CLUSTAL format seed alignment for MF_01543

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

FTHS_THEAC       ----------------MRDIEEIIKEIG---------------LGRDD--YELYGRYMAK
FTHS_THEVO       ----------------MRDIEEILHEMG---------------LSKDD--YELYGRYMAK
FTHS_PICTO       ----------------MKNISEIIN------------------IPEDY--YDLYGRYIAK
FTHS_DEHM1       MTINNRKSHLKDLDPGLMKDWEIAEKAEEFLKPSKMLA-EELGLTEDE--IIPHGKYVAK
FTHS_DEHMC       MAVNDREFHLKELDPVLMKDWEIAEKAEDFLKPVKVLA-MELGLTEDE--IIPHGKYIAK
FTHS_PHOPR       ----------------MKSDIQICRDTA--LTPIDQIA-LMAGIEPQD--LTPQGTLKAK
FTHS_VIBCH       ----------------MLPDIEICRATP--LAPIDTIA-QKAGLHANE--YESHGQHKAK
FTHS_VIBVU       ----------------MLSDIDICRTTP--LKPIEQIA-AKAGLLADE--FETHGLYKAK
FTHS_VIBVY       ----------------MLSDIDICRTTP--LKPIEQIA-AKAGLLADE--FETHGLYKAK
FTHS_VIBPA       ----------------MQSDIEICRNTP--LSSIDVIA-EKAGLLPEE--FDTHGKYKAK
FTHS_ALIF1       ----------------MKSDIEICQTAT--LTRMKTIA-SNLGLHDDD--ITPQGPFKAK
FTHS_SHEON       ----------------MLTDMEISRRAH--LKDIAQLG-AEFGLLPEE--MQLFGNTKAK
FTHS_CUTAK       ----------------MKSDLEIAREAH--LDPIEKVA-ARAGIDEKY--LEPYGRGVAK
FTHS_THET2       ----------------------MIVKED--LLPIEEVA-AKLGLDRDR--LYLYGPHMAK
FTHS_MOOTH       -------------MSKVPSDIEIAQAAK--MKPVMELA-RGLGIQEDE--VELYGKYKAK
FTHS_CALS4       ----------------MKSDIEIAQEAK--MLHIRDVA-AKLGIEEDY--LEYYGKYKAK
FTHS_CLOAB       ----------------MKTDIEIAQEAK--MEPIVKIA-EKIGLNEDD--IDLYGKYKCK
FTHS_CLOPE       ----------------MKNDIEIAQSAK--MEPIINIA-KKIGLGEDD--IELYGKYKCK
FTHS_CLOTE       -------------MEKVLTDIEIAQKAQ--MKPIGEIA-EKYGILEDE--LELYGKYKAK
FTHS_FUSNN       -----------------MTDIQIAQAAK--KENIVEIA-KKLGLTEDD--IEQYGKYKAK
FTHS_NEIMA       --------------MSFKTDAEIAQSST--MRPIGEIA-AKLGLNVDN--IEPYGHYKAK
FTHS_NEIMB       --------------MSFKTDAEIAQSST--MRPIGEIA-AKLGLNADN--IEPYGHYKAK
FTHS_NEIG1       --------------MSFKTDAETAQSST--MRPIGEIA-AKLGLNVDN--IEPYGHYKAK
FTHS_HAEDU       ----------------MKSDVEIAQSAT--MQHINHIA-EKLGLTVDQ--IEQYGKYKAK
FTHS2_STRP8      ---------------MVLSDIEIANSVT--MEPISKVA-NQLGIDEEA--LCLYGKYKAK
FTHS2_STRPM      ---------------MVLSDIEIANSVT--MEPISKVA-NQLGIDEEA--LCLYGKYKAK
FTHS2_STRP3      ---------------MVLSDIEIANSVT--MEPISKVA-NQLGIDEEA--LCLYGKYKAK
FTHS2_STRP1      ---------------MVLSDIEIANSVT--MEPISKVA-DQLGIDKEA--LCLYGKYKAK
FTHS2_STRP6      ---------------MVLSDIEIANSVT--MEPISKVA-DQLGIDKET--LCLYGKYKAK
FTHS_SYMTH       ----------------MLSDIAIAQRAR--LEPITKVA-EQIGLGPED--LELYGRYKAK
FTHS_RHILO       -------------MAEVKSDIEIARAAK--KKQIQEIG-QKIGIPTEH--LLPYGHDKAK
FTHS_RHIME       -------------MGEVKSDIEIARAAR--KQPIMEVG-AKLGIPPEH--LLPYGHDKAK
FTHS_RUEPO       --------------MAYKSDIEIAREAR--KLPILEIG-AKLGIAADE--LLPYGHDKAK
FTHS_PELUB       -------------MSEVKSDIQIAREAK--MQPINDIL-AKINVPDESSAFSPMGRHIAK
FTHS_METEA       ----------------MPSDIEIARAAT--LKPIAQVA-EKLGIPDEA--LHNYGKHIAK
FTHS_ZYMMO       ----------------MLSDIEIARAAT--LKPITEIA-GRLNIPDES--VLSYGHTIAK
FTHS_METCA       -----------------MSDIEIAQRAK--MLPIIDLAREKLGIPAAS--LDPYGHYKAK
FTHS_BACCZ       ----------MTTTTTVKSDIEIAQEAS--MKKIQEIA-ADLNILEDE--LEPYGHYKGK
FTHS_BACHK       ----------MTTTTTVKSDIEIAQEAS--MKKIQEIA-ADLNILEDE--LEPYGHYKGK
FTHS_BACAN       ----------MTTTTTVKSDIEIAQEAN--MKKIQEIA-ADLNILEDE--LEPYGHYKGK
FTHS_BACC1       ----------MTTTTTVKSDIEIAQEAS--MKKIQEIA-ADLNILEDE--LEPYGHYKGK
FTHS_BACCR       ----------MTTTTTVKSDIEIAQEAS--MKKIQEIA-ADLNILEDE--LEPYGHYKGK
FTHS_LISMF       ------------MSNKVKSDIEIASKAE--ILPVTTIA-EHLGLDADA--LELYGKYKAK
FTHS_LISMO       ------------MSNKVKSDIEIASKAE--ILPVTTIA-EHLGLDADA--LELYGKYKAK
FTHS_LISIN       ------------MSNKVKSDIEIASVAE--ILPVTTIA-EHLGLDADA--LELYGKYKAK
FTHS_STRA3       ----------------MKTDIEIAQSVA--LKPIAEIV-EQVGIGFDD--IELYGKYKAK
FTHS_STRA5       ----------------MKTDIEIAQSVA--LKPIAEIV-EQVGIGFDD--IELYGKYKAK
FTHS1_STRP1      ----------------MKSDIEIAQSVA--LQPITDIV-KKVGIDGDD--IELYGKYKAK
FTHS1_STRP3      ----------------MKSDIEIAQSVA--LQPITDIV-KKVGIDGDD--IELYGKYKAK
FTHS1_STRP6      ----------------MKSDIEIAQSVA--LQPITDIV-KKVGIDGDD--IELYGKYKAK
FTHS1_STRP8      ----------------MKSDIEIAQSVA--LQPITDIV-KKVGIDGDD--IELYGKYKAK
FTHS1_STRPM      ----------------MKSDIEIAQSVA--LQPITDIV-KKVGIDGDD--IELYGKYKAK
FTHS_STRT1       ----------------MKTDIEIAQSVE--LKPITEVV-EKVGIGFDD--LELYGKYKAK
FTHS_STRT2       ----------------MKTDIEIAQSVE--LKPITEVV-EKVGIGFDD--LELYGKYKAK
FTHS_STRPN       ----------------MKTDIEIAQSIE--LKPIVDVV-EKLGISYDD--LELYGKYKAK
FTHS_STRR6       ----------------MKTDIEIAQSIE--LKPIVDVV-EKLGISYDD--LELYGKYKAK
FTHS_STRMU       ----------------MKTDIEIAQSVD--LRPITNVV-KKLGFDFDD--LELYGKYKAK
FTHS_ENTFA       ----------------MKTDINIAQAAT--LKPIQEIA-ETIGLSEDS--LELYGKYKAK
FTHS_LACLA       ----------------MKTDIEIAQAAD--IQPITKIA-EKIGLSFDD--IELYGKYKAK
FTHS_STAAM       --------------MTHLSDLDIANQST--LQPIKDIA-ASVGISEDA--LEPYGHYKAK
FTHS_STAAN       --------------MTHLSDLDIANQST--LQPIKDIA-ASVGISEDA--LEPYGHYKAK
FTHS_STAAR       --------------MTHLSDLDIANQST--LQPIKDIA-ASVGISEDA--LEPYGHYKAK
FTHS_STAAS       --------------MTHLSDLDIANQST--LQPIKDIA-ASVGISEDA--LEPYGHYKAK
FTHS_STAAW       --------------MTHLSDLDIANQST--LQPIKDIA-ASVGISEDA--LEPYGHYKAK
FTHS_STAAC       --------------MTHLSDLDIANQST--LQPIKDIA-ASVGISEDA--LEPYGHYKAK
FTHS_STAHJ       --------------MAHLSDLDIANQSE--LKPIGEIA-EKAGIPADA--LEQYGHYKAK
FTHS_STAES       --------------MAQLSDLEIANLSK--LKPISEIA-RKVGITEDA--LEPYGHYKAK
FTHS_STAEQ       --------------MAQLSDLEIANLSK--LKPISEIA-RKVGITEDA--LEPYGHYKAK
FTHS_BACLD       -------------MKSHLSDIEIAQRTE--LKPITEIA-RKLNINDEE--IECFGCTKAK
FTHS_CORDI       ----------------MPTDVEIAQAHT--LEPITDIA-NRAGVPSDA--LIPYGFTKAK
FTHS_CORJK       ------MTNSSATSNPQPSDVEIAQAHT--LEPITTIA-ERAGIPEAA--LIPYGRTKAK
FTHS1_LACAC      ----------------MKSDIEIAQETK--ELPIEEIA-AKVNLKKED--LEPYGQDKAK
FTHS_LACJO       ----------------MKSDIEIAQDTK--ELPITEIA-KKVDLQPDE--IELYGNDKAK
FTHS2_LACAC      ----------------MPTDIEIADAAK--MQPITEIA-QKLGLSSDD--IEQYGHYKAK
FTHS_LACPL       -----------------MKDIEIAQQVT--PEPITAIA-AKAGLTVDQ--IDQYGSTKAK
FTHS_BACFN       ----------------MKSDIEIARSVE--LKKIKQVA-ESIGIPRDE--VENYGRYIAK
FTHS_BACFR       ----------------MKSDIEIARSVE--LKKIKQVA-ESIGIPRDE--VENYGRYIAK
FTHS_BACTN       ----------------MKSDIEIARSVE--LKKIKQVA-ESIGIPREE--VENYGRYIAK
FTHS_PORGI       ----------------MKSDIQIARDIE--LQRIEQIA-ESIDLPVEQ--LEPYGRYTAK
