGLMGK--LITET
CYSI_SHESH       --QPLQTGLREIAKIHKGDFRMTSNQNFIVAGVAEEDKEAIEALARNHGLMGK--LITET
CYSI_SHEWM       --QPLQTGLREIAKIHKGDFRMTSNQNFIIASVAEEDKAEIEALARSHGLMGK--LITET
CYSI_SHELP       --QPLQTGLREIALVHKGDFRMTANQNIIIAGVAEEDKAQIEALARSHGLMGK--LISPT
CYSI_THIRO       --QSSMQGLREIARIHQGDFRITPNQNLIVARVPEPGKSEIEALARKYGLLD---KGIAL
CYSI_LEPBA       --YNLKTALLEVSKTRRATFRFTCNQNLILSDIFPKDKDLIESILVKFGVHRKTAEVSPI
CYSI_LEPBP       --YNLKTALLEVSKTRRATFRFTCNQNLILSDIFPKDKDLIESILVKFGVHRKTAEVSPI
CYSI_ACIF2       --IPLLSGLDALARLHHGEIRLTCNQNLLIAGISPAERPVVETVLAEYGLNR-LLNLAPV
CYSI_ACIF5       --IPLLSGLDALARLHHGEIRLTCNQNLLIAGISPAERPVVETVLAEYGLNR-LLNLAPV
CYSI_XANAC       --AAHLSGLRAIAQLNVGEFRMTPNQNLVIAGVLASERARVDALVAHYGLDAGNQSATAL
CYSI_XANC5       --AAHLSGLRAIAQLNVGEFRMTPNQNLVIAGVPASERARVDALVAQYALDAGNRAATAL
CYSI_XANOM       --ATHLSGLRAIAQLNVGEFRMTPNQNLVIAGVPASERARVDALVAQYALDAGNRSASAL
CYSI_XANOP       --ATHLSGLRAIAQLNVGEFRMTPNQNLVIAGVPASERARVDALVAQYALDAGNRSASAL
CYSI_XANOR       --ATHLSGLRAIAQLNVGEFRMTPNQNLVIAGVPASERARVDALVAQYALDAGNRSASAL
CYSI_XANC8       --AAHLSGLRAIAQLQMGEFRMTPNQNLVIAGVPAEQRAQIDQLVAQYGLDAGNLAPTAL
CYSI_XANCB       --AAHLSGLRAIAQLQMGEFRMTPNQNLVIAGVPAEQRAQIDQLVAQYGLDAGNLAPTAL
CYSI_XANCP       --AAHLSGLRAIAQLQMGEFRMTPNQNLVIAGVPAEQRAQIDQLVAQYGLDAGNLAPTAL
CYSI_XYLF2       --STLLSGFREIAQLGIGEFRMTPNQNVVIAGISPGQRAAIDALVTQYGLDTGNRAPTAL
CYSI_XYLFT       --STLLSGFREIAQLGIGEFRMTPNQNVVIAGISPGQRAAIDALVTQYGLDTGNRAPTAL
CYSI_XYLFM       --STLLSGFREIAQLGIGEFRMTPNQNVVIAGISPGQRAAIDALVTQYGLDTGNRAPTAL
CYSI_XYLFA       --SPLLSGFRAIAQLGIGQFRMTPNQNVVIAGISPGQRATIDALVTQYGLDTGNRAPTAL
CYSI_MYXXD       --APHLTGLREIARIHTGDFRLTANQNLVIAGVTPEARDAIGALVTAHALDS-FRSASPV
CYSI_GEOKA       --YKLMTGLREIAKVHTGDFRLTPNQNLIIANVTSEKKPEIEALIAKYGLTDGRR-YTAL
CYSI_GEOTN       --YKLMTGLREIAKVHTGDFRLTANQNLVIANVTSEKKAEIEALIAKYGLTDGKR-YTAL
CYSI_ANOFW       --YPLMTGLREIAKVHTGDFRLTANQNLVIANVPSEKKEEMDALIQQYKLTDGKH-YSAL
CYSI_BACVZ       --YKLMTGLREIAKVHTGDFRLTSNQNLIIGNVSSQKKKQISALIEQYGLTDGRQ-HSAL
CYSI_BACSU       --YKLMTGLREIAKVHTGEFRLTANQNLMIANVSSDKKEEISALIEQYGLTDGKH-YSAL
CYSI_BACHD       --YKLMTGLREIAKIHTGDIRLTSNQNLIIANVTSQKKKKINELIEQYGLTDGKH-YTAL
CYSI_BACLD       --YKLMTGLREIAKVHTGDIRLTANQNLIIANVTSQKKKKISELIEQFGLTDGKH-YTAL
CYSI_BACP2       --YPLMTGIREIAKIHSGDFRLTANQNLIIGNVTSHKKKQIEQLIQEFGLSDGQQ-HSAL
CYSI_BACSK       --YQLMTGLREIAKIHTGEFRLTGNQNVIISNITAAKKKAIQAIVETYRLTDGQH-VSAL
CYSI_LYSSC       --YKLLTGLREIAKVHTGDFRLTPNQNLMISNVTPQKKKKIAAIIEQYKLTDGAH-YSAL
CYSI_PAESJ       --NKLRSALREIAKIHTGDFRLTANQNLVIANVTAQKKTKIVALLKEFGIAEGSN-YSAL
CYSI_BREBN       --YLLKSGLREIAKVHTGDFRLTPNQNLLIGNVTSEKKPEIEQIIQAYGLTDGAT-YSAL
CYSI_OCEIH       --YPLMTGLREIAKVHTGDFRLTPNQNLIIANVSSDNKKQINDLVEKFNLTEGKT-YSGL
CYSI_STAEQ       --YLLKTALREIAEIHTGDFRLSPNQNLVIANVSPEKKEEIQAIIDKYKLTDGKN-YTGL
CYSI_STAES       --YLLKTALREIAEIHTGDFRLSPNQNLVIANVSPEKKEEIQAIIDKYKLTDGKN-YTGL
CYSI_STAHJ       --YQLKTALRKIAETHTGDFRLSPNQNLIIANVTPEKKEEIQSLIDQYGLTDGKN-YTGL
CYSI_STAS1       --YKLKTALRTIAEVHTGDFRLTPNQNLVIANVAAHKKNEIEKIITDFGITDGQH-YTGL
CYSI_STACT       --FKLKTAIKELAKVHKGDFRMTPNQNLIIANVDEKDKPEIQKIIDNYGLTDGKN-YSGL
CYSI_NITOC       --QPLMTGLREIAKIHKGDFRLTTNQNLTIANISKTNKPRIEALLEKYRIPMPER-FSPI
CYSI_NITHX       --HPMMDGLRAIAQVHKGMFRITPNQNLIISDIAPEDRPAIAALMKQYGLDQFET-RSGL
CYSI_NITWN       --HPMMDGLRAIAQVHKGMFRVTPNQNLIIADIASRDRPEIEALMKEYGLDQFET-RSGL
CYSI_OLICO       --QPLMDGLREIARVHKGHFRITPNQNLIIADIAPEDRPAIEEVMKEYGLDAFET-RSQL
CYSI_BORPD       --LPLLEGLREIARVHTGSFRITPNQNVVIADIGDAERPRIEALLRQYQLEAGPS-TSAL
CYSI_METSB       --VALLDGLRAIAAVHQGSFRMTPNQNVVIADIPAKQKPKIAALLREYGLDHRNE-QSLL
CYSI_NITEC       ---DTLDKIARIAHVHKGHFRLTPNQNLMIANVATADKPKIDALLVGSGLIAFNE-HSVL
CYSI_NITEU       ---DMLDKIAQIAHVHKGHFRLTPNQNLMIANVATADKPEIEALLRETGLIAFNE-RSVL
CYSI_METC4       --PQFLSGLRRIAEVHEGDFRLTGNQNVIIANVPAGKRAEIDALVDEYGLTRGA---SAL
CYSI_METEP       --PQFLSGLRRIAEVHEGDFRLTGNQNVIIANVPAGKRAEIDALVDEYGLTRGA---SAL
CYSI_METEA       --PQFLSGLRRIAEVHEGDFRLTGNQNVIIANVPAGKRAEIDALVDEYGLTRGA---SAL
CYSI_METPB       --PQFLSGLRRIAEVHEGDFRLTGNQNVIIANVPAAKRAEIDALVDEYGLTRGA---SAI
CYSI_METRJ       --PQFLSGLRRIAEVHQGDFRLTGNQNVIIANVPAEKRAEIDALVDEYGLTRGA---SAL
CYSI_METNO       --PRYLSGLRRIAEVHQGDFRLTGNQNVIVANVPADRKSEIDALVAEYGLNLGV---TAL
CYSI_METS4       --PRYLSGLRRIAEIHEGDFRLTGNQNVIVANVPAGARAEIDRLVAEYGLTIGA---GAL
CYSI_CHRSD       --PQLMTGMREIAQAHDGDIVLTTNQNLIITQVPEARREVIDDLLDRYRMTVEA---TPL
                            ::    . : .: ***. :  :    :  :        :          

CYSI_ECOLC       RENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMAKHGVS-DEHIVMRVTGCPNGCGRA
CYSI_SHIB3       RENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMAKHGVS-DEHIVMRVTGCPNGCGRA
CYSI_ECO55       RENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMAKHGVS-DEHIVMRVTGCPNGCGRA
CYSI_ECOSE       RENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMAKHGVS-DEHIVMRVTGCPNGCGRA
CYSI_ECOLU       RENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMAKHGVS-DEHIVMRVTGCPNGCGRA
CYSI_ECO5E       RENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMAKHGVS-DEHIVMRVTGCPNGCGRA
CYSI_ECO57       RENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMAKHGVS-DEHIVMRVTGCPNGCGRA
CYSI_ECO24       RENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMAKHGVS-DEHIVMRVTGCPNGCGRA
CYSI_ECO8A       RENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMAKHGVS-DEHIVMRVTGCPNGCGRA
CYSI_SHISS       RENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMAKHGVS-DEHIVMRVTGCPNGCGRA
