CLUSTAL format seed alignment for MF_01542

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y809_STAAS       -MNPIVEFCLSNMAKGGDYVFNQLENDPDVDVLEYGCLTHCGICSAGLYALVNGDIVEGD
Y821_STAAW       -MNPIVEFCLSNMAKGGDYVFNQLENDPDVDVLEYGCLTHCGICSAGLYALVNGDIVEGD
Y901_STAAR       -MNPIVEFCLSNMAKGGDYVFNQLENDPDVDVLEYGCLTHCGICSAGLYALVNGDIVEGD
Y939_STAAM       -MNPIVEFCLSNMAKGGDYVFNQLENDPDVDVLEYGCLTHCGICSAGLYALVNGDIVEGD
Y800_STAAN       -MNPIVEFCLSNMAKGGDYVFNQLENDPDVDVLEYGCLTHCGICSAGLYALVNGDIVEGD
Y942_STAAC       -MNPIVEFCLSNMAKGGDYVFNQLENDPDVDVLEYGCLTHCGICSAGLYALVNGDIVEGD
Y633_STAES       -MFPLVEFCISNMAKGSDVVFEKLENDPNIDVLEYGCLQNCGLCASSLYALVDGDIVEGN
Y525_STAEQ       -MFPLVEFCISNMAKGSDVVFEKLENDPNIDVLEYGCLQNCGLCASSLYALVDGDIVEGN
Y2012_STAHJ      -MFPLVEFCISNMAKGGDYVYDKLENDPDVDVLEYGCLNNCSVCSCGLYALVDGDTVEGD
Y5172_BACAN      MIKPLIEFCVGNLASGSQAALEKLEKDPNLDVMEYGCLGYCGICFEGPFALVNGEVVQGA
Y5075_BACC1      MIKPLIEFCVGNLASGSQAALEKLEKDPNLDVMEYGCLGYCGICFEGPFALVNGEVVQGA
Y4937_BACCR      MIKPLIEFCVGNLASGSQAALEKLEKDPNLDVMEYGCLGYCGICFEGPFALVNGEVVQGA
Y4669_BACCZ      MIKPLIEFCVGNLASGSQAALEKLEKDPNLDVMEYGCLGYCGICFEGPFALVNGEVVQGS
Y4649_BACHK      MIKPLIEFCVGNLASGSQAALEKLEKDPNLDVMEYGCLGYCGICFEGPFALVNGEVVQGS
Y3414_ALKHC      -MRPIIEFCLSNLASGTQKAMEELEKDPNLDIIEYGCLSHCGSCANDKFALVNGEYVSGE
Y2936_BACSK      -MRPIIEFCLSNLASGSHDAMEELEKDPNLDIIEYGCLNHCGTCALDHFALVNGEYIAGD
Y2958_GEOKA      -MLPIIEFCISNLASGSYKAMEMLEKDPNLDIIEYSCLSYCTRCAETLFALVNGEFVSGE
Y3401_BACLD      -MFPIVEFCVSNLAQGSQEAKEILEKDPNLDVVEYGCLSYCGQCMQTMYALVNGEMVTAN
YUZB_BACSU       -MNPMIEFCVSNLAHGSQEARAILEKDPNLDVLEYGCLSYCGTCMESLFALVNGEVVMGE
Y2491_LISIN      -MNPIVEFCVNNLASGADAAFAKLDADDSLDVIEYDCLTYCDLCATSLFALVDGEVVRGE
Y2366_LISMF      -MNPIVEFCVNNLASGADAAFAKLDADDSLDVIEYDCLTYCDLCATSLFALVDGEVVRGE
Y2392_LISMO      -MNPIVEFCVNNLASGADAAFAKLDADDNLDVIEYDCLTYCDLCATSLFALVDGEVVRGE
                  : *::***:.*:* *   .   *: * .:*::**.**  *  *    :***:*: : . 

Y809_STAAS       SPEELLQNIYAHIKETWIF---
Y821_STAAW       SPEELLQNIYAHIKETWIF---
Y901_STAAR       SPEELLQNIYAHIKETWIF---
Y939_STAAM       SPEELLQNIYAHIKETWIF---
Y800_STAAN       SPEELLQNIYAHIKETWIF---
Y942_STAAC       SPEELLQNIYAHIKETWIF---
Y633_STAES       TPDDLLKNIYQHIEDNDITNLL
Y525_STAEQ       TPDDLLKNIYQHIEDNDITNLL
Y2012_STAHJ      TPDELLKNIYKHIEENDFTNLL
Y5172_BACAN      TVEELVNNVYEYLDENPMF---
Y5075_BACC1      TVEELVNNVYEYLDENPMF---
Y4937_BACCR      TVEELVNNVYEYLDENPMF---
Y4669_BACCZ      TVEELVNNVYEYLDENPMF---
Y4649_BACHK      TVEELVNNVYEYLDENPMF---
Y3414_ALKHC      TNEQLVENIYHYLDENPMF---
Y2936_BACSK      TPEELVSNIYKYLEENPMF---
Y2958_GEOKA      TPEQLVENIYRHLEENPMF---
Y3401_BACLD      NPAELVENIYKFIDENELI---
YUZB_BACSU       TPAELVENIYTFIEENPMF---
Y2491_LISIN      TAEELVANIYTFLEENPF----
Y2366_LISMF      TAEELVANIYTFLEENPF----
Y2392_LISMO      TAEELVANIYTFLEENPF----
                 .  :*: *:* .:.:. :