FTHS_TREDE       ----------------MKTDIEIAREAK--LKKIAEIA-DGLGIHDDN--VIPYGKYIAK
FTHS_THEMA       ------------------------------MKPIKEIA-DQLELKDDI--LYPYGHYIAK
FTHS_HALMA       ------------------------------MEPIWELV-EPWGLGLDD--LQYFGEYTAK
FTHS_MYCPE       ----------------MTNNIFKYFN---------------------IKELEKFGKFYKV
FTHS_UREPA       ----------------MAKIIEEMINKK----------------GLLIDDYELYGNEIAK
                                                                       *     

FTHS_THEAC       LD-LGLQNRGRPR-----AKLILVTAMTPTPAGEGKTTTTIGLGQAM-KKLGKNVAIAIR
FTHS_THEVO       LS-LNLQEVNKKK-----AKLILVTAMTPTAAGEGKTTTTIGLGQAF-KKLGKNVAIAIR
FTHS_PICTO       VS-LNVLDYLKNKR---YGKLILVTAMTPTPAGEGKTTTAIGLGNAL-KLLGKNAGIAIR
FTHS_DEHM1       VDFAGVLTRLKDRP---NGKYIDVTAITPTPLGEGKSTTTMGLVQGL-GNLGKKVTGAIR
FTHS_DEHMC       VDFAGVLARLKDRP---NGKYIDVTAITPTPLGEGKSTTTMGLVQGL-GKLGKKVTGAIR
FTHS_PHOPR       VK-PSILNRLADKP---EGKLVLVTAITPTPLGEGKTVTTIGLAQGL-AKINKRVIACIR
FTHS_VIBCH       VS-LHCLERLANKP---KGKFILVTAITPTPLGEGKTVTTIGLAQGL-AKLNHSVMACIR
FTHS_VIBVU       VS-ARCVKRLAEQQ---DGKLVLVTAITPTPLGEGKTVTTIGLAQGL-QSLNQSVMACIR
FTHS_VIBVY       VS-ARCVKRLAEQQ---DGKLVLVTAITPTPLGEGKTVTTIGLAQGL-QSLNQSVMACIR
FTHS_VIBPA       VH-PKCLARLNDNQ---NGKLVLVTAITPTPLGEGKTVTTIGLAQGL-AKLKQSVMACIR
FTHS_ALIF1       VN-IDALKRLKSEP---NGKLILVSAITPTPLGEGKTVTTIGLAQGL-AKLGESVSACIR
FTHS_SHEON       VD-LQVQQRLAGQP---KGKLIIVTAVTPTPHGEGKTVTTIGLTQSL-KALGNKVCACIR
FTHS_CUTAK       VD-LDVVTHNRDHS---CGKYVVVTAMTPTPLGEGKTTTAVGLAQGL-EKIGKHSVLALR
FTHS_THET2       VL------GEPPKA---KGKLVLVTAITPTPAGEGKTTTAIGLVDAL-WRLGKRAALALR
FTHS_MOOTH       IS-LDVYRRLKDKP--D-GKLILVTAITPTPAGEGKTTTSVGLTDAL-ARLGKRVMVCLR
FTHS_CALS4       IS-PALWDKIKDRK--D-GKLILVTAITPTPAGEGKTTTTVGLGQAL-AKLGKKAMIALR
FTHS_CLOAB       IS-LDVLKQNKNKQ--D-GKLVLVTAINPTPAGEGKSTVTVGLGEAL-CKMNKNTVIALR
FTHS_CLOPE       IS-LDAIKKLENNK--D-GKLVLVTAINPTPAGEGKSTVTVGLGQAL-NKIGKNTVIALR
FTHS_CLOTE       LS-LDIFDRLKDEK--D-GKLVLVTAISPTPAGEGKSTTSIGLGQAL-NKIGKKTFIALR
FTHS_FUSNN       VN-LDVLQKNK-RP--N-GKLILVTAITPTPAGEGKSTVTIGLTQAL-NKMGKLSAAAIR
FTHS_NEIMA       IN-PAEAFKLP-QK--Q-GRLILVTAINPTPAGEGKTTVTIGLADAL-RHIGKDSVIALR
FTHS_NEIMB       IN-PAEAFKLP-QK--Q-GRLILVTAINPTPAGEGKTTVTIGLADAL-RHIGKDAVIALR
FTHS_NEIG1       IN-PAEAFKLP-QK--Q-GRLILVTAINPTPAGEGKTTVTIGLADAL-RHIGKDSVIALR
FTHS_HAEDU       IN-PADAFKLP-AK--N-GKLILVTAINPTPAGEGKTTVTIGLTDAL-NHIGKQAVVAAR
FTHS2_STRP8      ID-ARQLVALKDKP--D-GKLILVTAISPTPAGEGKTTTSVGLVDAL-SAIGKKAVIALR
FTHS2_STRPM      ID-ARQLVALKDKP--D-GKLILVTAISPTPAGEGKTTTSVGLVDAL-SAIGKKAVIALR
FTHS2_STRP3      ID-ARQLVALKDKP--D-GKLILVTAISPTPAGEGKTTTSVGLVDAL-SAIGKKAVIALR
FTHS2_STRP1      ID-ARQLVALKNKP--D-GKLILVTAISPTPAGEGKTTTSVGLVDAL-SAIGKKAVIALR
FTHS2_STRP6      ID-ARQLVALKDKP--D-GKLILVTAISPTPAGEGKTTTSVGLVDAL-SAIGKKAVIALR
FTHS_SYMTH       VA-DHVWPRVRSNP--D-GKLILVTAISPTPAGEGKTTVTVGLGQAM-SRIGKRAIIALR
FTHS_RHILO       IS-AEFIKSVKGNK--D-GKLILVTAINPTPAGEGKTTTTVGLGDGL-NRIGKKAIVCIR
FTHS_RHIME       VS-AEFIAAQNEKR--N-GRLILVTAINPTPAGEGKTTTTVGLGDGL-NRIGKKAIVCIR
FTHS_RUEPO       VS-QGFIDSVQDRA--D-GRLILVTAINPTPAGEGKTTTTVGLGDGL-NRIGKNAMICIR
FTHS_PELUB       IN-LEYLDTLKDKP--N-GKLVLVTAITPTPAGEGKTTTSVGLNDGL-NKIGKKSIVCLR
FTHS_METEA       ID-HDFIASLEGKP--E-GKLVLVTAISPTPAGEGKTTTTVGLGDAL-NRIGKRAVMCLR
FTHS_ZYMMO       LD-GEYLNSLSSKP--R-GKLVLVSAITPTPAGEGKTTTTVGLGDAF-NRIGKKAVICLR
FTHS_METCA       VA-LDYIDGLKDRP--D-GKLILVTAISPTPAGEGKTTTTVGLGDAL-NRIGKKTVMCLR
FTHS_BACCZ       LS-LDIFKRLQNEK--D-GKVVLVTAINPTPAGEGKSTVTVGLGQAF-NKIGKKTVIALR
FTHS_BACHK       LS-LDIFKRLQNEK--D-GKVVLVTAINPTPAGEGKSTVTVGLGQAF-NKIGKKTVIALR
FTHS_BACAN       LS-LDIFKRLQNEK--D-GKVVLVTAINPTPAGEGKSTVTVGLGQAF-NKIGKKTVIALR
FTHS_BACC1       LS-LDIFKRLQNEK--D-GKVVLVTAINPTPAGEGKSTVTVGLGQAF-NKIGKKTVIALR
FTHS_BACCR       LS-LDIFKRLQDEK--D-GKVVLVTAINPTPAGEGKSTVTVGLGQAF-NKIGKKTVIALR
FTHS_LISMF       LS-YDTIHSLKDKE--P-GKLVLVTAINPTPAGEGKSTVTVGLGDAL-SKKDKKTVIALR
FTHS_LISMO       LS-YDTIHSLKDKE--P-GKLVLVTAINPTPAGEGKSTVTVGLGDAL-SKKDKKTVIALR
FTHS_LISIN       LS-YDTIHSLKDKE--Q-GKLVLVTAINPTPAGEGKSTVTVGLGDAL-SKKDKKTVIALR
FTHS_STRA3       LS-FDKIEAVRSQK--V-GKLILVTAINPTPAGEGKSTMSIGLADAL-NKIGKKTMIALR
FTHS_STRA5       LS-FDKIEAVKSQK--V-GKLILVTAINPTPAGEGKSTMSIGLADAL-NKIGKKTMIALR
FTHS1_STRP1      LS-FEKMKAVEANE--P-GKLILVTAINPTPAGEGKSTMSIGLADAL-NQMGKKTMLALR
FTHS1_STRP3      LS-FEKMKAVEANE--P-GKLILVTAINPTPAGEGKSTMSIGLADAL-NQMGKKTMLALR
FTHS1_STRP6      LS-FEKMKAVEANE--P-GKLILVTAINPTPAGEGKSTMSIGLADAL-NQMGKKTMLALR
FTHS1_STRP8      LS-FEKMKAVEANE--P-GKLLLVTAINPTPAGEGKSTMSIGLADAL-NQMGKKTMLALR
FTHS1_STRPM      LS-FEKMKAVEANE--P-GKLLLVTAINPTPAGEGKSTMSIGLADAL-NQMGKKTMLALR
FTHS_STRT1       LS-FDKINEVKDDK--P-GKLILVTAINPTPAGEGKSTMSIGLADAL-NKIGKKTMIALR
FTHS_STRT2       LS-FDKINEVKDDK--P-GKLILVTAINPTPAGEGKSTISIGLADAL-NKIGKKTMIALR
FTHS_STRPN       LS-FDKIRAVESNP--V-GKLILVTAINPTPAGEGKSTLTIGLADAL-NKIGKKTMIAIR
FTHS_STRR6       LS-FDKIRAVESNP--V-GKLILVTAINPTPAGEGKSTLTIGLADAL-NKIGKKTMIAIR
FTHS_STRMU       LT-FDKIKAVEENA--P-GKLVLVTAINPTPAGEGKSTITIGLADAL-NKIGKKTMIAIR
FTHS_ENTFA       ID-FPTLQSLEAQP--E-GKLILVTSINPTPAGEGKSTVTIGLGDAL-NQINKKTVIALR
FTHS_LACLA       IP-LEVLDKFDQQS--E-GKLVLVTSINPTPAGEGKSTVTVGLADAF-ARQGKNVMVALR
FTHS_STAAM       ID-INKITPRENK-----GKVVLVTAMSPTPAGEGKSTVTVGLADAF-HELNKNVMVALR
FTHS_STAAN       ID-INKITPRENK-----GKVVLVTAMSPTPAGEGKSTVTVGLADAF-HELNKNVMVALR
FTHS_STAAR       ID-INKITPRENK-----GKVVLVTAMSPTPAGEGKSTVTVGLADAF-HELNKNVMVALR
FTHS_STAAS       ID-INKITPRENK-----GKVVLVTAMSPTPAGEGKSTVTVGLADAF-HELNKNVMVALR
FTHS_STAAW       ID-INKITPRENK-----GKVVLVTAMSPTPAGEGKSTVTVGLADAF-HELNKNVMVALR
FTHS_STAAC       ID-INKITPRENK-----GKVVLVTAMSPTPAGEGKSTVTVGLADAF-HELNKNVMVALR
FTHS_STAHJ       ID-INQIKPKDNK-----GKVVLVTAMSPTPAGEGKSTVTVGLSDAF-NELKKNVMVALR
FTHS_STAES       ID-INQIQEQEKK-----GKVVLVTAMSPTPAGEGKSTVTVGLADAF-NKLNHNVTVALR
FTHS_STAEQ       ID-INQIQEQEKK-----GKVVLVTAMSPTPAGEGKSTVTVGLADAF-NKLNHNVTVALR
FTHS_BACLD       IS-LKIFERLKEKP--D-GQVILVTSINPTPAGEGKSTVTVGLSQAL-WQIGKKSIVAMR
FTHS_CORDI       ID-INRIASE-----NT-GKLVLVTGISPTPAGEGKSTVLIGLSDAM-RLRGHNSIVAIR
FTHS_CORJK       ID-VPALRAEREGVNKK-GKLVLVTAMSPTPAGEGKSTVLIGLADAV-RTAGRQTMVAIR
FTHS1_LACAC      IN-WKAINRIRKND-KL-GKLILVTSISPTPAGEGKSTITIGLGDAIHNQLHKNTLIALR
FTHS_LACJO       IS-WKGINRIKQGK-KL-GKLILVTSISPTPAGEGKSTITIGLGDAISNQLHKNTLIALR
FTHS2_LACAC      IN-LPVKEVEGKK-----HKLILVTGINPTSAGEGKSTVLVGLGDAL-NQLGHQTTIAMR
FTHS_LACPL       LK-LPL-PVKKTQ-----RNLILVTSINPTPAGEGKSTVTIGLGDAL-TKIGKSTMIALR