CYSI_SHIBS       RENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMAKHGVS-DEHIVMRVTGCPNGCGRA
CYSI_SHIDS       RENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMAKHGVS-DEHIVMRVTGCPNGCGRA
CYSI_ECOL6       RENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMAKHGVS-DEHIVMRVTGCPNGCGRA
CYSI_ECOBW       RENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMAKHGVS-DEHIVMRVTGCPNGCGRA
CYSI_ECOLI       RENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMAKHGVS-DEHIVMRVTGCPNGCGRA
CYSI_ECOBR       RENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMAKHGVS-DEHIVMRVTGCPNGCGRA
CYSI_ECOK1       RENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMAKHGVS-DEHIVMRVTGCPNGCGRA
CYSI_ECO81       RENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMAKHGVS-DEHIVMRVTGCPNGCGRA
CYSI_ECO45       RENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMAKHGVS-DEHIVMRVTGCPNGCGRA
CYSI_ECOUT       RENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMAKHGVS-DEHIVMRVTGCPNGCGRA
CYSI_ECOL5       RENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMAKHGVS-DEHIVMRVTGCPNGCGRA
CYSI_ECO27       RENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMAKHGVS-DEHIVMRVTGCPNGCGRA
CYSI_SHIFL       RENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMVKHGVS-DEHIVMRVTGCPNGCGRA
CYSI_SHIF8       RENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMVKHGVS-DEHIVMRVTGCPNGCGRA
CYSI_ECOSM       RENSMACVSFPTCPLAMAEAERFLPSFIDKIDNLMAKHGVS-DEHIVMRVTGCPNGCGRA
CYSI_ECOHS       RENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMAKHGVS-DEHIVMRVTGCPNGCGRA
CYSI_ECO7I       RENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMAKHGVS-DEHIVMRVTGCPNGCGRA
CYSI_ESCF3       RENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMAKHGVS-DEHIVMRVTGCPNGCGRA
CYSI_CITK8       RENSMACVSFPTCPLAMAEAERFLPTFVDKVDALMTHHGVS-DEHIVLRVTGCPNGCGRA
CYSI_SALA4       RENSMACVSFPTCPLAMAEAERFLPSFTDKVEAILEKHGIP-DEHIVMRVTGCPNGCGRA
CYSI_SALTI       RENSMACVSFPTCPLAMAEAERFLPSFTDKVEAILEKHGIP-DEHIVMRVTGCPNGCGRA
CYSI_SALTY       RENSMACVSFPTCPLAMAEAERFLPSFTDKVEAILEKHGIP-DEHIVMRVTGCPNGCGRA
CYSI_SALCH       RENSMACVSFPTCPLAMAEAERFLPSFTDKVEAILEKHGIP-DEHIVMRVTGCPNGCGRA
CYSI_SALPC       RENSMACVSFPTCPLAMAEAERFLPSFTDKVEAILEKHGIP-DEHIVMRVTGCPNGCGRA
CYSI_SALNS       RENSMACVSFPTCPLAMAEAERFLPSFTDKVEAILEKHGIP-DEHIVMRVTGCPNGCGRA
CYSI_SALPA       RENSMACVSFPTCPLAMAEAERFLPSFTDKVEAILEKHGIP-DEHIVMRVTGCPNGCGRA
CYSI_SALPK       RENSMACVSFPTCPLAMAEAERFLPSFTDKVEAILEKHGIP-DEHIVMRVTGCPNGCGRA
CYSI_SALDC       RENSMACVSFPTCPLAMAEAERFLPSFTDKVEAILEKHGIP-DEHIVMRVTGCPNGCGRA
CYSI_SALG2       RENSMACVSFPTCPLAMAEAERFLPSFTDKVEAILEKHGIP-DEHIVMRVTGCPNGCGRA
CYSI_SALEP       RENSMACVSFPTCPLAMAEAERFLPSFTDKVEAILEKHGIP-DEHIVMRVTGCPNGCGRA
CYSI_SALHS       RENSMACVSFPTCPLAMAEAERFLPSFTDKVEAILEKHGIP-DEHIVMRVTGCPNGCGRA
CYSI_SALSV       RENSMACVSFPTCPLAMAEAERFLPSFTDKVEAILEKHGIP-DEHIVMRVTGCPNGCGRA
CYSI_SALPB       RENSMACVSFPTCPLAMAEAERFLPSFTDKVEAILEKHGIP-DEHIVMRVTGCPNGCGRA
CYSI_SALAR       RENSMACVSFPTCPLAMAEAERFLPSFVDKVEAVMAKHGVG-NEHIVLRVTGCPNGCGRA
CYSI_ENT38       RENSMACVSFPTCPLAMAEAERFLPSFTDKVEAVLAKHGIP-DEHIVMRVTGCPNGCGRA
CYSI1_KLEP3      RENSMACVSFPTCPLAMAEAERFLPSFIDKVEGVMNKHGVS-DEHIVTRVTGCPNGCGRA
CYSI_KLEP7       RENSMACVSFPTCPLAMAEAERFLPSFIDKVEGVMSKHGVS-DEHIVTRVTGCPNGCGRA
CYSI_CROS8       RENSMACVSFPTCPLAMAEAERFLPQFIDKVDGIMAKHGLA-EEHIVLRVTGCPNGCGRA
CYSI_ERWT9       RENSMACVAFPTCPLAMAEAERFLPQFVTRVEAIMNAHGVG-DEHIVLRVTGCPNGCGRA
CYSI_PECAS       RKNSMACVSFPTCPLAMAEAERFLPEFVTKVEGIMQQHGVG-DEHIVLRVTGCPNGCGRS
CYSI2_PECCP      RKNSMACVSFPTCPLAMAEAERFLPEFVTKVEDIMQQHGVG-DEHIVLRVTGCPNGCGRA
CYSI_DICP7       RKNSMACVSLPTCPLAMAEAERFLPQFVTEVEAIMRNHGVG-DEHIVLRVTGCPNGCGRA
CYSI_DICC1       RQNSMACVSLPTCPLAMAEAERFLPEFVTQVEGIMHKHGVG-DDHIVLRVTGCPNGCGRA
CYSI_YERPE       RENSMACVSFPTCPLAMAEAERFLPEFVTRVEGILQQHGLA-DEHIVLRVTGCPNGCGRA
CYSI_YERPP       RENSMACVSFPTCPLAMAEAERFLPEFVTRVEGILQQHGLA-DEHIVLRVTGCPNGCGRA
CYSI_YERPA       RENSMACVSFPTCPLAMAEAERFLPEFVTRVEGILQQHGLA-DEHIVLRVTGCPNGCGRA
CYSI_YERPN       RENSMACVSFPTCPLAMAEAERFLPEFVTRVEGILQQHGLA-DEHIVLRVTGCPNGCGRA
CYSI_YERP3       RENSMACVSFPTCPLAMAEAERFLPEFVTRVEGILQQHGLA-DEHIVLRVTGCPNGCGRA
CYSI_YERPY       RENSMACVSFPTCPLAMAEAERFLPEFVTRVEGILQQHGLA-DEHIVLRVTGCPNGCGRA
CYSI_YERPS       RENSMACVSFPTCPLAMAEAERFLPEFVTRVEGILQQHGLA-DEHIVLRVTGCPNGCGRA
CYSI_YERPB       RENSMACVSFPTCPLAMAEAERFLPEFVTRVEGILQQHGLA-DEHIVLRVTGCPNGCGRA
CYSI_YERE8       RENSMACVSFPTCPLAMAEAERFLPEFVTRIEGILQQHGLP-DEHIVMRVTGCPNGCGRA
CYSI_SERP5       RQNSMACVSFPTCPLAMAEAERFLPEFVTKVEGILHRHGVG-DEHIVLRITGCPNGCGRA
CYSI_PHOLL       RKNSMACVSFPTCPLAMAEAERFLPEFVTHVEQLMNKHGIG-DEHIVLRVTGCPNGCARA
CYSI_PROMH       RKHAMACVSFPTCPLAMAEAERFLPAFTDTLDNIMAKYGVS-DEHIVVRVTGCPNGCGRA
CYSI_BUCAI       RKNSMACVSFPTCPLAMAEAERMLSFFITQLENIMLKYGVE-DEVIILRVSGCPNGCGRS
CYSI_BUCA5       RKNSMACVSFPTCPLAMAEAERMLSFFITQLENIMLKYGVE-DEVIILRVSGCPNGCGRS
CYSI_BUCAT       RKNSMACVSFPTCPLAMAEAERMLSFFITQLENIMLKYGVE-DEVIILRVSGCPNGCGRS
CYSI_BUCAP       RENSMACVSFPTCPLAIAESERILSFFITKVENIMLKYGIE-KEIIILRISGCPNGCGRS
CYSI_ZYMMO       RKNSMACVSFPTCPLAMAEAERFLPNFLTKVEAVMTKYDIA-DEYIVFRTTGCPNNCGRS
CYSI_ACTPJ       RENAMSCVSLPTCPLAMAEAERVLPDFISELDKVLSKHNVA-DESIITRITGCPNGCRRA
CYSI_ACTP2       RENAMSCVSLPTCPLAMAEAERVLPDFISELDKVLSKHNVA-DESIITRITGCPNGCGRA
CYSI_ACTP7       RENAMSCVSLPTCPLAMAEAERVLPDFISELDKVLSKHNVA-DESIITRITGCPNGCGRA
CYSI_ACTPL       RENAMSCVSLPTCPLAMAEAERVLPDFISELDKVLSKHNVA-DESIITRITGCPNGCGRA
CYSI_ACTSZ       RENSMSCVSFPTCPLAMAESERALPEFIDELDNIMAKHDVA-DDYIVTRITGCPNGCGRA