FTHS_BACFN       IP-EYLIDEEKVKK----SNLILVTAITATKAGIGKTTVSIGLALGL-NKIGKKAIVALR
FTHS_BACFR       IP-EYLIDEEKVKK----SNLILVTAITATKAGIGKTTVSIGLALGL-NKIGKKAIVALR
FTHS_BACTN       IP-EQLIDEEKVKK----SNLVLVTAITATKAGIGKTTVSIGLALGL-NKIGKKAIVALR
FTHS_PORGI       VP-LSCIDEEKVKK----GNLILVTAITPNKAGVGKTTVSIGLALGL-NHIGKKAIVALR
FTHS_TREDE       VP-YSVIDDAKVKK----NNLILVTAITPTKAGIGKTTVSIGLALGL-NKIGKKAVAALR
FTHS_THEMA       ID-HRFLKSLENHEDGK---LILVTAVTPTPAGEGKTTTSIGLSMSL-NRIGKKSIVTLR
FTHS_HALMA       VK-QHAIERLREQAENREQNLVLVTGMTPTPKGEGKTVTTVGLGQTL-NHVGEEAMIAIR
FTHS_MYCPE       KKEYEIPKKLE-------SKLILVTSINPTPEGEGKTTTLIGINDCL-NYFGKESIACLR
FTHS_UREPA       IKSIKKLNKKD-------SKLIVITSMNPNPAGEGKTTTAIGLVDAL-NKHGYKAIGALR
                                      : ::.:...  * **:.  :*:   .            *

FTHS_THEAC       EPSLGPCFGIKGGATGGGKSKVEPSDRINLFFTGDFPTITAAHNLLSAMINNHMYHGNE-
FTHS_THEVO       EPSLGPCFGIKGGATGGGKSKVEPSDRINLLFTGDFPAISAAHNLLSAMINNHIYHGNE-
FTHS_PICTO       EPSLGPCFGVKGGATGGGKSTVEPSNKINLMFTGDFPAVSAAHNLLSAVINNHMYHGNE-
FTHS_DEHM1       QPSSGPTFNIKGSAAGGGRSQCLPLSPFTLGLTGDIDAVTNSHNLAMVALQARIQHEANN
FTHS_DEHMC       QPSSGPTFNIKGSAAGGGLSQCLPLSPFSLGLTGDIDAVTNSHNLAMVALQARLQHEANN
FTHS_PHOPR       QPSMGPVFGVKGGAAGGGYSQVAPMEKLNLHLTGDIHAVTAAHNLAAAALDARLYHEERH
FTHS_VIBCH       QPSMGPIFGVKGGAAGGGYSQVAPMEELNLHLTGDIHAVTAAHNLAAAAIDARIYHEQRL
FTHS_VIBVU       QPSMGPVFGVKGGAAGGGYSQVAPMDELNLHLTGDIHAVTAAHNLAAAAIDARIYHEQRA
FTHS_VIBVY       QPSMGPVFGVKGGAAGGGYSQVAPMDELNLHLTGDIHAVTAAHNLAAAAIDARIYHEQRA
FTHS_VIBPA       QPSMGPVFGIKGGAAGGGYSQVAPMEELNLHLTGDIHAVTAAHNLASAALDARLFHEQRE
FTHS_ALIF1       QPSMGPVFGVKGGAAGGGYSQVAPMEELNLHLTGDIHAITAAHNLASAAIDARIYHEQRL
FTHS_SHEON       QPSMGPVFGVKGGAAGGGYAQVVPMQELNLHLTGDIHAVSSAHNLGAAAIASRLYHEMRL
FTHS_CUTAK       QPSMGPTFGIKGGAAGAGYSQVLPMEKLNLHLTGDFHAIGAAHNLLAAMIDNHLHQGNE-
FTHS_THET2       EPSLGPVFGVKGGATGGGKARVEPRHEINLHFTGDFHAVTSAVNLLNALLDNHLHQGNE-
FTHS_MOOTH       EPSLGPSFGIKGGAAGGGYAQVVPMEDINLHFTGDIHAVTYAHNLLAAMVDNHLQQGNV-
FTHS_CALS4       EPSLGPSFGIKGGAAGGGYSQVVPMEDINLHFTGDIHAITAAHNLLAAMIDNHIHHGNE-
FTHS_CLOAB       EPSLGPVFGIKGGAAGGGYAQVVPMEDINLHFTGDMHAITSANNLLCAAIDNHIHQGNS-
FTHS_CLOPE       EPSLGPVFGIKGGAAGGGYAQVVPMEDINLHFTGDMHAITSANNLLCAAIDNHIHQGNL-
FTHS_CLOTE       EPSLGPVFGVKGGAAGGGYAQVVPMEDINLHFTGDMHAIGITNNLLSAAIDNHIHQGNA-
FTHS_FUSNN       EPSLGPVFGMKGGAAGGGYAQVVPMEDINLHFTGDMHAIGIAHNLISACIDNHINSGNA-
FTHS_NEIMA       EPSLGPVFGVKGGAAGGGYAQVLPMEDINLHFTGDFHAIGAANNLLAAMLDNHIYQGNE-
FTHS_NEIMB       EPSLGPVFGVKGGAAGGGYAQVLPMEDINLHFTGDFHAIGAANNLLAAMLDNHIYQGNE-
FTHS_NEIG1       EPSLGPVFGVKGGAAGGGYAQVLPMEDINLHFTGDFHAIGAANNLLAAMLDNHIYQGNE-
FTHS_HAEDU       EPSLGPVFGVKGGAAGGGYAQVLPMEDINLHFTGDFHAITSANNLLAALLDNHIYQGNA-
FTHS2_STRP8      EPSLGPVFGVKGGAAGGGHAQVVPMEDINLHFTGDFHAIGVANNLLAALIDNHIHHGNS-
FTHS2_STRPM      EPSLGPVFGVKGGAAGGGHAQVVPMEDINLHFTGDFHAIGVANNLLAALIDNHIHHGNS-
FTHS2_STRP3      EPSLGPVFGVKGGAAGGGHAQVVPMEDINLHFTGDFHAIGVANNLLAALIDNHIHHGNS-
FTHS2_STRP1      EPSLGPVFGVKGGAAGGGHAQVVPMEDINLHFTGDFHAIGVANNLLAALIDNHIHHGNS-
FTHS2_STRP6      EPSLGPVFGVKGGAAGGGHAQVVPMEDINLHFTGDFHAIGVANNLLAALIDNHIHHGNS-
FTHS_SYMTH       EPSLGPAFGVKGGAAGGGYSQVVPMDEINLHFTGDFHAVTAANNLLAAMIDNHLHQGNK-
FTHS_RHILO       EASLGPNFGVKGGAAGGGYAQVVPMEDMNLHFTGDFHAITTAHNLLSALIDNHIYWGNE-
FTHS_RHIME       EASLGPCFGIKGGAAGGGYAQVVPMEDINLHFTGDFHAITSAHNLLSALIDNHIYWGNE-
FTHS_RUEPO       EASLGPNFGMKGGAAGGGYAQIVPMEEMNLHFTGDFHAITSAHSLLSAMIDNHIYWGNE-
FTHS_PELUB       EPSLGPSFGMKGGAAGGGYAQVVPMEQINLHFTGDFHAITSAHNLLSALIDNHIYWGNK-
FTHS_METEA       EPSLGPCFGMKGGAAGGGKAQVVPMEQINLHFTGDFHAITSAHSLAAALIDNHIYWANE-
FTHS_ZYMMO       EPSLGPCFGVKGGAAGGGYAQVVPMERINLHFTGDFHAITSAHDLLAAMIDNHVHWGNE-
FTHS_METCA       EPSLGPCFGVKGGAAGGGHAQVVPMEDINLHFTGDFHAVGVAHNLLSALIDNHINHGNA-
FTHS_BACCZ       EPSLGPTMGLKGGAAGGGFSQVVPMEDINLHFTGDIHAITTANNALAAFIDNHIQQGNT-
FTHS_BACHK       EPSLGPTMGLKGGAAGGGFSQVVPMEDINLHFTGDIHAITTANNALAAFIDNHIQQGNT-
FTHS_BACAN       EPSLGPTMGLKGGAAGGGFSQVVPMEDINLHFTGDIHAITTANNALAAFIDNHIQQGNT-
FTHS_BACC1       EPSLGPTMGLKGGAAGGGFSQVVPMEDINLHFTGDIHAITTANNALAAFIDNHIQQGNT-
FTHS_BACCR       EPSLGPTMGLKGGAAGGGFSQVVPMEDINLHFTGDIHAITTANNALAAFIDNHIQQGNT-
FTHS_LISMF       EPSLGPTMGIKGGATGGGYAQVIPMEDINLHFTGDFHAITAANNALSAFIDNHMQQGND-
FTHS_LISMO       EPSLGPTMGIKGGATGGGYAQVIPMEDINLHFTGDFHAITAANNALSAFIDNHMQQGND-
FTHS_LISIN       EPSLGPTMGIKGGATGGGYAQVIPMEDINLHFTGDFHAITAANNALSAFIDNHMQQGND-
FTHS_STRA3       EPSLGPVMGIKGGAAGGGYAQVLPMEDINLHFTGDMHAITTANNALSALLDNHIHQGNE-
FTHS_STRA5       EPSLGPVMGIKGGAAGGGYAQVLPMEDINLHFTGDMHAITTANNALSALLDNHIHQGNE-
FTHS1_STRP1      EPSLGPVMGIKGGAAGGGYAQVLPMEDINLHFTGDMHAITTANNALSALIDNHLQQGND-
FTHS1_STRP3      EPSLGPVMGIKGGAAGGGYAQVLPMEDINLHFTGDMHAITTANNALSALIDNHLQQGND-
FTHS1_STRP6      EPSLGPVMGIKGGAAGGGYAQVLPMEDINLHFTGDMHAITTANNALSALIDNHLQQGND-
FTHS1_STRP8      EPSLGPVMGIKGGAAGGGYAQVLPMEDINLHFTGDMHAITTANNALSALIDNHLQQGND-
FTHS1_STRPM      EPSLGPVMGIKGGAAGGGYAQVLPMEDINLHFTGDMHAITTANNALSALIDNHLQQGND-
FTHS_STRT1       EPSLGPVMGIKGGAAGGGYAQVLPMEDINLHFTGDMHAITTANNALSALLDNHIHQGNA-
FTHS_STRT2       EPSLGPVMGIKGGAAGGGYAQVLPMEDINLHFTGDMHAITTANNALSALLDNHIHQGNA-
FTHS_STRPN       EPSLGPVMGIKGGAAGGGYAQVLPMEDINLHFTGDMHAITTANNALSALIDNHLHQGNE-
FTHS_STRR6       EPSLGPVMGIKGGAAGGGYAQVLPMEDINLHFTGDMHAITTANNALSALIDNHLHQGNE-
FTHS_STRMU       EPSLGPVMGIKGGAAGGGYAQVLPMEDINLHFTGDMHAITTANNALSALIDNHLHQGNE-
FTHS_ENTFA       EPSLGPVMGIKGGATGGGYAQVLPMEEINLHFTGDMHAITTANNALAALLDNHLQQGNE-
FTHS_LACLA       EPSLGPVMGIKGGAAGGGFAQVLPMEDINLHFTGDIHAITTANNAISAFLDNSLHQGNP-
FTHS_STAAM       EPALGPTFGIKGGATGGGYAQVLPMEDINLHFNGDFHAITTANNALSAFIDNHIHQGNE-
FTHS_STAAN       EPALGPTFGIKGGATGGGYAQVLPMEDINLHFNGDFHAITTANNALSAFIDNHIHQGNE-
FTHS_STAAR       EPALGPTFGIKGGATGGGYAQVLPMEDINLHFNGDFHAITTANNALSAFIDNHIHQGNE-
FTHS_STAAS       EPALGPTFGIKGGATGGGYAQVLPMEDINLHFNGDFHAITTANNALSAFIDNHIHQGNE-
FTHS_STAAW       EPALGPTFGIKGGATGGGYAQVLPMEDINLHFNGDFHAITTANNALSAFIDNHIHQGNE-
FTHS_STAAC       EPALGPTFGIKGGATGGGYAQVLPMEDINLHFNGDFHAITTANNALSAFIDNHIHQGNE-
FTHS_STAHJ       EPALGPTFGIKGGATGGGYAQVLPMEDINLHFNGDFHAITTANNALSAFIDNHIHQGNE-
FTHS_STAES       EPALGPTFGIKGGATGGGYAQVLPMEDINLHFNGDFHAITTANNALSAFIDNHLHQGNE-
FTHS_STAEQ       EPALGPTFGIKGGATGGGYAQVLPMEDINLHFNGDFHAITTANNALSAFIDNHLHQGNE-
FTHS_BACLD       EPSLGPTMGLKGGAAGGGYSQVLPMEDINLHFTGDMHAITAANNALAAFIDNHIHQGNE-
FTHS_CORDI       EPSLGPVMGIKGGAAGGGYSQIVPMEDINLHFTGDFHAITAANNTLAAMIDNHIHQGNT-
FTHS_CORJK       EPSQGPVMGIKGGAAGGGYAQIVPMEDINLHFTGDMHAITAATNTLAAMVDNHVQHGNA-
FTHS1_LACAC      EPSMGPVFGLKGGATGGGRAQIIPMEDINLHFTGDMHALTAAIDTLAALVDNYIYQDNS-
FTHS_LACJO       EPSMGPVFGLKGGATGGGYAQIITMEDINLHFTGDMHALTSAIDTLAALVDNYIYQDNS-
FTHS2_LACAC      EPSMGPVFGIKGGATGGGYSQVVPMEDINLHFTGDMHALTSANNTLAALIDNYIMRDNV-
FTHS_LACPL       EPSLGPVMGMKGGATGGGYSQVIPMEDINLHFTGDMHALTAANNTLAALIDNHIQQGNQ-
FTHS_BACFN       EPSLGPCFGMKGGAAGGGYAQVLPMEKINLHFTGDFHAITSAHNMISALLDNYLYQNQS-
FTHS_BACFR       EPSLGPCFGMKGGAAGGGYAQVLPMEKINLHFTGDFHAITSAHNMISALLDNYLYQNQS-
FTHS_BACTN       EPSLGPCFGMKGGAAGGGYAQVLPMEKINLHFTGDFHAITSAHNMISALLDNYLYQNQA-
FTHS_PORGI       EPSLGPCFGMKGGAAGGGYAQVLPMENINLHFTGDFHAVTSAHNMITALLENYIYQNRN-
FTHS_TREDE       EPSLGPCFGMKGGAAGGGYAQVLPMEDINLHFTGDFHAITSAHNMISALFDNYIFRAQG-
FTHS_THEMA       EPSLGPTLGLKGGATGGGRSRVLPSDEINLHFTGDMHAVASAHNLLAAVLDSHIKHGNE-
FTHS_HALMA       EPSLGPVFGVKGGAAGGGRSQVLPMEDINLHFTGDLHALTSAHNLIAAMLDAKISQGDD-
FTHS_MYCPE       QPSMGPYFGIKGGATGSGKCEIQNPEKVNCGFTNDFYAIEAANNLIMSVIENEIYFNTD-
FTHS_UREPA       EPSMGPVFGMKGTGSGGGLSFLKPFDKINLHFSGDFHAITAANNLIVAVIENEIHNRSS-
                 :.: ** :.:** .:*.* .       ..  :..*: ::  : .     .   :      

FTHS_THEAC       -------------LNLDPKRITFPRTIDMNDRSLRSILVGVGPR---DMGVLAGDSFVIT
FTHS_THEVO       -------------LNLDPKRITFPRTIDMNDRSLRSIVVGVGPR---DMGAIANDNFVIT
FTHS_PICTO       -------------LKLDPKNIVFPRTIDMDDRSLRSIIVGSGDR---STGVMMNDKYVIT
FTHS_DEHM1       TDEFLSSRS-LKRLDIDPARVELKWAIDFCAQSLREIIMGIGGK---TDGYQMHSGFGIS
FTHS_DEHMC       TDEFLSSRH-LTRLDIDPSRVEMKWAMDFCAQSLREIIMGIGGK---TDGYRMPSGFGIS
FTHS_PHOPR       GYEAFSDKTGLPALRIDIKNIVWKRVMDHNDRALRMITVGKNEAGKAINGLEREDGFDIS
FTHS_VIBCH       GYADFERRTGMPALRIDPKQVIWKRVMDHNDRALRMVTVGRNEPGKNINGYEREDGFDIS
FTHS_VIBVU       GYQAFEARTGLPALRIDPDRVVWKRVMDHNDRALRKVRVGINDEGKTINGFEREEGFDIS
FTHS_VIBVY       GYQAFEARTGLPALRIDPDRVVWKRVMDHNDRALRKVRVGLNDEGKTINGFEREEGFDIS
FTHS_VIBPA       GYDAFEARTGLKALKIDVESITWKRVMDHNDRALRMVKIGLNEHGKTINGFERNEGFDIS
FTHS_ALIF1       GYDVFSEKNELPALRIDPQHVVWKRVMDHNDRALRMVTIGKNEDGKTINGYEREDGFDIT
FTHS_SHEON       GKAEFERQSGLSYLDIDPKGIRWHRVVDHNDRCLREIEVGLGEN----NGPAYTSGFDIT
FTHS_CUTAK       -------------LDIEPHSISWRRVVDINDRALRNTIVGLGSR---VDGVPRETGFDIT
FTHS_THET2       -------------LGIDPRRIELKRAIDMNDRALRHIVLGLGGK---AHGVPREGGFELT
FTHS_MOOTH       -------------LNIDPRTITWRRVIDLNDRALRNIVIGLGGK---ANGVPRETGFDIS
FTHS_CALS4       -------------LNIDIRTITWKRAMDMNDRALREIIVGLGGK---ANGYPRQDGFIIT
FTHS_CLOAB       -------------LKIDQRRIVFKRVMDMNDRALRSIVVGLGGK---VNGFPREDGFMIT
FTHS_CLOPE       -------------LRIDSRRIVFKRVMDMNDRALRNIVVGMGGK---INGFLREDGFMIT
FTHS_CLOTE       -------------LKIDSREIVWKRVVDMNDRALRNVVVGMGGK---ACGFTRQDGFMIT
FTHS_FUSNN       -------------LGIDVTKITWKRVVDMNDRALRNIVIGLGGK---ANGYPRQDSFQIT
FTHS_NEIMA       -------------LNIDPKRVLWRRVVDMNDRQLRNIIDGMGKP---VDGVMRPDGFDIT
FTHS_NEIMB       -------------LNIDPKRVLWRRVVDMNDRQLRNIIDGMGKP---VDGVMRPDGFDIT
FTHS_NEIG1       -------------LNIDPKRVLWRRVVDMNDRQLRNIIDGMGKP---VDGVMRPDGFDIT
FTHS_HAEDU       -------------LNIDPKRILWRRVIDMNDRQLRNILGGLGNT---TDGVIRPDGFDIT
FTHS2_STRP8      -------------LGIDSRRITWKRVVDMNDRQLRHIVDGLQGK---VNGVPREDGYDIT
FTHS2_STRPM      -------------LGIDSRRITWKRVVDMNDRQLRHIVDGLQGK---VNGVPREDGYDIT
FTHS2_STRP3      -------------LGIDSRRITWKRVVDMNDRQLRHIVDGLQGK---VNGAPREDGYDIT
FTHS2_STRP1      -------------LGIDSRRITWKRVVDMNDRQLRHIVDGLQGK---VNGIPREDGYDIT
FTHS2_STRP6      -------------LGIDSRRITWKRVVDMNDRQLRHIVDGLQGK---VNGVPREDGYDIT
FTHS_SYMTH       -------------LGLDPRQITFKRVLDMNDRALRSVVIGLGGK---NGGVPRQEEFMIT
FTHS_RHILO       -------------LGIDTRRVVWRRVMDMNDRALREMICSLGGV---ANGFPREGGFDIT
FTHS_RHIME       -------------QAIDIRRIAWRRVMDMNDRALRQIVGSLGGV---ANGYPRETGFDIT
FTHS_RUEPO       -------------ADIDTRRVVWRRVVDMNDRALRQITCSLGGV---SNGFPREAGFDIT
FTHS_PELUB       -------------LDIDVRRIVWKRVMDMNDRSLRSININLGGV---ANGFPREDGFDIT
FTHS_METEA       -------------LNIDVRRIHWRRVVDMNDRALRAINQSLGGV---ANGFPREDGFDIT
FTHS_ZYMMO       -------------PVMDRNSITFRRVIDMNDRMLRNMVIGLGGK---ANGYPREGGFDIS
FTHS_METCA       -------------LDIDPRRIQWKRVVDMNDRALRKIVVGMGGT---ANGYLREDGFDIV
FTHS_BACCZ       -------------LGIDTRKIVWKRCVDLNDRALRNVVIGLGGP---VQGVPREDGFDIT
FTHS_BACHK       -------------LGIDTRKIVWKRCVDLNDRALRNVVIGLGGP---VQGVPREDGFDIT
FTHS_BACAN       -------------LGIDTRKIVWKRCVDLNDRALRNVVIGLGGP---VQGVPREDGFDIT
FTHS_BACC1       -------------LGIDTRKIVWKRCVDLNDRALRNVVIGLGGP---VQGVPREDGFDIT
FTHS_BACCR       -------------LGIDTRKIVWKRCVDLNDRALRNVVIGLGGP---VQGVPREDGFDIT
FTHS_LISMF       -------------LDIDGRRIVWKRVVDLNDRALRKVVVGLGGP---IQGVPREDGFDIT
FTHS_LISMO       -------------LEIDGRRIVWKRVVDLNDRALRKVVVGLGGP---IQGVPREDGFDIT
FTHS_LISIN       -------------LGIDGRRIVWKRVVDLNDRALRKVVVGLGGP---IQGVPREDGFDIT
FTHS_STRA3       -------------LDIDQRRVIWKRVVDLNDRALRQVIVGLGSS---VNGIPREDGFDIT
FTHS_STRA5       -------------LDIDQRRVIWKRVVDLNDRALRQVIVGLGSP---VNGIPREDGFDIT
FTHS1_STRP1      -------------LGIDPRRIIWKRVLDLNDRALRQVIVGLGSP---VNGVPREDGFDIT
FTHS1_STRP3      -------------LGIDPRRIIWKRVLDLNDRALRQVIVGLGSP---VNGVPREDGFDIT
FTHS1_STRP6      -------------LGIDPRRIIWKRVLDLNDRALRQVIVGLGSP---VNGVPREDGFDIT
FTHS1_STRP8      -------------LGIDPRRIIWKRVLDLNDRALRQVIVGLGSP---VNGVPREDGFDIT
FTHS1_STRPM      -------------LGIDPRRIIWKRVLDLNDRALRQVIVGLGSP---VNGVPREDGFDIT
FTHS_STRT1       -------------LGIDQRRIIWKRVVDLNDRALRHVTVGLGGP---LNGIPREDGFDIT
FTHS_STRT2       -------------LGIDQRRIIWKRVVDLNDRALRHVTVGLGGP---LNGIPREDGFDIT
FTHS_STRPN       -------------LGIDQRRILWKRVVDLNDRTLRHVTVGLGGP---LNGIPREDGFDIT
FTHS_STRR6       -------------LGIDQRRILWKRVVDLNDRALRHVTVGLGGP---LNGIPREDGFDIT
FTHS_STRMU       -------------LGIDQRRIIWKRVVDLNDRALRHVTVGLGSP---INGIPREDGFDIT
FTHS_ENTFA       -------------LKIDSRRVIWKRAVDLNDRALRQVVVGLGGP---FQGVPREDGFDIT
FTHS_LACLA       -------------LNIDPRRIIWKRVVDLNDRALRHVTVGLGGP---LNGVPREDGFDIT
FTHS_STAAM       -------------LGIDQRRIEWKRVLDMNDRALRHVNVGLGGP---TNGVPREDGFNIT
FTHS_STAAN       -------------LGIDQRRIEWKRVLDMNDRALRHVNVGLGGP---TNGVPREDGFNIT
FTHS_STAAR       -------------LGIDQRRIEWKRVLDMNDRALRHVNVGLGGP---TNGVPREDGFNIT
FTHS_STAAS       -------------LGIDQRRIEWKRVLDMNDRALRHVNVGLGGP---TNGVPREDGFNIT
FTHS_STAAW       -------------LGIDQRRIEWKRVLDMNDRALRHVNVGLGGP---TNGVPREDGFNIT
FTHS_STAAC       -------------LGIDQRRIEWKRVLDMNDRALRHVNVGLGGP---TNGVPREDGFNIT
FTHS_STAHJ       -------------LGIDVRRVEWKRVLDMNDRALRHVNVGLGGP---TNGVPREDGFNIT
FTHS_STAES       -------------LGIDQRRIEWKRVLDMNDRALRHVNVGLGGT---THGVPREDGFNIT