CYSI_MANSM       RENAMSCVSFPTCPLAMAESERVLPEFIDELDKIMAKHHVE-QDYIVTRITGCPNGCGRA
CYSI_NEIMB       RENAMSCVSFPTCPLAMAEAERVLPDFIGELDKIMAKHGTS-DDYIVTRITGCPNGCGRA
CYSI_NEIM0       RENAMSCVSFPTCPLAMAEAERVLPDFIDELDKIMAKHGTS-DDYIVTRITGCPNGCGRA
CYSI_NEIMF       RENAMSCVSFPTCPLAMAEAERVLPDFIGELDKIMAKHGTS-DDYIVTRITGCPNGCGRA
CYSI_NEIMA       RENAMSCVSFPTCPLAMAEAERVLPDFIGELDKIMAKHGTS-DDYIVTRITGCPNGCGRA
CYSI_AERHH       RKQSMACVALPTCPLAMAEAERMLPAFVTDIEGLLAKHELA-NDAIIFRVTGCPNGCGRA
CYSI_TOLAT       RKNSMACVALPTCPLAMAEAERFLPAFTTQIEAVMAKHGLA-DDHVIFRVTGCPNGCGRA
CYSI_ALIF1       RKNSMACVAFPTCPLAMAEAERFLPEFVTEIEGVLKKHNLPEEDNIIFRVTGCPNGCGRA
CYSI_ALIFM       RKNSMACVAFPTCPLAMAEAERFLPEFVTEIEGVLKKHNLPEEDNIIFRVTGCPNGCGRA
CYSI_ALISL       RKNSMACVAFPTCPLAMAEAERFLPEFVTEIEGVLKKHNLPEDDNIIFRVTGCPNGCGRA
CYSI_VIBTL       RKNSMACVAFPTCPLAMAEAERFLPEFVTDVEDILKKHGLPEEDNIILRITGCPNGCGRA
CYSI_VIBCB       RKNSMACVAFPTCPLAMAEAERFLPQFVTDVEGILEKHGIPEEDNIILRVTGCPNGCGRA
CYSI_VIBPA       RKNSMACVAFPTCPLAMAEAERFLPQFVTDVEGILEKHGLPENDNIILRVTGCPNGCGRA
CYSI_VIBVU       RKNAMACVAFPTCPLAMAEAERFLPQFVTDVEGILDKHGLDKEDNIILRVTGCPNGCGRA
CYSI_VIBVY       RKNSMACVAFPTCPLAMAEAERFLPQFVTDVEGILDKHGLDKEDNIILRVTGCPNGCGRA
CYSI_VIBCH       RINSMACVAFPTCPLAMAEAERFLPSFVTEVEGILAKHALPKEENIILRVTGCPNGCGRA
CYSI_VIBCM       RINSMACVAFPTCPLAMAEAERFLPSFVTEVEGILAKHALPKEENIILRVTGCPNGCGRA
CYSI_VIBC3       RINSMACVAFPTCPLAMAEAERFLPSFVTEVEGILAKHALPKEENIILRVTGCPNGCGRA
CYSI_PHOPR       RKNSMACVAFPTCPLAMAEAERFLPDFVTDVEGVLAKHGLAEDDNIILRVTGCANGCGRA
CYSI_ALTMD       RLDSMACVALPTCPLAMAEAERYLPDAVTELEGLLAKHGLE-EDSVIFRVTGCPNGCGRA
CYSI_PSEA6       RKDSMACVALPTCPLAMAEAERYLPEAVTQLEGILAKHAIA-QKSIIYRVTGCPNGCGRS
CYSI_PSEHT       RKNSMACVALPTCPLAMAEAERYLPSLVEKIEALLAKHGVP-NDSIIMRVVGCPNGCGRA
CYSI_SHEAM       RKNSMACVSLPTCPLAMAEAERYLPTLVTHVEGILSKHGIA-DDHIILRVVGCPNGCGRA
CYSI_COLP3       RKSSMACVAFPTCPLAMAEAERYLPGLVDDVEAILEKNGLK-DDSIILRVTGCPNGCGRA
CYSI_BAUCH       RKASMACVAFPTCPLAMAEAERFLPQFVTKVENIMSRHGLG-QEKIILRVTGCPNGCGRA
CYSI_SODGM       RKASMACVAFPTCPLAMAEAERFLPQFVSNVETIMSGHGLA-EDEIILRVTGCSNGCGRA
CYSI_BLOFL       RKSSMACVAFPTCPLAMAEAERFLPAFVTKVEHVMSKYNLQ-RDAIILRVTGCPNGCARA
CYSI_BLOPB       RKASMACVAFPTCPLAMAEAERFLPKFVTKIEHIMSKYRLE-KDAIILRVTGCPNSCARA
CYSI2_KLEP3      RKSAMACVSYPTCPLAMAEAERVLPDIVDRLDAILIRNGIA-DRDVIFRVTGCPNGCGRA
CYSI1_PECCP      RKDSMACVSFPTCPLAMAEAERVLPDVVSQIEHLLHKYGVG-DESFVFRITGCPNGCGRA
CYSI_PSYIN       RFNSMACVALPTCPLAMAEAERYLPGLVTDVEALLTKHGIG-DDHIILRVTGCPNGCARP
CYSI_SHEB5       RGHSIACVALPTCPLAMAEAERYFPEFIDHIDALQAKHGIS-EQAIVVRMTGCPNGCARP
CYSI_SHEB9       RGHSIACVALPTCPLAMAEAERYFPEFIDHIDALQAKHGIS-EQAIVVRMTGCPNGCARP
CYSI_SHEB2       RGHSIACVALPTCPLAMAEAERYFPEFIDHIDALQAKHGIS-EQAIVVRMTGCPNGCARP
CYSI_SHEB8       RGHSIACVALPTCPLAMAEAERYFPEFIDHIDALQAKHGIS-EQAIVVRMTGCPNGCARP
CYSI_SHEPC       RGHSIACVALPTCPLAMAEAERYFPEFIDHIDALQAKHGIS-EQAIVVRMTGCPNGCARP
CYSI_SHESW       RGHSIACVALPTCPLAMAEAERYFPEFIDHIDALQAKHGIS-EQAIVVRMTGCPNGCARP
CYSI_SHESA       RGHSIACVALPTCPLAMAEAERYFPEFIDHIDALQAKNGIS-DQAIVVRMTGCPNGCARP
CYSI_SHESR       RGHSIACVALPTCPLAMAEAERYFPEFIDHIDALQAKNGIS-DQAIVVRMTGCPNGCARP
CYSI_SHESM       RGHSIACVALPTCPLAMAEAERYFPEFIDHIDALQAKNGIS-DQAIVVRMTGCPNGCARP
CYSI_SHEON       RGHSIACVALPTCPLAMAEAERYFPEFIDHIDALQAKNGIS-DQAIVVRMTGCPNGCARP
CYSI_SHEDO       RGHSIACVALPTCPLAMAEAERYFPEFIDHIDALQAKHGIS-DQSIVVRMTGCPNGCARP
CYSI_SHEFN       RGHSIACVALPTCPLAMAEAERYFPEFIDHIDALQAKHGIS-EQSIVVRMTGCPNGCARP
CYSI_SHEHH       RGHSIACVALPTCALAMAEAERYFPDFLTKVEALQQKHGFL-DQGIVIRMTGCPNGCARP
CYSI_SHEPA       RGHSIACVALPTCALAMAEAERYFPDFLTKVEALQEKHGFL-DQGIVIRMTGCPNGCARP
CYSI_SHEPW       RGHSIACVALPTCALAMAEAERYFPDFLTKVEALQDKHGFL-DQGIVIRMTGCPNGCARP
CYSI_SHESH       RGRSIACVALPTCALAMAEAERYFPDFLTKVESLQEKHGFA-DQGIVIRMTGCPNGCARP
CYSI_SHEWM       RGRSIACVALPTCALAMAEAERYFPDFLSKVESLQEKHGFL-DQGIVIRMTGCPNGCARP
CYSI_SHELP       RGHSIACVALPTCALAMAEAERYFPDFMTKVEALQEKHGFL-EQPIVIRMTGCPNGCARP
CYSI_THIRO       RLNGMSCVALPTCPLAMAEAERYYPDFLAQVERLTRKHGLA-EQEIVTRMTGCPNGCARP
CYSI_LEPBA       RKNSIACVALNTCSLALAEAQRYLPSLIDKIEPILSKHGLS-EEPISIRMTGCPNGCARP
CYSI_LEPBP       RKNSIACVALNTCSLALAEAQRYLPSLIDKIEPILSKHGLS-EEPISIRMTGCPNGCARP
CYSI_ACIF2       RAHAMACVALPTCPLAMAEAERYLPVFLDRIEALLAEVGLE-GEALTVRMTGCPNGCARP
CYSI_ACIF5       RAHAMACVALPTCPLAMAEAERYLPVFLDRIEALLAEVGLE-GEALTVRMTGCPNGCARP
CYSI_XANAC       ARGAMACVALPTCGLAMAEAERYLPDFGAALQPLLQQHGLA-ETPIVLRLSGCPNGCSRP
CYSI_XANC5       ARGAMACVALPTCGLAMAEAERYLPDFSAALQPLLQQHGLA-DTPIVLRVSGCPNGCSRP
CYSI_XANOM       ARGAMACVALPTCGLAMAEAERYLPDFSAALQPLLQQHGLA-DTPIVLRLSGCPNGCSRP
CYSI_XANOP       ARGAMACVALPTCGLAMAEAERYLPDFSAALQPLLQQHGLA-DTPIVLRLSGCPNGCSRP
CYSI_XANOR       ARGAMACVALPTCGLAMAEAERYLPDFSAALQPLLQQHGLA-DTPIVLRLSGCPNGCSRP
CYSI_XANC8       ARGAMACVALPTCGLAMAEAERYLPDFSAALQPLLERHGLA-QTPIVLRLSGCPNGCSRP
CYSI_XANCB       ARGAMACVALPTCGLAMAEAERYLPDFSAALQPLLERHGLA-QTPIVLRLSGCPNGCSRP
CYSI_XANCP       ARGAMACVALPTCGLAMAEAERYLPDFSAALQPLLERHGLA-QTPIVLRLSGCPNGCSRP
CYSI_XYLF2       GRHAMACVALPTCGLAMAEAERYLPDFNAKLQPILEKYGLA-EAPILLRISGCPNGCSRP
CYSI_XYLFT       GRHAMACVALPTCGLAMAEAERYLPDFNAKLQPILEKYGLA-EAPILLRISGCPNGCSRP
CYSI_XYLFM       ARHAMACVALPTCGLAMAEAERYLPDFNAKLQPILEKYGLA-ETPILLRISGCPNGCSRP
CYSI_XYLFA       ARHAMACVALPTCGLAMAEAERYLPDFNVKLQPILEKYGLA-EKPILLRISGCPNGCSRP
CYSI_MYXXD       RRNALACVALPTCGLAMAEAERYLPTFVGRLEDRLRAHGLQ-DANLLLRITGCPNGCARP
CYSI_GEOKA       RRNALACVALPTCGLAMAEAERYLPKLLDKIEEIIDENGLR-DEEITIRMTGCPNGCARH
CYSI_GEOTN       RRNSLACVALPTCGLAMAEAERYLPKLLDKIEEIIDENGLR-DEEITIRMTGCPNGCARH
CYSI_ANOFW       RRNSLACVALPTCGLAMAEAERYLPTLIDKIEEIVEENGLR-DEEITIRMTGCPNGCARH
CYSI_BACVZ       RRSSMACVALPTCGLAMAEAERYLPKLIDKIEDIVDENGLR-DEEITIRMTGCPNGCARH
CYSI_BACSU       RRSSMACVALPTCGLAMAEAERYLPTLLDKIEEIIDENGLR-DQEITIRMTGCPNGCARH
CYSI_BACHD       RRSSIACVALPTCGLAMAEAERYLPKLIDKIDEIIEENGLK-NEEITIRMTGCPNGCARH
CYSI_BACLD       RRSSIACVALPTCGLAMAEAERYLPKLIDKIDEIVEENGLK-NEEITIRMTGCPNGCARH
CYSI_BACP2       RRSSMACVALPTCGLAMAEAERYLPRLIDKIEEIVEENGLS-DKEITIRMTGCPNGCARH
CYSI_BACSK       RRNSMACVAFPTCGLAMAESERYLPSLIDKLEFILDEAGIR-EEDIVIRMAGCPNGCSRA
CYSI_LYSSC       RRNSIACVSLPTCGLAMAEAERYLPSLITKIETIIDETGLN-DTEIVIRMSGCPNGCSRA
CYSI_PAESJ       RRSALSCVALPTCGLAMAEAERYLPSLIDRLEPILANAGLQ-DQEINIRMTGCPNGCARP
CYSI_BREBN       RRNSMACVSLPTCGLAMAEAERYLPTLLDEIELILDEAGLR-DEEIVIRMTGCPNGCARP
CYSI_OCEIH       RRNSMACVAFPTCGLAMAESERYLPELLDKIEVILDESGLR-EEEIVIRMSGCPNGCSRP
CYSI_STAEQ       RRNSMACVAFPTCGLAMAESERYLPSLITKIEDLLDESGLK-EEEITIRMTGCPNGCARP
CYSI_STAES       RRNSMACVAFPTCGLAMAESERYLPSLITKIEDLLDESGLK-EEEITIRMTGCPNGCARP
CYSI_STAHJ       RRNSMACVAFPTCGLAMAESERYLPSLISKIEDLLDEAGVD-DEEITIRMTGCPNGCARP
CYSI_STAS1       RRNSMACVAFPTCGLAMAESERYLPSLITKIEDLLDEAGLK-EEEITIRMTGCPNGCARP
CYSI_STACT       RRNSMACVAFPTCGLAMAESERYLPSLVGKIEDLLDEFGLS-EEEITIRMTGCPNGCARP
CYSI_NITOC       RQHAMSCVALPSCGLAMAESERMLPGFLARLEAVVEKAGLA-DEPITLRVTGCPNGCSRP
CYSI_NITHX       RLNSMACVALPTCGLAMAESERYLPDLVTKIEAILNVHGLK-DDPITIRMTGCPNGCSRP
CYSI_NITWN       RLNSMACVALPTCGLAMAESERYLPDLLTKIEAILNTYGLT-DDPITIRMTGCPNGCARP
CYSI_OLICO       RLNSMACVALPTCGLAMAESERYLPDLISKIEPLLERYGLT-DEPITIRMTGCPNGCARP
CYSI_BORPD       RLNSMACVALPTCGLAMAESERYLPELVGKIEALLRTHGLE-REPITIRMSGCPNGCSRP
CYSI_METSB       RLNSMACVALPTCGLAMAESERYLPTLVTKIETILAEKGLE-KEPITIRMTGCPNGCARP
CYSI_NITEC       RLNSMACVAFPTCGLAMADSERYLPTLITKIEGILTRYNLQ-DEPITLRMTGCPNGCSRP
CYSI_NITEU       RLNSMACVALPTCGLAMADSERYLPDLITKIEGILTRYNLQ-NEPITLRMTGCPNGCSRP
CYSI_METC4       RRNSMACVALPTCGLALAESERYLPDLLSELEESLARHGLQ-DEPITIRSTGCPNGCARP
CYSI_METEP       RRNSMACVALPTCGLALAESERYLPDLLSELEESLARHGLQ-DEPITIRSTGCPNGCARP
CYSI_METEA       RRNSMACVALPTCGLALAESERYLPDLLSELEESLARHGLQ-DEPITIRSTGCPNGCARP
CYSI_METPB       RRNSIACVALPTCGLALAESERYLPDLLTELEESLARHGLQ-DEPITIRSTGCPNGCARP
CYSI_METRJ       RRSSLACVALPTCGLALAESERYLPDLMTELEESLASHGLA-EEEITIRSTGCPNGCARP
CYSI_METNO       RRNSLACVALPTCGLALAESERFMPGLLTELEESLAAHGLQ-DEDITIRMTGCPNGCARP
CYSI_METS4       RRNSLACVALPTCGLALAESERFMPDLLTRLEERLAAHGLR-DEDITVRMTGCPNGCARP
CYSI_CHRSD       RRHAMACVAFPTCGLAMAESERYLPSLIDRLDAIMREAGLA-DDAIIVRMTGCPNGCARP
                    .::**:  :* **:*:::*  .     ::             .  *  **.*.* * 

CYSI_ECOLC       MLAEVGLVGKAPGRYNLHLSGNRIGTRIPRMYKENITEPEILASLDELIGRWAKER--EA
CYSI_SHIB3       MLAEVGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITEPEILASLDELIGRWAKER--EA
CYSI_ECO55       MLAEVGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITEPEILASLDELIGRWAKER--EA
CYSI_ECOSE       MLAEVGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITEPEILASLDELIGRWAKER--EA
CYSI_ECOLU       MLAEVGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITEPEILASLDELIGRWAKER--EA
CYSI_ECO5E       MLAEVGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITEPEILASLDELIGRWAKER--EA
CYSI_ECO57       MLAEVGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITEPEILASLDELIGRWAKER--EA
CYSI_ECO24       MLAEVGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITEPEILASLDELIGRWAKER--EA
CYSI_ECO8A       MLAEVGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITEPEILASLDELIGRWAKER--EA
CYSI_SHISS       MLAEVGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITEPEILASLDELIGRWAKER--EA
CYSI_SHIBS       MLAEVGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITEPEILASLDELIGRWAKER--EA
CYSI_SHIDS       MLAEVGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITEPEILASLDELIERWAKER--EA
CYSI_ECOL6       MLAEVGLVGKAPGRYNLHLGGNRMGTRIPRMYKENITEPEILASLDELIGRWAKER--EA
CYSI_ECOBW       MLAEVGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITEPEILASLDELIGRWAKER--EA
CYSI_ECOLI       MLAEVGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITEPEILASLDELIGRWAKER--EA
CYSI_ECOBR       MLAEVGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITEPEILASLDELIGRWAKER--EA
CYSI_ECOK1       MLAEVGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITEPEILASLDELIGRWAKER--EV
CYSI_ECO81       MLAEVGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITEPEILASLDELIGRWAKER--EV
CYSI_ECO45       MLAEVGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITEPEILASLDELIGRWAKER--EV
CYSI_ECOUT       MLAEVGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITEPEILASLDELIGRWAKER--EV
CYSI_ECOL5       MLAEVGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITEPEILASLDELIGRWAKER--EV
CYSI_ECO27       MLAEVGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITESEILASLDELIGRWAKER--EV
CYSI_SHIFL       MLAEVGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITEPEILASLDELIGRWAKER--EA
CYSI_SHIF8       MLAEVGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITEPEILASLDELIGRWAKER--EA
CYSI_ECOSM       MLAEVGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITEPEILASLDELIGRWAKER--EA
CYSI_ECOHS       MLAEVGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITEPEILASLDELIGRWAKER--EA
CYSI_ECO7I       MLAEVGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITEPEILALLDELIGRWAKER--EA
CYSI_ESCF3       MLAEVGLVGKAPGRYNLHLGGNRIGTRIPRMHKENITEPEILATLDELIGRWAKER--EA
CYSI_CITK8       MLAEVGLVGKAPGRYNLHLGGNRIGTRIPRMFKENITEPEILASLDELIGRWVKER--EA