FTHS_STAEQ       -------------LGIDQRRIEWKRVLDMNDRALRHVNVGLGGT---THGVPREDGFNIT
FTHS_BACLD       -------------LNIDIRKIVWKRALDLNDRALRETVVGLGGK---ANGFPREDGFDIT
FTHS_CORDI       -------------LGIDVRRITWQRCLDVNDRCLRKVVTGLGGK---AHGVPTETGFTIT
FTHS_CORJK       -------------LGIDPRRVTWRRCLDVNDRSLRHVVTGLGGP---GQGTPREGGFDIT
FTHS1_LACAC      -------------LNIDPERILLKRGLDVNDRALRKITVGQGSK---FNGIEHKASFAIT
FTHS_LACJO       -------------LELDPNRILLKRGIDVNDRTLRKITIGQGSR---FNGIEHEASFAIT
FTHS2_LACAC      -------------LGLDPRRIIWKRVEDVNDRVLRNVVTGLGGI---MQGVPRETGFDIT
FTHS_LACPL       -------------LGIDQRRIQWKRALDINDRALRHTVIGLGGA---TSGVPREDGFDIT
FTHS_BACFN       -------------KGFGLKEILWRRVLDVNDRSLRNIVVGLGPK---TNGITQESGFDIT
FTHS_BACFR       -------------KGFGLKEILWRRVLDVNDRSLRNIVVGLGPK---TNGITQESGFDIT
FTHS_BACTN       -------------KGFGLKEILWRRVLDVNDRSLRSIVVGLGPK---SNGITQESGFDIT
FTHS_PORGI       -------------TCDGLSEILWKRVLDVNDRSLRNAVTGLGTI---SDGIPRQTGFDIT
FTHS_TREDE       -------------TPKAIKTVLWKRVLDVNDRNLRQVVTGLG-E---GNGVVMESGFDIT
FTHS_THEMA       -------------LKIDITRVFWKRTMDMNDRALRSIVIGLGGS---ANGFPREDSFIIT
FTHS_HALMA       -------------LNIDINNVSWPRAIDMNDRALRETVVGLGGK---TGGTPREDSFILT
FTHS_MYCPE       -------------LEIDPQKIIWKRCIDINDRSLRDINYQVSK------NTKINSSFSIT
FTHS_UREPA       -------------MQIDSQKILIKRCLDVNDRSLRNIEYDIN-------HQQTKSGFNIT
                                     :      *   : **                     : : 

FTHS_THEAC       PASEVMAITGLSLNYQDLKARLSRILAGFTTK-NKPVFAGDLKAEGSMAALLRDALKPNL
FTHS_THEVO       PASEVMAITGLSLNYKDLKEKLSRILAGFTVK-NKPVFAADLKAEGSMAALLRDALKPNL
FTHS_PICTO       AASEVMAILALSRNYNELKQRLGNIMIGYNLN-KAPIFARDLKVHGAMASLLVDALRPNI
FTHS_DEHM1       VSSEVMAILSVFTGLADLRERMSKIIVAYRQN-GEPVTTADLEVDGAMTALLLRAVNPNL
FTHS_DEHMC       VSSEVMAILSVFTSLSDLRERMGKIIVAYRKN-DEPVTTADLEVDGAMTALLLRAVNPNL
FTHS_PHOPR       AASEIMAILALSKDLADMRQRIGRVVLAYNID-GNPITAEDLQVAGAMTVTMCEAIEPTL
FTHS_VIBCH       AASELMAILALASDLRDLRRRIGNVVLAYDLD-GNPVTTEDLKVAGAMAVSMKEAIEPTL
FTHS_VIBVU       AASELMAILALSKNLQDMRERIGKVVLAYNLD-SEPVSAEQLQVAGAMTVTLKEAIKPTL
FTHS_VIBVY       AASELMAILALSKNLQDMRERIGKVVLAYNLD-GEPVSAEQLQVAGAMTVTLKEAIKPTL
FTHS_VIBPA       AASELMAIIALAKNLKDLRQRIGKIVVAYDLD-GQPITTEDLQVAGAMAVTLKEAIAPTL
FTHS_ALIF1       AASELMAILALATDLQDLRQRIGRIVVAYNLD-GEPVTTEDLQVAGAMTVTMKFAINPTL
FTHS_SHEON       AASELMAILALSRNLTDMRVRIGKLVLALNRQ-GEAVSADELGVAGAMTAIMADAVKPTL
FTHS_CUTAK       AASEVGVILSLATSLSDLRARLGRIVIGYNRS-KEPVSAEDLHAAGSMAVILKDALKPNL
FTHS_THET2       VASEVMALMSLARDFQDLKRRLGRMRVAFTHE-GKPVYAEDLMAVGAMAALLRQAFLPNL
FTHS_MOOTH       VASEVMACLCLASDLMDLKERFSRIVVGYTYD-GKPVTAGDLEAQGSMALLMKDAIKPNL
FTHS_CALS4       VASEIMAILCLSHDLMDLKRRLGDIIVAYDKD-GSPVTARDLKADGAMAVLLKDAIKPNL
FTHS_CLOAB       VASEIMAILCLANDLMDLKERMGKILIAYDLD-GNPVYCRDLKVEGAMAMLMKDAMKPNL
FTHS_CLOPE       VASEIMAILCMASDLEDLKERMGNILIAYNLD-GEPVYAKELEVQGAMALLMKDAIKPNL
FTHS_CLOTE       VASEVMAILCLAKDLMDLKERLGNIIVAYSLE-GKPVTAGDLKVNGAMAMLLKDAIKPNI
FTHS_FUSNN       VGSEIMAILCLSNSITELKEKIKNIVIGTSVT-GKLIKVGDFHIEGAVAALLKDAIKPNL
FTHS_NEIMA       VASEVMAVFCLAKDISDLKERLGNILVAYAKD-GSPVYAKDLKANGAMAALLKDAIKPNL
FTHS_NEIMB       VASEVMAVFCLAKDISDLKERLGNILVAYAKD-GSPVYAKDLKANGAMAALLKDAIKPNL
FTHS_NEIG1       VASEVMAVFCLAKDISDLKERFGNILVAYAKD-GSPVYAKDLKAHGAMAALLKDAIKPNL
FTHS_HAEDU       VASEVMAIFCLAKDLADLKTRLGNILVAYTKD-KQPVYAKDLNAQGAMAALLKDAIKPNL
FTHS2_STRP8      VASEIMAILCLSENISDLKARLEKIIIGYNYQ-GEPVTAKDLKAGGALAALLKDAIHPNL
FTHS2_STRPM      VASEIMAILCLSENISDLKARLEKIIIGYNYQ-GEPVTAKDLKAGGALAALLKDAIHPNL
FTHS2_STRP3      VASEIMAILCLSENISDLKARLEKIIIGYNYR-GEPVTAKDLKAGGALAALLKDAIHPNL
FTHS2_STRP1      VASEIMAILCLSENISDLKARLEKIIIGYNYQ-GEPVTAKDLKAGGALAALLKDAIHPNL
FTHS2_STRP6      VASEIMAILCLSENISDLKARLEKIIIGYNFQ-GEPVTAKDLKAGGALAALLKDAIHPNL
FTHS_SYMTH       PASEVMATLCLAEDLADLKRRCGEIIVGYTYD-GAPVRARDLKAEGAMATLLKEAIKPNL
FTHS_RHILO       VASEVMAILCLSTDLKDLEKRLGDIIVAYRRD-KSPVYARDLKADGAMAVLLKDAMQPNL
FTHS_RHIME       VASEVMAILCLAMDIKDLEKRLGNIIIGYRRD-KSPVFARDIKADGAMAVLLKDAMQPNL
FTHS_RUEPO       VASEVMAILCLARDLKDLEKRLGDIIVAYRRD-KSPVYCRDIKAEGAMTVLLKDAMQPNL
FTHS_PELUB       VASEIMAIFCLSNDLEDLEKRIGNITIAYTRD-KKPVYAKDLKAQGPMTVLLKDAIRPNV
FTHS_METEA       VASEVMAVFCLAKNLADLEERLGRIVIAETRD-RKPVTLADVKATGAMTVLLKDALQPNL
FTHS_ZYMMO       VASEVMAILCLASDLKDLRSRLERIIIGEDND-HNPVAAAKIKAAGAMTALLKDALQPNL
FTHS_METCA       VASEVMAILCLATSMADLKERLGRIIVGYKSDGKTPVYARDLKAHGAMAALLKDAIKPNL
FTHS_BACCZ       VASEIMAVFCLATDIQDLKARLSRIVVAYNFA-NQPVTVKDLGVEGALTLLLKDALKPNL
FTHS_BACHK       VASEIMAVFCLATDIQDLKARLSRIVVAYNFA-NQPVTVKDLGVEGALTLLLKDALKPNL
FTHS_BACAN       VASEIMAVFCLATDIQDLKARLSRIVVAYNFA-NQPVTVKDLGVEGALTLLLKDALKPNL
FTHS_BACC1       VASEIMAVFCLATDIQDLKARLSRIVVAYNFA-NQPVTVKDLGVEGALTLLLKDALKPNL
FTHS_BACCR       VASEIMAVFCLATDIQDLKARLSRIVVAYNFA-NQPVTVKDLGVEGALTLLLKDALKPNL
FTHS_LISMF       VASEIMAIICLASDLKDLKKRLSEIVIGYNYK-KEPITVGEMGYEGALTLLLKDALKPNL
FTHS_LISMO       VASEIMAIICLASDLKDLKKRLSEIVIGYNYK-KEPITVGEMGYEGALTLLLKDALKPNL
FTHS_LISIN       VASEIMAIICLASDLKDLKKRLSEIVIGYNYK-KEPITVGEMGYEGALTLLLKDALKPNL
FTHS_STRA3       VASEIMAILCLATDLSDLKKRLSNIVVAYSRD-RKPIYVKDLKIEGALTLILKDAIKPNL
FTHS_STRA5       VASEIMAILCLATDLSDLKKRLSNIVVAYSRN-RKPIYVKDLKIEGALTLILKDTIKPNL
FTHS1_STRP1      VASEIMAILCLATDLKDLKKRLADIVVAYTYD-RKPVYVRDLKVEGALTLILKDAIKPNL
FTHS1_STRP3      VASEIMAILCLATDLKDLKKRLADIVVAYTYD-RKPVYVRDLKVEGALTLILKDAIKPNL
FTHS1_STRP6      VASEIMAILCLATDLKDLKKRLADIVVAYTYD-RKPVYVRDLKVEGALTLILKDAIKPNL
FTHS1_STRP8      VASEIMAILCLATDLKDLKKRLADIVVAYTYD-RKPVYVRDLKVEGALTLILKDAIKPNL
FTHS1_STRPM      VASEIMAILCLATDLKDLKKRLADIVVAYTYD-RKPVYVRDLKVEGALTLILKDAIKPNL
FTHS_STRT1       VASEIMAILCLATDINDLKERLANIVVAYRYD-RTPVYVRDLEIEGALTLILKDAIKPNL
FTHS_STRT2       VASEIMAILCLATDINDLKERLANIVVAYRYD-RTPVYVRDLEIEGALTLILKDAIKPNL
FTHS_STRPN       VASEIMAILCLATDIEDLKRRLANIVIGYRYD-RTPVSVGDLQVEGALALILKDAIKPNL
FTHS_STRR6       VASEIMAILCLATDIEDLKRRLANIVIGYRYD-RTPVSVGDLQVEGALALILKDAIKPNL
FTHS_STRMU       VASEIMAILCLATNVEDLKERLANIVIGYRFD-RSPVYVRDLEVQGALALILKEAIKPNL
FTHS_ENTFA       VASEIMAILCLAQNLTDLKERLSRIIVAYNDQ-REPVTVKDLNVAGALTLLLKDALKPNL
FTHS_LACLA       VVSEIMAVLCLATSISDLKERLGKIVLAQSYD-RKPVTLGDLGVQGAIAMLLKDALKPNL
FTHS_STAAM       VASEIMAILCLSRSIKDLKDKISRITIGYTRD-RKPVTVADLKVQGALAMILKDAIKPNL
FTHS_STAAN       VASEIMAILCLSRSIKDLKDKISRITIGYTRD-RKPVTVADLKVQGALAMILKDAIKPNL
FTHS_STAAR       VASEIMAILCLSRSIKDLKDKISRITIGYTRD-RKPVTVADLKVQGALAMILKDAIKPNL