CYSI_SALA4       MLAEIGLVGKAPGRYNLHLGGNRIGSRIPRMYQENITEPDILASLDELIGRWAKER--EA
CYSI_SALTI       MLAEIGLVGKAPGRYNLHLGGNRIGSRIPRMYQENITEPDIQASLDELIGRWAKER--EA
CYSI_SALTY       MLAEIGLVGKAPGRYNLHLGGNRIGSRIPRMYKENIAEPDILASLDELIGRWAKER--EA
CYSI_SALCH       MLAEIGLVGKAPGRYNLHLGGNRIGTRIPRMYQENITEPDILASLDQLIGRWAKER--EA
CYSI_SALPC       MLAEIGLVGKAPGRYNLHLGGNRIGTRIPRMYQENITEPDILASLDQLIGRWAKER--EA
CYSI_SALNS       MLAEIGLVGKAPGRYNLHLGGNRIGSRIPRMYKENITEPDILASLDELIGRWAKER--EA
CYSI_SALPA       MLAEIGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITEPDILASLGELIGRWAKER--EA
CYSI_SALPK       MLAEIGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITEPDILASLGELIGRWAKER--EA
CYSI_SALDC       MLAEIGLVGKAPGRYNLHLGGNRIGTRIPRMYQENITEPDILASLDELIGRWAKER--EA
CYSI_SALG2       MLAEIGLVGKAPGRYNLHLGGNRIGTRIPLMYQENITEPDILASLDELIGRWAKER--EA
CYSI_SALEP       MLAEIGLVGKAPGRYNLHLGGNRIGTRIPRMYQENITEPDILASLDELIGRWAKER--EA
CYSI_SALHS       MLAEIGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITEPDILASLGELIGRWAKER--EA
CYSI_SALSV       MLAEIGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITESDILASLDELVGRWAKER--EA
CYSI_SALPB       MLAELGLVGKAPGRYNVHLGGNRMGTRIPRMYRENITESEILDSVDELVGRWAKER--EA
CYSI_SALAR       MLAEIGLVGKAPGRYNLHLGGNRIGSRIPRMYKENITEPAILASLDELIGRWAKER--EA
CYSI_ENT38       LLAELGLVGKAPGRYNVHLGGNRSGTRIPRMYRENITEPEILDSLDELVGRWAKER--EA
CYSI1_KLEP3      MLAEVGLVGKAPGRYNLHLGGNRSGTRIPRMYRENITESEILDSLDELVGRWAKER--EA
CYSI_KLEP7       MLAEVGLVGKAPGRYNLHIGGNRNGTRIPRMYRENITESEILDSLDELVGRWAKER--EA
CYSI_CROS8       MLAELGLVGKAPGRYNLHLGGNRIGTRIPRMYRENITESEILDNIDELVGRWAQER--EP
CYSI_ERWT9       LLAEIGLVGKAPGRYNLHLGGNRIGTRIPRMYQENINEEQILATLDELIGRWSQER--NA
CYSI_PECAS       MLAEIGLVGKAMGRYNLHLGGNREGTRIPRMYRENINETEILAEIDRLVGLWAQDR--LQ
CYSI2_PECCP      MLAEIGLVGKAVGRYNLHLGGNREGTRIPRMYRENINETEILAEIDRLIGLWAQDR--QP
CYSI_DICP7       LLAEIGLVGKAIGRYNLHLGGNREGTRIPRMYRENITEAEILREIDALVGRWAAER--QP
CYSI_DICC1       MLAEIGLVGKAIGRYNLHIGGNREGTRIPRMYRENITEKEILTEIDQLVARWAGER--HS
CYSI_YERPE       LLAEVGLVGKAVGRYNLHLGGNREGTRIPRMYRENITADEILLITDQLVGRWAKER--HV
CYSI_YERPP       LLAEVGLVGKAVGRYNLHLGGNREGTRIPRMYRENITADEILLITDQLVGRWAKER--HV
CYSI_YERPA       LLAEVGLVGKAVGRYNLHLGGNREGTRIPRMYRENITADEILLITDQLVGRWAKER--HV
CYSI_YERPN       LLAEVGLVGKAVGRYNLHLGGNREGTRIPRMYRENITADEILLITDQLVGRWAKER--HV
CYSI_YERP3       LLAEVGLVGKAVGRYNLHLGGNREGTRIPRMYRENITADEILLITDQLVGRWAKER--HV
CYSI_YERPY       LLAEVGLVGKAVGRYNLHLGGNREGTRIPRMYRENITADEILLITDQLVGRWAKER--HV
CYSI_YERPS       LLAEVGLVGKAVGRYNLHLGGNREGTRIPRMYRENITADEILLITDQLVGRWAKER--HV
CYSI_YERPB       LLAEVGLVGKAVGRYNLHLGGNREGTRIPRMYRENITADEILLITDQLVGRWAKER--HV
CYSI_YERE8       LLAEMGLVGKAVGRYNLHLGGNREGTRIPRMYRENITEDEILAITDQLVGRWAKER--HT
CYSI_SERP5       LLAEIGLVGKAVGRYNLHLGGNREGTRIPRMYRENINEEEILREIDQLVGRWATER--TA
CYSI_PHOLL       MLAEVGLVGKALDRYNLHLGGNRIGTRIPRMYKENISSQAILSIMDELIGRWATGR--QP
CYSI_PROMH       MLAEVGLVGKAPDRYNLHLGGNRMGTRIPRMYRENISSQEIIEILDTLIGQWAISR--EL
CYSI_BUCAI       LLAEIGLIGKSIGRYNLYIGGNRIGNRIPKIYKENITEQEILIHLKYLIKTWSNER--KN
CYSI_BUCA5       LLAEIGLIGKSIGRYNLYIGGNRIGNRIPKIYKENITEQEILIHLKYLIKTWSNER--KN
CYSI_BUCAT       LLAEIGLIGKSIGRYNLYIGGNRIGNRIPKIYKENITEQEILMHLKYLIKTWSNER--KN
CYSI_BUCAP       LLAEIGLIGKSLGRYNLYIGGNRIGSRIPKIYKENITEQEILIHLDFLIKIWSIER--QK
CYSI_ZYMMO       LLAEIGLVGRAIGRYNLYIGGDRVGTRIPRLFRENITEDEILSEVDSLIGRWAKER--DG
CYSI_ACTPJ       MLAEIGLVGKAIGRYNLHIGGDRAGLRIPRLYKENITLQEIVNEIDQLVARWATER--QT
CYSI_ACTP2       MLAEIGLVGKAIGRYNLHIGGDRAGLRISRLYKENITLQEIVNEIDQLVARWATER--QT
CYSI_ACTP7       MLAEIGLVGKAIGRYNLHIGGDRAGLRISRLYKENITLQEIVNEIDQLVARWATER--QT
CYSI_ACTPL       MLAEIGLVGKAIGRYNLHIGGDRAGLRIPRLYKENITLQEIVNEIDQLVARWATER--QT
CYSI_ACTSZ       MLAEIGLVGKAIGRYNLHLGGDRPGTRIPRMYKENITLPEILAELDGLIGRWAKER--NS
CYSI_MANSM       MLAEIGLVGKAVGRYNLHLGGNIAGTRIPRLYKENITLDEILSELDGLIARWATER--DQ
CYSI_NEIMB       MLAEIGLVGKAVGRYNLHIGGDREGVRIPRLYKENITLPEILAELDDLIGKWAAER--NI
CYSI_NEIM0       MLAEIGLVGKAVERYNLHIGGDREGVRIPRLYKENITLPEILAELDDLIGKWAAER--NI
CYSI_NEIMF       MLAEIGLVGKAVGRYNLHIGGDREGVRIPRLYKENITLPEILSELDDLIGKWAAGR--DT
CYSI_NEIMA       MLAEIGLVGKAVGRYNLHIGGDREGVRIPRLYKENITLPEILAELDDLIGKWAAER--NI
CYSI_AERHH       MLAEVGLVGKAPGRYNLHLGGNLEGTRIPRLHLENITEPQILAELDALIGRWAKDR--NA
CYSI_TOLAT       MLAEIGLVGKAMDRYNFYIGGNREGTRIPRQYRENITSAEILKEIDALLGRWAKER--NE
CYSI_ALIF1       MLAEIGLVGKAPGRYNFHLGGNRSGTRVPKMYKENITDRQILTEIDQLVGRWATER--NE
CYSI_ALIFM       MLAEIGLVGKAPGRYNFHLGGNRSGTRVPKMYKENITDRQILTEIDHLVGRWAIER--NE
CYSI_ALISL       MLAEIGLIGKAPGRYNFHLGGNRSGTRVPKMYKENITDRQILSEIDELVGRWATER--QE
CYSI_VIBTL       MLAELGLVGKAPGRYNMHLGGNKAGTRIPKMYKENITSAQILEEIDSLVGRWATER--TD
CYSI_VIBCB       MLAEIGLVGKAPGRYNLHLGGNRGGTRVPKMCKENITDKQILEEIDQLVARWAAER--EE
CYSI_VIBPA       MLAEIGLVGKAPGRYNLHLGGNRAGTRVPKMYKENITDKQILEEIDLLVARWSKER--EE
CYSI_VIBVU       MLAEIGLVGKAPGRYNLHLGGNRGGTRVPKMYKENITDKQILEEIDQLVGRWANER--LP
CYSI_VIBVY       MLAEIGLVGKAPGRYNLHLGGNRGGTRVPKMYKENITEKQILEEIDQLVGRWANER--LP
CYSI_VIBCH       MLAEIGLVGKAPGRYNLHLGGNRNGTRIPKMYKENITDTQILQEIDELVGRWASER--LD
CYSI_VIBCM       MLAEIGLVGKAPGRYNLHLGGNRNGTRIPKMYKENITDTQILQEIDELVGRWASER--LD
CYSI_VIBC3       MLAEIGLVGKAPGRYNLHLGGNRNGTRIPKMYKENITDTQILQEIDELVGRWASER--LD
CYSI_PHOPR       MLAEIGLVGKAPGRYNVHLGGNRNGTRVPKMYRENITVPQIMDEIDQLVGRWANER--ED
CYSI_ALTMD       MLSEVGLVGKGPGKYNLHLGGNREGTRIPRMYRENISEQEIMAELDTLLGQWAKER--DS
CYSI_PSEA6       MLAEIGLVGKGPGKYNLHLGGNRQGTRIPKMYKENIGEQQIMDELDVLIGQWAKEA--QS
CYSI_PSEHT       MLAEAGLVGKGPGKYNVYLGGNLEGTRIPKLYLENVGEDVYLAAFDELIGQWVNER--ND
CYSI_SHEAM       MLAEAGLVGRGPGKYNLYLGGNTAGTRIPKLYLDNVAEAEILAALDSLIGRWSVER--NP
CYSI_COLP3       MLAEIGLVGKGPGKYNMYLGSDLAGSRVPKLYKENVDEAGVLSEIDALSARWSAER--ND
CYSI_BAUCH       MLAEIGLVGKTIGRYNLYLGGDSIGTRIPRIYRENLTEEEILSIINDTTGRWARER--QP
CYSI_SODGM       MLAEIGLVGKAIGRYNLYLGGDRIGTRIPRIYRENITEDEILSIIDDTAGRWARER--QP
CYSI_BLOFL       MLAEIGLTGRGIGRYNLYLGGNKNGTRIPRLYKENITEDEILHVLDITIGDWAKNR--KT
CYSI_BLOPB       MLSEIGLTGRSIGRYNLYLGGNNIGTRIPRLYKENITENDILNILDTTISRWAQER--NS
CYSI2_KLEP3      MLAEIGLVGRAVGRYDIYLGGNREGTRIPRLYKENQPLEEIIRDLDALLSAWAQAD--NP
CYSI1_PECCP      MLAEVGLIGRAVGRYSLYIGGNREGTRIPRLYKDNIDVPTLFDEIEKLIALWAKER--NI
CYSI_PSYIN       LLAEVGLIGKAPGRYNLYLGGNTNGTRLPKMYKENIDEAAIIMTMDELIGRWANER--ES
CYSI_SHEB5       FAAEIGLVGKAPGRYNLYLGASFEGTRLNKMHRENIQEAEILAELDTLFGRYAVER--DA
CYSI_SHEB9       FAAEIGLVGKAPGRYNLYLGASFEGTRLNKMHRENIQEAEILAELDTLFGRYAVER--DA
CYSI_SHEB2       FAAEIGLVGKAPGRYNLYLGASFEGTRLNKMHRENIQEAEILAELDTLFGRYAVER--DA
CYSI_SHEB8       FAAEIGLVGKAPGRYNLYLGASFEGTRLNKMHRENIQEAEILAELDTLFGRYAVER--DA
CYSI_SHEPC       FAAEIGLVGKAPGRYNLYLGASFEGTRLNKMHRENIQEADILAELDTLFGRYAVER--DA
CYSI_SHESW       FAAEIGLVGKAPGRYNLYLGASFEGTRLNKMHRENIQEADILAELDTLFGRYAVER--DA
CYSI_SHESA       FAAEIGLVGKAPGRYNLYLGANFEGTRLNKMYRENIQEAEILAELDALFARYAVER--NA
CYSI_SHESR       FAAEIGLVGKAPGRYNLYLGANFEGTRLNKMYRENIQEAEILAELDALFARYAVER--NA
CYSI_SHESM       FAAEIGLVGKAPGRYNLYLGANFEGTRLNKMYRENIQEAEILAELDALFARYAIER--NA
CYSI_SHEON       FAAEIGLVGKAPGRYNLYLGANFEGTRLNKMYRENIQEAEILAELDALFARYAIER--NA
CYSI_SHEDO       FAAEIGLVGKAPGRYNLYLGANFEGTRLNKMHKENIQEAEILAELDTLFGRYATER--DA
CYSI_SHEFN       FAAEIGLVGKAPGRYNLYLGASFEGTRLNKMHKENIQEAEILAELDTLFGRYATER--DA
CYSI_SHEHH       FAAEIGLVGKAPGRYNLYLGASFEGTRLNKLYRENIQEAEILDQLDTLFAQYASQR--QA
CYSI_SHEPA       FAAEIGLVGKAPGRYNLYLGASFEGTRLNKLYRENIQEAEILAELDALFALYVAER--QA
CYSI_SHEPW       FAAEIGLVGKAPGRYNLYLGASFEGTRLNKLYRENIQEAEILAELDSLFARYVAER--ET
CYSI_SHESH       FAAEIGLVGKAPGRYNLYLGASFEGTRLNKLYRENIQEAEILSELDQLFARYVSER--EE
CYSI_SHEWM       FAAEIGLVGKAPGRYNLYLGASFEGTRLNKLYRENIQEAEILSELDSLFARYVAER--EE
CYSI_SHELP       FAAEIGLVGKAPGRYNLYLGASFEGTRLNKLYRENIQEAEILAALDELFARYVKER--EA
CYSI_THIRO       YLAELALVGKGPGRYNLMLGGNGRRYRLNRLYRENLDEAAILAEIDTLLGRYAACR--QP
CYSI_LEPBA       YISEIGLVGTSYGKYNLHVGADAEGYRLNKKYKEDLDESAILQELDGLFGKFSKDR--KG
CYSI_LEPBP       YISEIGLVGTSYGKYNLHVGADAEGYRLNKKYKEDLDESAILQELDGLFGKFSKDR--KG
CYSI_ACIF2       YLAEIGLVGKAPGLYDLYLGGDRTGMRLNALYREALDEEALLDALRPLLKRFAGQR--WA
CYSI_ACIF5       YLAEIGLVGKAPGLYDLYLGGDRTGMRLNALYREALDEEALLDALRPLLKRFAGQR--WA
CYSI_XANAC       YLAEIALVGKAPGRYNLMLGGDRRGQRLNTLYRENITEPEILAALEPLLARYAAERDHAN
CYSI_XANC5       YLAEMALVGKAPGRYNLMLGGDRRGQRLNTLYRENITEPEILAALQPLLARYASEGDHAN
CYSI_XANOM       YLAEIALVGKAPGRYNLMLGGDRRGQRLNTLYRENITEPEILAALEPLLARYAAERDHAN
CYSI_XANOP       YLAEIALVGKAPGRYNLMLGGDRRGQRLNTLYRENITEPEILAALEPLLARYAAERDHAN
CYSI_XANOR       YLAEIALVGKAPGRYNLMLGGDRRGQRLNTLYRENITEPEILAALEPLLARYAAERDHAN
CYSI_XANC8       YLAEIALVGKAPGRYNLMLGGDRRGQRLNTLYRENINEADILAALEPLLARYAAERDRHT
CYSI_XANCB       YLAEIALVGKAPGRYNLMLGGDRRGQRLNTLYRENINEADILAALEPLLARYAAERDRHT
CYSI_XANCP       YLAEIALVGKAPGRYNLMLGGDRRGQRLNTLYRENINEADILAALEPLLARYAAERDRHT
CYSI_XYLF2       YLAEIALVGKAPGRYNLMLGGDQRGQRLNTLYRENITETEILAALEPLLGRYQQKR--LP
CYSI_XYLFT       YLAEIALVGKAPGRYNLMLGGDQRGQRLNTLYRENITETEILAALEPLLGRYQQKR--LP
CYSI_XYLFM       YLAEIALVGKAPGRYNLMLGGDQRGQRLNTLYRENITETEILAALEPLLGRYQQKR--LP
CYSI_XYLFA       YLAEIALVGKAPGRYNLMLGGDQRGQRLNTLYRENITETEILAALEPLLGRYQQKR--LP
CYSI_MYXXD       YLAEVGLVGKAPGRYNLHLGGDARGQRLSHLYRENIDEDAILAALEPLFEGYARER--QP
CYSI_GEOKA       VLAEIAFVGKAVGKYNMYLGAAFNGTRLGKLYRENIGEEEILRELRMLLSRYAKER--LD
CYSI_GEOTN       VLAEIAFVGKAVGKYNMYLGAAFNGTRLGKLYRENIGEEEILRELRVLLARYAKER--LD
CYSI_ANOFW       VLGEIAFIGKSVGKYNMYLGAAFDGSRLGKLYRENIGEKEILSELRMLLSRYAKER--FD
CYSI_BACVZ       ALGEIGFIGKAPGKYNMYLGAAFDGSRLSKMYRENIGEEEILSELRTILPRYAKER--EE
CYSI_BACSU       ALGEIGFIGKAPGKYNMYLGAAFDGSRLSKMYRENIGEADILSELRILLSRYAKER--EE
CYSI_BACHD       ALGEIGFIGKAPGKYNMYLGAAFDGSRLSKMYRENIGEEEILKELREILPRYAKER--KE
CYSI_BACLD       ALGEIGFIGKAPGKYNMYLGAAFDGSRLSKMYRENIGEEEILKELRNILPRYAKER--NE
CYSI_BACP2       ALGEIGFIGKSPGKYNMYLGAAFDGSRLSKLYRENVGEEEILNELGSLLPRYAKER--EE
CYSI_BACSK       ALAEIGFIGKAPGKYNLYLGGGFAGERLSKMYKENIGEAEILETLEPILFAYAKER--EE
CYSI_LYSSC       AMAEIGFIGKGPGKYNLYLGASFTGNRLNKIYRENIGEEEILAELRPILVHYAKER--LV
CYSI_PAESJ       ALGEISFIGKSPGKYNMYMGAGFTGDRLSKMYKENIGEDEIIDTLTPIIDRYASER--NK
CYSI_BREBN       ALAEISFIGKAVGKYNMYLGGGFSGNRLNKLYRENIGEAEILNELRPILNRYAKER--EE
CYSI_OCEIH       ALAEIAFIGKAPGKYNMYLGGSFNGSRLNKLYKENIGEEEILNTLRPIFIDFAKDK--QK
CYSI_STAEQ       ALAEIAFIGKAPGKYNMYLGGSFKGERLNKIYKENIDENEILESLRPLLLRYSKER--LD
CYSI_STAES       ALAEIAFIGKAPGKYNMYLGGSFKGERLNKIYKENIDENEILESLRPLLLRYSKER--LD
CYSI_STAHJ       ALAEIAFIGKAPGKYNMYLGGGFKGERLNKLYKENIGEQEILESLRPILMDYGKER--LE
CYSI_STAS1       ALAEVAFIGKGPGKYNMYLGGGFIGDRLNKIYKENIGEAEILESLRPILLQYAKER--TE
CYSI_STACT       ALAEISFIGKAPGKYNFYLGGSFKGDRLNKLYKENIGEKEILESLRPILEQYSKER--EK
CYSI_NITOC       YISEIALVGKSLGRYNLYLGAGFAGQRLNKLYRESLTEDEIIATLSPLFEHYARER--QQ
CYSI_NITHX       YIAEIGLTGRAPGKYNLYLGGGFHGERLNKMYLENVGEGAILEALDKTLGHYARDR--KP
CYSI_NITWN       YIAEIGLTGRAPGKYNLYLGGGFHGERLNKMYLENVGEPAILEALDKTLGHYARDR--KP
CYSI_OLICO       YVAEIALTGRAPGKYNLYLGGGFHGERLNKMYLENVGESAILDALDKVLGHFARER--TP
CYSI_BORPD       YIAEIGLTGRAPGKYNLYLGGGFHGQRLNRMVLENAAEAAILALLDTTLAHYARDR--HE
CYSI_METSB       YVAEIALTGRAPGKYNLYFGGGFHGQRLNKMYLENVGEDAILQAVDAIAGHYAQDK--NP
CYSI_NITEC       FIAEIGLTGRAPGKYNLYLGGGFHGQRLNRLYRENIGEAAILEALDEVLRHYATER--LP