FTHS_STAAS       VASEIMAILCLSRSIKDLKDKISRITIGYTRD-RKPVTVADLKVQGALAMILKDAIKPNL
FTHS_STAAW       VASEIMAILCLSRSIKDLKDKISRITIGYTRD-RKPVTVADLKVQGALAMILKDAIKPNL
FTHS_STAAC       VASEIMAILCLSRSIKDLKDKISRITIGYTRD-RKPVTVADLKVEGALAMILKDAIKPNL
FTHS_STAHJ       VASEVMAILCLARNINDLKEKISRITIGYTRD-RKPVTVADLKVEGALAMILKDAIKPNL
FTHS_STAES       VASEIMAILCLSRNIKDLKEKISRITIGYTRH-HKPITVSDLKVEGALTLILKDAIKPNL
FTHS_STAEQ       VASEIMAILCLSRNIKDLKEKISRITIGYTRH-HKPITVSDLKVEGALTLILKDAIKPNL
FTHS_BACLD       VASEIMAVLCLARDLADLKKRLASMIVAYTVD-GQPVTAGMLGVQGALALLLKDAIKPNL
FTHS_CORDI       AASEIMAILCLALDLTDLEARLARIVVGQTFS-SEPVTVGQLNAQGALAALLRDAVNPNL
FTHS_CORJK       AASEIMAILCLATDLEDLKKRIGRIVVGQTYD-RRPVTAGDLKCAGAITALLRDAINPNL
FTHS1_LACAC      VANELMAILCLANDINDLKARIGDMLVGYTQD-DQPVYVKQLGFQGAIAALLSNALKPNL
FTHS_LACJO       VANELMAILCLATDIDDLKKRIGNMLVGFSVK-DEPVYVKDLGFEGAIAALLSTALKPNL
FTHS2_LACAC      AASEMMAILCLSESLHNLKKRIGRIVVGYTYE-KKPVTVDQLGFTGAITLLLKDAIKPNL
FTHS_LACPL       VASELMAILCLSENIADLKQRVNRIVIGYTHD-RQPVTVADLNVGGAITLLLKDALRPNL
FTHS_BACFN       PASEIMAILCLSKDVDDLRRRIENILLGYTYD-NKPFTVKDLGVAGAITVLLKDAIHPNL
FTHS_BACFR       PASEIMAILCLSKDVDDLRRRIENILLGYTYD-NKPFTVKDLGVAGAITVLLKDAIHPNL
FTHS_BACTN       PASEIMAILCLSKDVEDLRRRIENILLGFTYD-DQPFTVKDLGVAGAITVLLKDAIHPNL
FTHS_PORGI       PASEIMAILCLAKDFEDLRSRLENILLGYTKE-GAPFTVKDLGIAGSIAVLLKDAIKPNL
FTHS_TREDE       PASEIMAIFCLAKDIEDLRRRIENIILGYDTE-NNAVKVKDLGIAGSIVVLLKNAINPNL
FTHS_THEMA       AASEVMAILALSENMKDLKERLGKIIVALDAD-RKIVRISDLGIQGAMAVLLKDAINPNL
FTHS_HALMA       AASELMAVLCLASDIGDLKERVSRIIVAYDED-GDPVTVEDIEATGPATMLLRDAIKPNV
FTHS_MYCPE       AASNLMALFCLAKSKSDFKKRIENTLVAFSKS-NKAIYVKDLNIIDSIMLILDDALKPNL
FTHS_UREPA       AASDLMALFCLAHDHKDFEDKLAQTIVAYNIV-NQPIRICDLELTKAIMAILEDALYANL
                   .:: .   :  .  ::. :      .        .    .    .    :  :. ..:

FTHS_THEAC       VQTTEGVPAFVHTGPFGNIAHGTSSLVADKIALNLFDYVITEAGFGSDLGAEKFFNLASR
FTHS_THEVO       VQTTEGVPAFVHTGPFGNIAHGTSSIVADRIAMNLFDYVITEAGFGSDLGAEKFFNIVSR
FTHS_PICTO       AQTSEHVPAIIHTGPFGNIAHGTSSILGDIIGLKMFDYLVTEAGFGSDLGFEKFIDIVLR
FTHS_DEHM1       LQTIEGQPVFVHAGPFANIAIGQSSIVADRLALKLADYHVTESGFGADIGFEKFWNIKCR
FTHS_DEHMC       LQTIEGQPVFVHAGPFANIAIGQSSIVADRLALKLADYHVTESGFGADIGFEKFWNIKCR
FTHS_PHOPR       MQTLEGVATLIHAGPFANIAHGNSSIIADRIALKLSEFTVTEGGFGSDMGFEKACNIKAQ
FTHS_VIBCH       MQTLEGVPTLIHAGPFANIAHGNSSIIADEIATRLADYTVTEGGFGSDMGFEKACNIKAK
FTHS_VIBVU       MQTLEGVPTLIHAGPFANIAHGNSSIIADEIALKLSSYVVTEAGFGSDMGLEKACNIKSS
FTHS_VIBVY       MQTLEGVPTLIHAGPFANIAHGNSSIIADEIALKLSSYVVTEAGFGSDMGLEKACNIKSS
FTHS_VIBPA       MQTLEGVPTLIHAGPFANIAHGNSSIIADEIALKLSRYTVTEAGFGSDMGFEKACNIKAA
FTHS_ALIF1       MQTLEGVPTFVHSGPFANIAHGNSSIIADNIALKLTDYTVTEGGFGSDMGFEKACNIKAP
FTHS_SHEON       MQTLNGAPCLIHAGPFANIAHGNSSVIADDIALKLADFVVTEGGFGSDMGFEKFCNIKAR
FTHS_CUTAK       LQTTENSPVLVHAGPFGNIATGNSSVIADRVGIGCGDYLLTEAGFGADMGAERFFNIKCR
FTHS_THET2       VQTAEGNPAFIHMGPFGNIAHGTNSLRASLFALGLADLVVQEAGFATDLGLEKFMNVVAR
FTHS_MOOTH       VQTLENTPAFIHGGPFANIAHGCNSIIATKTALKLADYVVTEAGFGADLGAEKFYDVKCR
FTHS_CALS4       VQTIENVPAFVHGGPFANIAHGCNSLIATKYGLKLADYLVTEAGFGADLGAEKFFDVKAR
FTHS_CLOAB       VQTLENTPAIIHGGPFANIAHGCNSILATKMALKLGDYVITEAGFGADLGAEKFLDIKCR
FTHS_CLOPE       VQTLENTPAIIHGGPFANIAHGCNSIIATKTALKMSDITITEAGFGADLGAEKFLDIKCR
FTHS_CLOTE       VQTLENTPALIHGGPFANIAHGCNSLIATRLGLKLGDILVTEAGFGADLGAEKFLDIKCR
FTHS_FUSNN       VQTLENTPVFIHGGPFANIAHGCNSILATKMALKLTDYVVTEAGFAADLGAEKFIDIKCR
FTHS_NEIMA       VQTIEGTPAFVHGGPFANIAHGCNSVTATRLAKHLADYAVTEAGFGADLGAEKFCDIKCR
FTHS_NEIMB       VQTIEGTPAFVHGGPFANIAHGCNSVTATRLAKHLADYAVTEAGFGADLGAEKFCDIKCR
FTHS_NEIG1       VQTIEGTPAFVHGGPFANIAHGCNSVTATRLAKHLADYAVTEAGFGADLGAEKFCDIKCR
FTHS_HAEDU       VQTMAGSPAFIHGGPFANIAHGCNSVIATRLALHLGDYAVTEAGFGADLGAEKFCDIKCR
FTHS2_STRP8      VQTLEHTPALIHGGPFANIAHGCNSVLATKLALKYGDYAVTEAGFGADLGAEKFIDIKCR
FTHS2_STRPM      VQTLEHTPALIHGGPFANIAHGCNSVLATKLALKYGDYAVTEAGFGADLGAEKFIDIKCR
FTHS2_STRP3      VQTLEHTPALIHGGPFANIAHGCNSVLATKLALKYGDYAVTEAGFGADLGAEKFIDIKCR
FTHS2_STRP1      VQTLEHTPALIHGGPFANIAHGCNSVLATKLALKYGDYAVTEAGFGADLGAEKFIDIKCR
FTHS2_STRP6      VQTLEHTPALIHGGPFANIAHGCNSVLATKLALKYGDYAVTEAGFGADLGAEKFIDIKCR
FTHS_SYMTH       VQTLENTPAFVHGGPFANIAHGCNTVVATRLALKLADYVITEAGFGADLGAEKFIDIKCR
FTHS_RHILO       VQTLENNPAFVHGGPFANIAHGCNSVVATTTALKLADYVVTEAGFGADLGAEKFFDIKCR
FTHS_RHIME       VQTLENNPAFVHGGPFANIAHGCNSVVATTTALKLADYVVTEAGFGADLGAEKFFDIKCR
FTHS_RUEPO       VQTLENNPAFVHGGPFANIAHGCNSVIATKTALKVADYVVTEAGFGADLGAEKFMNIKCR
FTHS_PELUB       TQTLENNPAIIHGGPFANIAHGCNSVIATKTGLKLADYVVTEAGFGADLGAEKFLDIKCR
FTHS_METEA       VQTLEGNPALIHGGPFANIAHGCNSVIATRTGLRLADYTVTEAGFGADLGAEKFIDIKCR
FTHS_ZYMMO       VQTLEGNPALIHGGPFANIAHGCNSLIATKAALHLGDIAITEAGFGADLGAEKFFDIKCR
FTHS_METCA       VQTLENNLAIIHGGPFANIAHGCNTVTATQTALKLADYVVTEAGFGADLGAEKFIDIKCR
FTHS_BACCZ       VQTLENTPAIIHGGPFANIAHGCNSVIATTMAAKLGDYVITEAGFGADLGAEKFLDIKAR
FTHS_BACHK       VQTLENTPAIIHGGPFANIAHGCNSVIATTMAAKLGDYVITEAGFGADLGAEKFLDIKAR
FTHS_BACAN       VQTLENTPAIIHGGPFANIAHGCNSVIATTMAAKLGDYVITEAGFGADLGAEKFLDIKAR
FTHS_BACC1       VQTLENTPAIIHGGPFANIAHGCNSVIATTMAAKLGDYVITEAGFGADLGAEKFLDIKAR
FTHS_BACCR       VQTLENTPAIIHGGPFANIAHGCNSVIATTMAAKLGDYVITEAGFGADLGAEKFLDIKAR
FTHS_LISMF       VQTLEHTPAIVHGGPFANIAHGCNSVSATSTALRLGEYVVTEAGFGADLGAEKFLDIKVP
FTHS_LISMO       VQTLEHTPAIVHGGPFANIAHGCNSVSATSTALRLGDYVVTEAGFGADLGAEKFLDIKVP
FTHS_LISIN       VQTLEHTPAIVHGGPFANIAHGCNSVSATSTALKLGEYVVTEAGFGADLGAEKFLDIKVP
FTHS_STRA3       VQTIYGTPALVHGGPFANIAHGCNSVLATSTALRLADYVVTEAGFGADLGAEKFLDIKTP
FTHS_STRA5       VQTIYGTPALVHGGPFANIAHGCNSVLATSTALRLADYVVTEAGFGADLGAEKFLDIKTP
FTHS1_STRP1      VQTIYGTPALIHGGPFANIAHGCNSVLATSTALRLADYTVTEAGFGADLGAEKFLNIKVP
FTHS1_STRP3      VQTIYGTPALIHGGPFANIAHGCNSVLATSTALRLADYTVTEAGFGADLGAEKFLNIKVP
FTHS1_STRP6      VQTIYGTPALIHGGPFANIAHGCNSVLATSTALRLADYTVTEAGFGADLGAEKFLNIKVP
FTHS1_STRP8      VQTIYGTPALIHGGPFANIAHGCNSVLATSTALRLADYTVTEAGFGADLGAEKFLNIKVP
FTHS1_STRPM      VQTIYGTPALIHGGPFANIAHGCNSVLATSTALRLADYTVTEAGFGADLGAEKFLNIKVP
FTHS_STRT1       VQTIYGTPALVHGGPFANIAHGCNSVLATSTALRLADYTVTEAGFGADLGAEKFLDIKTP
FTHS_STRT2       VQTIYGTPALVHGGPFANIAHGCNSVLATSTALRLADYTVTEAGFGADLGAEKFLDIKTP
FTHS_STRPN       VQTIYGTPAFVHGGPFANIAHGCNSVLATTTALHLADYTVTEAGFGADLGAEKFLDIKTP
FTHS_STRR6       VQTIYGTPAFVHGGPFANIAHGCNSVLATTTALHLADYTVTEAGFGADLGAEKFLDIKTP
FTHS_STRMU       VQTIYGTPAFVHGGPFANIAHGCNSVLATSTALRLADYTITEAGFGADLGAEKFLDIKAP
FTHS_ENTFA       VQTIEGTPAFVHGGPFANIAHGCNSILATKTALHLGDYVVTEAGFGGDLGGEKFLDIKVP