CYSI_NITEU       FIAEIGLTGRAPGKYNLYLGGGFHGQRLNRLYRENIGEPAILETLNEVLGRYATER--LP
CYSI_METC4       FISEIGLVGRGPERYHLYLGAAFDGSRLSKLYREDVTASEITGTLDPLFAAYAKDR--QP
CYSI_METEP       FISEIGLVGRGPERYHLYLGAAFDGSRLSKLYREDVTASEIKGTLDPLFAAYAKDR--QP
CYSI_METEA       FISEIGLVGRGPERYHLYLGAAFDGSRLSKLYREDVTASEIKGTLDPLFAAYAKDR--QP
CYSI_METPB       FISEIGLVGRGPERYHLYLGAAFDGSRLSKLYREDVLASEIKDTLDPLFAAYAKDR--QP
CYSI_METRJ       FISEIGLVGRGPERYHLYLGAAHDGSRLSKLYKEDVAASEIRDTLDPLFADYARGR--QP
CYSI_METNO       YIAEIGFVGRGPERYNLYLGAAFDGSRLSKLYAEDVAAKDIRATLDPLFAAYARDR--QP
CYSI_METS4       FIAEIGFVGRGPERYNVYLGAAFDGSRLSKLYADDVAAADIPALLDPLFAAYARER--IP
CYSI_CHRSD       YLAEIGFVGKTIGRYNLYLGGGFAGERLNKLYRENIDEATILEELTPLIRRYAVER--EP
                   .* .: *     * . ...     *:     :                 :        

CYSI_ECOLC       GEGFGDFTVRAGIIRPVLDPARDLWD-------------
CYSI_SHIB3       GEGFGDFTVRAGIIRPVLDPARDLWD-------------
CYSI_ECO55       GEGFGDFTVRAGIIRPVLDPARDLWD-------------
CYSI_ECOSE       GEGFGDFTVRAGIIRPVLDPARDLWD-------------
CYSI_ECOLU       GEGFGDFTVRAGIIRPVLDPARDLWD-------------
CYSI_ECO5E       GEGFGDFTVRAGIIRPVLDPARDLWD-------------
CYSI_ECO57       GEGFGDFTVRAGIIRPVLDPARDLWD-------------
CYSI_ECO24       GEGFGDFTVRAGIIRPVLDPARDLWD-------------
CYSI_ECO8A       GEGFGDFTVRAGIIRPVLDPARDLWD-------------
CYSI_SHISS       GEGFGDFTVRAGIIRPVLDPARDLWD-------------
CYSI_SHIBS       GEGFGDFTVRAGIIRPVLDPARDLWD-------------
CYSI_SHIDS       GEGFGDFTVRAGIIRPVLDPARDLWD-------------
CYSI_ECOL6       GEGFGDFTVRAGIIRPVLDPARDLWD-------------
CYSI_ECOBW       GEGFGDFTVRAGIIRPVLDPARDLWD-------------
CYSI_ECOLI       GEGFGDFTVRAGIIRPVLDPARDLWD-------------
CYSI_ECOBR       GEGFGDFTVRAGIIRPVLDPARDLWD-------------
CYSI_ECOK1       GEGFGDFTVRAGIIRPVLDPARDLWD-------------
CYSI_ECO81       GEGFGDFTVRAGIIRPVLDPARDLWD-------------
CYSI_ECO45       GEGFGDFTVRAGIIRPVLDPARDLWD-------------
CYSI_ECOUT       GEGFGDFTVRAGIIRPVLDPARDLWD-------------
CYSI_ECOL5       GEGFGDFTVRAGIIRPVLDPARDLWD-------------
CYSI_ECO27       GEGFGDFTVRAGIIRPVLDPARDLWD-------------
CYSI_SHIFL       GEGFGDFTVRAGIIRPVLDPARDLWD-------------
CYSI_SHIF8       GEGFGDFTVRAGIIRPVLDPARDLWD-------------
CYSI_ECOSM       GEGFGDFTVRAGIIRPVLDPARDLWD-------------
CYSI_ECOHS       GEGFGDFTVRAGIIRPVLDPARDLWD-------------
CYSI_ECO7I       GEGFGDFTVRAGIIRPVLDPARDLWD-------------
CYSI_ESCF3       GEGFGDFTVRAGIIRPVLDPARDLWD-------------
CYSI_CITK8       GEGFGDFTVRAGIIRPVLDPARDFWE-------------
CYSI_SALA4       GEGFGDFTVRAGIIRPVLDPARDFWE-------------
CYSI_SALTI       GEGFGDFTVRAGIIRPVLDPARDFWE-------------
CYSI_SALTY       GEGFGDFTVRAGIIRPVLDPARDFWE-------------
CYSI_SALCH       GEGFGDFTVRAGIIRPVLDPARDFWDNLNCRMASV----
CYSI_SALPC       GEGFGDFTVRAGIIRPVLDPARDFWE-------------
CYSI_SALNS       GEGFGDFTVRAGIIRPVLDPARDFWE-------------
CYSI_SALPA       GEGFGDFTVRAGIIRPVLDPARDFWE-------------
CYSI_SALPK       GEGFGDFTVRAGIIRPVLDPARDFWE-------------
CYSI_SALDC       GEGFGDFTVRAGIIRPVLDPARDFWE-------------
CYSI_SALG2       GEGFGDFTVRAGIIRPVLDPARDFWE-------------
CYSI_SALEP       GEGFGDFTVRAGIIRPVLDPARDFWE-------------
CYSI_SALHS       GEGFGDFTVRAGIIRPVLDPARDFWE-------------
CYSI_SALSV       GEGFGDFTVRAGIIRPVLDPARDFWE-------------
CYSI_SALPB       GEGFGDFTVRAGIIRPVLDPARDFWE-------------
CYSI_SALAR       GEGFGDFTVRAGIIRPVLDPARDFWE-------------
CYSI_ENT38       GEGFGDFTVRAGIIRPVLDPARDFWE-------------
CYSI1_KLEP3      GEGFGDFTVRAGIIRPVLDPARDFWE-------------
CYSI_KLEP7       GEGFGDFTVRAGIIRPVLDPARDFWE-------------
CYSI_CROS8       GEGFGDFTVRAGIIRPVLDPARDFWE-------------
CYSI_ERWT9       DEGFGDFTLRAGVVKPVLDPARDFWQ-------------
CYSI_PECAS       NEGFGDFVIRTNIIRPVLDPARDFYD-------------
CYSI2_PECCP      NEGFGDFTIRTNIIRPVLDPARDFYD-------------
CYSI_DICP7       DEGFGDFAIRAGIVRPVLDPAVDFYD-------------
CYSI_DICC1       GEGFGDFAIRVGIVKPVLDPAIDFYD-------------
CYSI_YERPE       DEGFGDFVIRAGVIAPVIDSARDFYDVQEAM--------
CYSI_YERPP       DEGFGDFVIRAGVIAPVIDSARDFYDVQEAM--------
CYSI_YERPA       DEGFGDFVIRAGVIAPVIDSARDFYDVQEAM--------
CYSI_YERPN       DEGFGDFVIRAGVIAPVIDSARDFYDVQEAM--------
CYSI_YERP3       DEGFGDFVIRAGVIAPVIDSARDFYDVQEAM--------
CYSI_YERPY       DEGFGDFVIRAGVIAPVIDSARDFYDVQEAM--------
CYSI_YERPS       DEGFGDFVIRAGVIAPVIDSARDFYDVQEAM--------
CYSI_YERPB       DEGFGDFVIRAGVIAPVIDSARDFYDVQEAM--------
CYSI_YERE8       DEGFGDFVIRVGVIAPVIDSARDFYDVQEAV--------
CYSI_SERP5       GEGFGDFTIRAGVVRPVVDPAQDFWD-------------
CYSI_PHOLL       NEGFGDFLIRTDIIKPVLDSARDFYDWQEAV--------
CYSI_PROMH       NEGFGDFLIRTDVIKPVVNSAIDFYEVQEVI--------
CYSI_BUCAI       KEDFGDFIVRKEFVKEVINPVYDFWS-------------
CYSI_BUCA5       KEDFGDFIVRKEFVKEVINPVYDFWS-------------
CYSI_BUCAT       KEDFGDFIVRKEFVKEVINPVYDFWS-------------
CYSI_BUCAP       KEHFGDFVIRRNVVKKVVNPIYDFWN-------------
CYSI_ZYMMO       KEAFGDFVVRAGIVKAVTDPAIDFYD-------------
CYSI_ACTPJ       NEAFGDFVIRSNIIAPVVNAHIDFWDATKIIPTTII---
CYSI_ACTP2       NEAFGDFVIRSNIIAPVVNAHIDFWDATKIIPTTII---
CYSI_ACTP7       NEAFGDFVIRSNIIAPVVNAHIDFWDATKIIPTTII---
CYSI_ACTPL       NEAFGDFVIRSNIIAPVVNAHIDFWDATKIIPTTII---
CYSI_ACTSZ       NEGFGDFVIRAGIIKPVVNAVVDFWDANLIPTVTA----
CYSI_MANSM       GEGFGDFVLRVGIIKPVVNPVVDFWDENLIPTVAV----
CYSI_NEIMB       GEGFGDFAIRTGIVKPVLNAPVDFWDASKAVAIARA---
CYSI_NEIM0       GEGFGDFAIRTGIVKPVLNAPVDFWDVSKAVAIARA---
CYSI_NEIMF       DEGFGDFAIRTGIVKPVLDAPVDFWDASKAVPIARA---
CYSI_NEIMA       GEGFGDFAIRTGIVKPVLNAPVDFWDASKAVAIARA---
CYSI_AERHH       GECFGDFVIRAGIIAPVIDSARDFYAA------------