FTHS_LACLA       VQTIEGTPALIHGGPFANIAHGCNSVLATKTALKLSDIVITEAGFGADLGGEKFLDIKTR
FTHS_STAAM       VQSIEGTPALVHGGPFANIAHGCNSILATETARDLADIVVTEAGFGSDLGAEKFMDIKAR
FTHS_STAAN       VQSIEGTPALVHGGPFANIAHGCNSILATETARDLADIVVTEAGFGSDLGAEKFMDIKAR
FTHS_STAAR       VQSIEGTPALVHGGPFANIAHGCNSILATETARDLADIVVTEAGFGSDLGAEKFMDIKAR
FTHS_STAAS       VQSIEGTPALVHGGPFANIAHGCNSILATETARDLADIVVTEAGFGSDLGAEKFMDIKAR
FTHS_STAAW       VQSIEGTPALVHGGPFANIAHGCNSILATETARDLADIVVTEAGFGSDLGAEKFMDIKAR
FTHS_STAAC       VQSIEGTPTLVHGGPFANIAHGCNSILATETARDLADIVVTEAGFGSDLGAEKFMDIKVR
FTHS_STAHJ       VQTIEGTPALVHGGPFANIAHGCNSILATETARDLADIVVTEAGFGSDLGAEKFIDIKAR
FTHS_STAES       VQTIEGTPALVHGGPFANIAHGCNSILATETARNLSDIVVTEAGFGSDLGAEKFMNIKAR
FTHS_STAEQ       VQTIEGTPALVHGGPFANIAHGCNSILATETARNLSDIVVTEAGFGSDLGAEKFMNIKAR
FTHS_BACLD       VQTVEGTPALVHGGPFANIAHGANSLIATKTAAKLADYVVTEAGFGADLGAEKFMHIKTR
FTHS_CORDI       VQTLGGTPALCHGGPFANIAHGCNSLIATKTALSLGDVVLTEAGFGSDLGAEKFFDIKSR
FTHS_CORJK       VQTLGGTPALVHGGPFANIAHGCNSLIATTTALDLSEVVLTEAGFGSDLGAEKFFDIKSR
FTHS1_LACAC      VQTLEHTPALVHGGPFANIAHGANSVMATNLALHLSDYVLTEAGFGSDLGGQKFMDFVSK
FTHS_LACJO       VQTLEHTPAIVHGGPFANIAHGANSVIATNTALHLSDYVLTEAGFGADLGGQKFMDFVSN
FTHS2_LACAC      VQTLDHTPAIIHGGPFANIAHGCNSVLATQIALKTSDYTVTECGFGADLGAEKFLDIKRP
FTHS_LACPL       VQTLAHTPALVHGGPFANIAHGCNSVLATQAGLNLADYTVTEAGFGADLGGQKFMDINVP
FTHS_BACFN       VQTTEGTAAFVHGGPFANIAHGCNSILATKMAMTFGDYVITEAGFGADLGAEKFYNIKCR
FTHS_BACFR       VQTTEGTAAFVHGGPFANIAHGCNSILATKMAMTFGDYVITEAGFGADLGAEKFYNIKCR
FTHS_BACTN       VQTTEGTAAFVHGGPFANIAHGCNSILATKLAMSFGDYVITEAGFGADLGAEKFYNIKCR
FTHS_PORGI       VQTTEHTPAFVHGGPFANIAHGCNSILATKMALSFGEYAVTEAGFGADLGAEKFLDIKCR
FTHS_TREDE       VQTTENTPAFIHGGPFANIAHGCNSVIATKTALTYGEYVITEAGFAADLGAEKFFDIKCR
FTHS_THEMA       VQTTEGTPALIHCGPFANIAHGTNSIIATKMAMKLSEYTVTEAGFGADLGAEKFIDFVSR
FTHS_HALMA       VQTIEGTPALVHGGPFANIAHGTNSLVADKTAFGMGDYLVTEAGFGSDLGAEKFMDVVCR
FTHS_MYCPE       VFSQDNNPIIMHGGPFANIAHGCNSVIALSCGLNKAEYVLTEAGFGSELGAEKFINILCR
FTHS_UREPA       VRTNEDNPVFVHGGPFANIAHGCNSIIATKNALALGDYVVTECGFGSDLGLEKFMNIKMA
                   :      : * ***.*** * .:: .   .       : * **. ::* ::  ..   

FTHS_THEAC       IGDLPINAVVLVATIRAIKHHG-----------GSKKEGEDIDAVKTGSKNLIRHVQNIR
FTHS_THEVO       IGNLPINAVVLVATIRALKLHG-----------GSKKQGEDVEAVKEGSKNLLRHVANIR
FTHS_PICTO       LSDFKLSAVVLVATVRAMRYHG-----------GGRINEPDVNAVLRGSENLMWHVQNIK
FTHS_DEHM1       LSGLKPDCAVIVATVRALKMHGGGPKVTPGAPLDPAYTTPNAALVEKGCQNMLAHIQTVK
FTHS_DEHMC       LSGLKPDCAVIVVTARALKMHGGGPKVTPGAPLDPAYTTPNTKLVEKGCQNMLAHIQTVK
FTHS_PHOPR       QADRGPDCAVVVATLRGLKANSGLYDLRPGQALPDAIFSPDEKALIAGFDNLKWHIRNAA
FTHS_VIBCH       ASGKTPDCAVIVATLRGLKANSGLYDLRPGQAVPDALFAPDSAALQAGFANLKWHIDNVN
FTHS_VIBVU       TSHKAPDCVVIVATLRGLKANSGLYDLKPGMPLPDALFQPDRAALESGFSNLKWHIDNAQ
FTHS_VIBVY       TSHKAPDCVVIVATLRGLKANSGLYDLKPGMPLPDALFQPDRAALESGFSNLKWHIDNAQ
FTHS_VIBPA       AANKAPDCVVIVATLRGLKANSGHYDLRPGMAIPDSIFSPDQAALVAGFENLKWHIKNVH
FTHS_ALIF1       LSEKSPDCAVLVATLRGIKANSGLFPLSPGQSLPKELFAPNKEALDAGLDNLLWHINNCA
FTHS_SHEON       QSGLIPSAAVLVTTLKALKANSGL-------ASDTDINAPDQARLEAGFANLNWHINNVV
FTHS_CUTAK       IGGMRPDAAVLVATVRALKTHAGRYKVIPGKPLPPAMLEDNPDDVLAGAANLRKHIEIVR
FTHS_THET2       TTGLVPEAVVLVATIRALRYHGGQ----------DAYGMPDPKAVKAGLANLEKHVENVE
FTHS_MOOTH       YAGFKPDATVIVATVRALKMHG--------GVPKSDLATENLEALREGFANLEKHIENIG
FTHS_CALS4       FGGLTPNAAVVVATVRALKMHG--------GVKKEDLQKEDVEAVRRGIENLEKQVENVR
FTHS_CLOAB       YGNLNPDCVVLVATIRALKHHG--------GALKEDLSKPNAKVLEKGLSNLGKQIENIK
FTHS_CLOPE       YGNLNPDCVVLVATIRALKHHG--------GVKKDELNISNVDALNKGMKNLEKQIENIK
FTHS_CLOTE       YGGLKPDAVVIVATIRALKMHG--------GVKKTELSGENLEALDKGFANLQKHITNMK
FTHS_FUSNN       LGGLKPDCAVIVATVRALEHHG--------KGD-----------LKAGLENLDKHIDNIK
FTHS_NEIMA       LAGLKPDAAVVVATVRALKYNG--------GVERANLGEENLDALEKGLPNLLKHISNLK
FTHS_NEIMB       LAGLKPDAAVVVATVRALKYNG--------GVERANLGEENLDALEKGLPNLLKHISNLK
FTHS_NEIG1       LAGLKPDAAVVVATVRALKYNG--------GVERANLGEENLEALAKGLPNLLKHISNLK
FTHS_HAEDU       LAELKPDVAVIVATVRALKYNG--------GVEKANLAEENLEALTEGLPNLLKHIANLK
FTHS2_STRP8      MSGLRPAAVVLVATIRALKMHG--------GVPKADLATENVQAVVDGLPNLDKHLANIQ
FTHS2_STRPM      MSGLRPAAVVLVATIRALKMHG--------GVPKANLATENVQAVVDGLPNLDKHLANIQ
FTHS2_STRP3      MSGLRPAAVVLVATIRALKMHG--------GVPKADLATENVQAVVDGLPNLDKHLANIQ
FTHS2_STRP1      MSGLRPAAVVLVATIRALKMHG--------GVPKADLATENVQAVVDGLPNLDKHLANIQ
FTHS2_STRP6      MSGLRPAAVVLVATIRALKMHG--------GVPKADLATENVQAVVDGLPNLDKHLANIQ
FTHS_SYMTH       LSGLRPDAVVVVATIRSLKMHG--------GLKKDDLAREDLEALQRGSANLMRHLRNVT
FTHS_RHILO       KAGLKPAAAVIVATVRAMKMNG--------GVKKEDLGKENIEAVKKGCANLGRHIENIR
FTHS_RHIME       KAGLTPDAAVIVATVRAIKMNG--------GVKREDLGRESVEAVRKGCANLGRHIQNVK
FTHS_RUEPO       KAGIAPSAVVLVATVRAMKMNG--------GVAKGDLGAENVAAVNKGCANLGRHIENVK
FTHS_PELUB       KSDLKPSCVVIVATIRALKMHG--------GVAKDDLKTENVEALKKGLVNLQRHVENVK
FTHS_METEA       QTGLKPSAVVIVATIRALKMHG--------GVNKKDLQAENLDALEKGFANLERHVNNVR
FTHS_ZYMMO       QANLEPDAVVLVATIRALKMHG--------GVALADLKNENIAALETGFANLARHAENLA
FTHS_METCA       MAGLNPAAVVLVATVRALKFHG--------GVKKEDLNQENLAALEAGFANLERHVHNIR
FTHS_BACCZ       AAGIKPEAVVIVATIRALKMHG--------GVAKDQLKEENVDALAKGMENLQKHVETIQ
FTHS_BACHK       AAGIKPEAVVIVATIRALKMHG--------GVAKDQLKEENVDALAKGMENLQKHVETIQ
FTHS_BACAN       AAGIKPEAVVIVATIRALKMHG--------GVAKDQLKEENVDALAKGMENLQKHVETIQ
FTHS_BACC1       AAGIKPEAVVIVATIRALKMHG--------GVAKDQLKEENVDALAKGMENLQKHVETIQ
FTHS_BACCR       AAGIKPEAVVIVATIRALKMHG--------GVAKDQLKEENVDALAKGMENLQKHVETIQ
FTHS_LISMF       ALGKAPDCVVIVATIRALKMHG--------GALKTELSEENVDALAKGFTNLQKHTESIQ
FTHS_LISMO       ALGKAPDCVVIVATIRALKMHG--------GALKTELSEENVDALAKGFTNLQKHTESIQ
FTHS_LISIN       ALGKAPDCVVIVATIRALKMHG--------GALKTELSEENVDALAKGFTNLQKHTESIQ
FTHS_STRA3       NLPTSPDAIVIVATLRALKMHG--------GVSKEDLSQENVKAVKRGFTNLERHVNNMR
FTHS_STRA5       NLPTSPDAIVIVATLRALKMHG--------GVSKEDLSQENVEAVKRGFTNLERHVNNMR
FTHS1_STRP1      NLPKAPDAIVIVATLRALKMHG--------GVAKSDLAAENCEAVRLGFANLKRHVENMR
FTHS1_STRP3      NLPKAPDAIVIVATLRALKMHG--------GVAKSDLAAENCEAVRLGFANLKRHVENMR
FTHS1_STRP6      NLPKAPDAIVIVATLRALKMHG--------GVAKSDLAAENCEAVRLGFANLKRHVENMR
FTHS1_STRP8      NLPKAPDAIVIVATLRALKMHG--------GVAKSDLAAENCEAVRLGFANLKRHVENMR
FTHS1_STRPM      NLPKAPDAIVIVATLRALKMHG--------GVAKSDLAAENCEAVRLGFANLKRHVENMR
FTHS_STRT1       NLPTTPDAVVIVATLRALKMHG--------GVAKTDLSEENVQAVRDGFSNLKRHVENIR
FTHS_STRT2       NLPTTPDAVVIVATLRALKMHG--------GVAKTDLSEENVQAVRDGFSNLKRHVENIR