CYSI_TOLAT       NEGFGDFVIRAGIVKPVVDSAKDFYAA------------
CYSI_ALIF1       NEGFGDFTIRAGIVDEVKVSKRDFHA-------------
CYSI_ALIFM       NEGFGDFTIRAGIVDEVKVSKRDFHA-------------
CYSI_ALISL       NEGFGDFTIRAGIVDEVKVSKRDFYA-------------
CYSI_VIBTL       NEGFGDFTIRAGIIEEVIISKRDLHA-------------
CYSI_VIBCB       GEAFGDFTIRAGIIQEVFVSKRDFHA-------------
CYSI_VIBPA       GEAFGDFTIRAGIIQEVFVSKRDFYA-------------
CYSI_VIBVU       NECFGDFTVRVGIIEEVIISKRDFYA-------------
CYSI_VIBVY       NECFGDFTVRVGIIEEVIISKRDFYA-------------
CYSI_VIBCH       GEGFGDFTIRAGIIEEVIISKRDFYA-------------
CYSI_VIBCM       GEGFGDFTIRAGIIEEVIISKRDFYA-------------
CYSI_VIBC3       GEGFGDFTIRAGIIEEVIISKRDFYA-------------
CYSI_PHOPR       GEDFGDFTVRTGIIEPVLVSKRDFYA-------------
CYSI_ALTMD       GEAFGDYVVRAGVVKPVVDSARDFYDQ------------
CYSI_PSEA6       DESFGDFVIRTGVIAEVVNSAEDFYA-------------
CYSI_PSEHT       GECFGDFVIRKGIVAEVKVSVTDFHA-------------
CYSI_SHEAM       GECFGDFVIRVGVVAEVKVSKTDFHA-------------
CYSI_COLP3       GEAFGDFVIRAGIVEQVIVSFRDFHHA------------
CYSI_BAUCH       DESYGDYVVRAGIIRPVINSALDFHN-------------
CYSI_SODGM       QESYGDYLVRAGIVRPVVDSARDFYD-------------
CYSI_BLOFL       QESYGDYVVRAGIVRAVINSEEDFYL-------------
CYSI_BLOPB       QESYGDYVVRSGIVNAVINSEKDFYE-------------
CYSI2_KLEP3      DEAFGDFAIQTGIIRPVLNSSIDFYLQD-----------
CYSI1_PECCP      GEGFGDFVIRAKIIMPVINAPVDFHTAV-----------
CYSI_PSYIN       GECFGDFVIRAAIIAEVIIASKDFHD-------------
CYSI_SHEB5       GETFGNFTVRVGVVKAVIDAAKDFHG-------------
CYSI_SHEB9       GETFGNFTVRVGVVKAVIDAAKDFHG-------------
CYSI_SHEB2       GETFGNFTVRVGVVKAVIDAAKDFHG-------------
CYSI_SHEB8       GETFGNFTVRVGVVKAVIDAAKDFHG-------------
CYSI_SHEPC       GETFGNFTVRVGVVKAVIDAAKDFHG-------------
CYSI_SHESW       GETFGNFTVRVGVVKAVIDAAKDFHG-------------
CYSI_SHESA       GETFGNFTVRTGVVKAVIDAAKDFHG-------------
CYSI_SHESR       GETFGNFTVRTGVVKAVIDAAKDFHG-------------
CYSI_SHESM       GETFGNFTVRTGVVKAVIDAAKDFHG-------------
CYSI_SHEON       GETFGNFTVRVGVVKAVIDAAKDFHG-------------
CYSI_SHEDO       GETFGNFTVRIGVVKAVNDAAKDFHG-------------
CYSI_SHEFN       GETFGNFTVRIGVVKAVNDAAKDFHA-------------
CYSI_SHEHH       GETFGNYTVRSGVVAAVNDAAKDFHG-------------
CYSI_SHEPA       GETFGNYTVRSGVVAAVLDAAKDFHG-------------
CYSI_SHEPW       GETFGNYTVRSGVVTAVIDAAKDFHG-------------
CYSI_SHESH       GETFGNFTVRSGVVKAVIDAAKDFHD-------------
CYSI_SHEWM       GETFGNFTVRIGAVSAVIDAAKDFHEQHNHA--------
CYSI_SHELP       GETFGNFTVRVGVVKAVIDAAKDFHG-------------
CYSI_THIRO       GERFGDYLIRDGIVRPVVNPAEDFHE-------------
CYSI_LEPBA       KESFGDYINRIGILK------------------------
CYSI_LEPBP       KESFGDYINRIGILK------------------------
CYSI_ACIF2       GETFGDFVRRQDLLPPDPGL-PHTGRR------------
CYSI_ACIF5       GETFGDFVRRQDLLPPDPGL-PHTGRR------------
CYSI_XANAC       DEGFGDFLHRAGVIALPPYP-THRRLDLELLA-------
CYSI_XANC5       DEGFGDFLHRAGVIALPPYP-THRRLDLELLA-------
CYSI_XANOM       DEGFGDFLHRAGLIALPSYP-THRRLDLELLA-------
CYSI_XANOP       DEGFGDFLHRAGLIALPSYP-THRRLDLELLA-------
CYSI_XANOR       DEGFGDFLHRAGLIALPSYP-THRRLDLELLA-------
CYSI_XANC8       DEGFGDFLHRSGLIALPPYP-THRHLDLELLA-------
CYSI_XANCB       DEGFGDFLHRSGLIALPPYP-THRHLDLELLA-------
CYSI_XANCP       DEGFGDFLHRSGLIALPPYP-THRHLDLELLA-------
CYSI_XYLF2       SEGFGDFLHRTGIIALPPYP-THRHVISSTLQA------
CYSI_XYLFT       SEGFGDFLHRTGIIALPPYP-THRHVISSTLQA------
CYSI_XYLFM       SEGFGDFLHRTGIIALPPYP-THRHVISSTLQA------
CYSI_XYLFA       GEGFGDFLHRTGIIALPPYP-THRHVISSTLQA------
CYSI_MYXXD       GEGFGDFVVRAGHVPSPAVQ-PRPS--------------
CYSI_GEOKA       GEHFGDFVIRAGIVKEVTDG-TNFHD-------------
CYSI_GEOTN       GEHFGDFVIRAGIVKEVTDG-TNFHD-------------
CYSI_ANOFW       GERFGDFVIRAGIVKEVTDG-TNFHD-------------
CYSI_BACVZ       GEHFGDFVIRAGIIKATTDG-TNFHE-------------
CYSI_BACSU       GEHFGDFVIRAGIIKATTDG-TNFHD-------------
CYSI_BACHD       GEHFGDFVIRAGIIKETTDG-TNFHD-------------
CYSI_BACLD       GERFGDFVIRAGIVKETTDG-TNFHD-------------
CYSI_BACP2       KEHFGDFVVRAGIVKETTDG-TNFHVQ------------
CYSI_BACSK       GEHFGDFVIRKGYVKAVESG-TDFHQ-------------
CYSI_LYSSC       GEHFGDFVIRAGYVTAVYDG-REFHV-------------
CYSI_PAESJ       GENFGDFVIRAGYVKAVTDG-TNFHD-------------
CYSI_BREBN       GEHFGDFVIRAGYVKEVRSG-LDFHE-------------
CYSI_OCEIH       DEHFGDFVIRAGYVEEVKSG-LDFHSSKEDVRS------
CYSI_STAEQ       GEHFGDFVIRDGVIAKVHDG-RDFHS-------------
CYSI_STAES       GEHFGDFVIRDGVIAKVHDG-RDFHS-------------
CYSI_STAHJ       GEHFGDFVIRSGVVAKVHGG-QDFHS-------------
CYSI_STAS1       GEHFGDFVVRAGIVEEVRDG-QTFHS-------------
CYSI_STACT       GEHFGDFVVRKGIVEKVTDG-RDFRG-------------
CYSI_NITOC       GEHFGDFVVRAGYVDEVRAG-REFHEVRSEKAVQSA---
CYSI_NITHX       GEHFGDFAIRAGYVVEVKEG-RFFND-------------
CYSI_NITWN       GEHFGDFAIRAGYVVEVKEG-RFFND-------------
CYSI_OLICO       GEHFGDFAIRAGYVAEVKEG-RYFND-------------
CYSI_BORPD       GEHFGDFAVRAGYVEAVTAG-RDFNQRRAPGAGATAPHA
CYSI_METSB       GEHFGDFTIRAGYVKEVRAG-REFND-------------
CYSI_NITEC       DEHFGDFTIRAGIIREVTEG-RFSND-------------
CYSI_NITEU       DEHFGDFTIRAGIIREVTEG-RFSND-------------
CYSI_METC4       GEHFGDFVIRAGFVAKTSNG-PDFHERTGPLRAA-----
CYSI_METEP       GEHFGDFVIRAGFVAKTSNG-PDFHERTGPLRAA-----
CYSI_METEA       GEHFGDFVIRAGFVAKTSNG-PDFHERTGPLRAA-----
CYSI_METPB       GEHFGDFVIRAGFVAKTSNG-PDFHERTGPLRAA-----
CYSI_METRJ       GEHFGDYLIRAGHVARTTNG-PDFHDRTGALKPATLG--
CYSI_METNO       GERFGDFVIRAGFVAKTING-PDFHDRTGALKAVA----
CYSI_METS4       GERFGDFVIRAGYVARTVNG-PDFHDRTGPLRAVA----
CYSI_CHRSD       GEAFGDFVVRTGIIAPTLAG-REFHA-------------
                  * :*::  :   :