FTHS_STRPN       NLPTSPDAVVIVATLRALKMNG--------GVAKDALTEENVEAVRAGFANLKRHVENIR
FTHS_STRR6       NLPTSPDAVVIVATLRALKMNG--------GVAKDALTEENVEAVRAGFANLKRHVENIR
FTHS_STRMU       NLPTSPDAVVIVATIRALKMNG--------GVAKDALNQENVEAVKAGFANLARHVENMR
FTHS_ENTFA       SLGKAPDAVVIVATIRALKMHG--------GLAKDQLAEENLPALQKGFANLEKHIQNMQ
FTHS_LACLA       QLGKQPDAVVIVATLRALKMHG--------GLDKKELTKENVEAVKKGFANLERHIKNMQ
FTHS_STAAM       EAGFDLAAVVVVATIRALKMHG--------GVAKDNLKEENVEAVKAGIVNLERHVNNIK
FTHS_STAAN       EAGFDLAAVVVVATIRALKMHG--------GVAKDNLKEENVEAVKAGIVNLERHVNNIK
FTHS_STAAR       EAGFDPAAVVVVATIRALKMHG--------GVAKDNLKEENVEAVKAGIVNLERHVNNIK
FTHS_STAAS       EAGFDPAAVVVVATIRALKMHG--------GVAKDNLKEENVEAVKAGIVNLERHVNNIK
FTHS_STAAW       EAGFDPAAVVVVATIRALKMHG--------GVAKDNLKEENVEAVKAGIVNLERHVNNIK
FTHS_STAAC       EAGFDPAAVVVVATIRALKMHG--------GVAKDNLKEENVEAVKAGIVNLERHVNNIK
FTHS_STAHJ       EAGFEPSAVVLVATVRALKMHG--------GVAKDDLKEENVEAVKAGIVNLERHVNNIR
FTHS_STAES       EAGFDPSAVVVVATIRALKMHG--------GVAKDQLQHENIEAVEAGLVNLERHVNNIK
FTHS_STAEQ       EAGFDPSAVVVVATIRALKMHG--------GVAKDQLQHENIEAVEAGLVNLERHVNNIK
FTHS_BACLD       AGGFTPGAVVIVATVRALKMHG--------GTPLADLKQKDLEALKRGIANLAKHIETID
FTHS_CORDI       VGDLNVAATVVVATVRSLKYNA--------GVPKDELTTENLEALASGVVNLERHVENIR
FTHS_CORJK       AGDLDVAATVVVATIRSLKHNG--------DS-----------VLKAGLANLERHVSNIR
FTHS1_LACAC      HLDKTPDAAVVVATVRALKYQA--------LGSTDKLDEENLDALKTGFKNLERHMNNMR
FTHS_LACJO       HLDKRPDAVVVVATVRALKYQA--------EETTDHLDEENIPALEKGFENLKRHMENMA
FTHS2_LACAC      VLGETPNAVVIVATARALKLNG--------GADKDELTKEDIPALEKGMANLRRHVENMQ
FTHS_LACPL       AVGQAPNAVVIVATIRALKLHG--------GVALQDLATENVAALKAGAANLGHHIHAMQ
FTHS_BACFN       KSGLQPRLTVIVATAQGLKMHG--------GVSLDRIKEPNLEGLREGLRNLDKHVRNLH
FTHS_BACFR       KSGLQPRLTVIVATAQGLKMHG--------GVSLDRIKEPNLEGLREGLRNLDKHVRNLH
FTHS_BACTN       KSGLQPKLTVIVATAQGLKMHG--------GVSLDRIKEPNMEGLKEGLRNLDKHIRNLR
FTHS_PORGI       EMGVAPKLTVLVATLRALKLHG--------GVAETEIKAPNAEALRRGLSNLDRHIYNLK
FTHS_TREDE       KAGLNPKLTIIAATTGGLKMHG--------DVPEKEISKPNAEALKKGLANLDKHIENMK
FTHS_THEMA       VGGFYPNAAVLVATVRALKYHG--------GANLKNIHEENLEALKEGFKNLRVHVENLR
FTHS_HALMA       KGDMTPNAVVLVASVRALKYHGLNQW----PVDYDEIGEAGVEAVEAGFSNLDKHARNLQ
FTHS_MYCPE       ETNLVPNLVVLTITLKAIKYHGVNNS------NNTSPLTDEKEKIDIGFNNVIHHFNLLK
FTHS_UREPA       SLNLKPDLIGLVISLKSIAYHAQTN---------------EKDYVKQGFANVLCHINHIK
                           :. :  .:  :.                      :  *  *:  :     

FTHS_THEAC       N-FGIDPVVAVNRFPTDTDGEIRALGEILDS----NGIKWALSEVFAKGGEGGIDLANKV
FTHS_THEVO       K-FGVEPVVALNKFPTDTENEIMAIGEILDS----HGIKWALSEVFEKGGEGGIELANKV
FTHS_PICTO       K-FGFNPVVAINRHSNDTDAEINAISNILTK----NGVEFSISDAYSDGGHGALDLAGKV
FTHS_DEHM1       T-AGINPVVCINHFAADTAQEIDIIRRTAEQ----AGARVAVSYHWANGGEGAAELAEAV
FTHS_DEHMC       T-AGINPVVCINHFAADTHEEIDIIRRTAEQ----AEARVAVSHHWAKGGDGATELAEAV
FTHS_PHOPR       Q-YGLPVVVAINRFPQDTDVELELLKNMVADTDFSTYVGVAISEAFGKGGEGATELAQAV
FTHS_VIBCH       Q-YGVPAVVAINRFPQDCAEELEQLVKLIEA--LPNRVSVAISEGFAKGGEGTKLLAEKV
FTHS_VIBVU       K-YGLPVVVAINQFPQDSAEELGQLKLWIQQ--LPLNVRVAISEGFAKGGKGMEAVAREV
FTHS_VIBVY       K-YGLPAVVAINQFPQDSAEELGQLKLWIQQ--LPLNVRVAISEGFAKGGKGMEAVAREV
FTHS_VIBPA       K-YGIPAVVAINQFPQDCEQELTALQDLIHA--FDPNVKVAISTAFAQGGEGTRDLAQYV
FTHS_ALIF1       K-YGLPVVVAINRFPEDTQEELDSLLNWVSN--LDMNVDVAISEAFVKGGNGTLELAEKV
FTHS_SHEON       Q-YGLPVVVAINRFASDTDAELNWLMEAVRG---TAAFGCELSEAFSQGEDGAMALAQTV
FTHS_CUTAK       E-FGVSPIVALNVFPTDHPDEIDAVRKVAEA----AGAHFASSTHVVDGGDGAVDLAHAV
FTHS_THET2       L-FGYKPVIALNRFPSDAPEEIALVRAFAEE----RGLPFAPSEVYAQGGEGGLELAERV
FTHS_MOOTH       K-FGVPAVVAINAFPTDTEAELNLLYELCAK----AGAEVALSEVWAKGGEGGLELARKV
FTHS_CALS4       K-FGVPVVVALNKFVFDTEREIEEVRKACDR----IGVDMAVAEVWEKGGEGGIELAEKV
FTHS_CLOAB       K-YGVPVVVAINKFITDSEEEIKCIEEYCSK----QGVKVSLTEVWEKGGEGGTDLANKV
FTHS_CLOPE       A-YGVPVVVAINKFITDSDEEVKAIEDFCKN----IGVEVSLTEVWEKGGEGGIDLANKV
FTHS_CLOTE       N-FGLPVMVAVNRFITDSEAEIDLLIKKCKE----IGVEVSLNEVWAKGGEGGIEMAEKL
FTHS_FUSNN       NKYKLPLVVAINKFITDTDEQINMIEKFCNE----RGAEVSLCEVWAKGGEGGIDLAEKV
FTHS_NEIMA       NVFGLPVVVALNRFVSDSDAELAMIEKACAE----HGVEVSLTEVWGKGGAGGADLARKV
FTHS_NEIMB       NVFGLPVVVALNRFVSDADAELAMIEKACAE----HGVEVSLTEVWGKGGAGGADLARKV
FTHS_NEIG1       NVFGLPVVVALNRFVSDSDAELAMIEKACAE----HGVEVSLTEVWGKGGAGGADLARKV
FTHS_HAEDU       NVLGLPVVVALNRFVSDSDAELALIQTACAK----QGVEVSLTEVWARSAVGGVDLAHKV
FTHS2_STRP8      DVYGLPVVVAINKFPLDTDAELQAVYDACDK----RGVDVVISDVWANGGAGGRELAEKV
FTHS2_STRPM      DVYGLPVVVAINKFPLDTDAELQAVYDACDK----RGVDVVISDVWANGGAGGRELAEKV
FTHS2_STRP3      DVYGLPVVVAINKFPLDTDAELQAVYDACDK----RGVDVVISDVWANGGAGARELAEKV
FTHS2_STRP1      DVYGLPVVVAINKFPLDTDAELQAVYDACDK----RGVDVVISDVWANGGAGGRELAEKV
FTHS2_STRP6      DVYGLPVVVAINKFPLDTDAELQAVYDACDK----RGVDVVISDVWANGGAGGRELAEKV
FTHS_SYMTH       EVFGLPAVVAINRFAADTEAEIALLRALVEE----AGATAVVADVHARGGDGGIELAQRV
FTHS_RHILO       Q-FGVPAVVAINHFYSDTDAEIQAMKDYVAS----MGEEAVLCKHWAKGSAGIEELANKV
FTHS_RHIME       K-FGVPVLVAINHFTSDTEAEVRAIKDYVRT----LGSEAVLCKHWAEGSAGIEELAYKV
FTHS_RUEPO       S-FGVPVVVAINHFVTDTDAEVQAVRDYCAN----HGVEAVLSRHWELGSEGSEALARKV
FTHS_PELUB       K-FGLPVAVAVNHFIKDTENEVKALIEFCDT----IGVKASLCTHWANGGEGTKELASHV
FTHS_METEA       S-FGLPVVVGVNHFFQDTDAEHARLKELCRDR---LQVEAITCKHWAEGGAGAEALAQAV
FTHS_ZYMMO       K-FGVKTVVAINRFHSDTEAELDKLQDLCAS----IGLDSAVCTHFTDGGAGAEDLARKL
FTHS_METCA       EHYGLPCVVSINHFSFDTEAEIAWLMKKCEA----LGVKAVLARHWAEGGKGAEALARTV
FTHS_BACCZ       S-FGVPFVIAINKFITDTDAEVAYLQEWCNE----RGYAVSLTEVWEKGGQGGVDLAEKV
FTHS_BACHK       S-FGVPFVIAINKFITDTDAEVAYLQEWCNE----RGYAVSLTEVWEKGGQGGVDLAEKV
FTHS_BACAN       S-FGVPFVIAINKFITDTDAEVAYLQEWCNE----RGYAVSLTEVWEKGGQGGVDLAEKV
FTHS_BACC1       S-FGVPFVIAINKFITDTDAEVAYLQEWCNE----RGYAVSLTEVWEKGGQGGVDLAEKV
FTHS_BACCR       S-FGVPFVIAINKFITDTDAEVTYLQEWCNE----RGYAVSLTEVWEKGGQGGVDLAEKV
FTHS_LISMF       T-FGIPYVVAINKFITDSDAEVAKLEALCEE----HGIPFSLTEVWEKGGDGGLELADKV
FTHS_LISMO       T-FGIPYVVAINKFITDSDAEVAKLEALCEE----HGIPFSLTEVWEKGGDGGLELADKV
FTHS_LISIN       T-FGIPYVVAINKFITDSDAEVAKLEQLCEE----HGIPFSLTEVWEKGGDGGLELADKV
FTHS_STRA3       Q-YGVPVVVAINQFTADTESEIATLKTLCSN----IDVAVELASVWEDGADGGLELAQTV
FTHS_STRA5       Q-YGVPVVVAINQFTADTESEIATLKTLCSN----IDVAVELASVWEDGADGGLELAQTV
FTHS1_STRP1      Q-FKVPVVVAINEFVADTEAEIATLKALCEE----IKVPVELASVWANGAEGGLALAKTV
FTHS1_STRP3      Q-FKVPVVVAINEFVADTEAEIATLKALCEE----IKVPVELASVWANGAEGGLALAKTV
FTHS1_STRP6      Q-FKVPVVVAINEFVADTEAEIATLKALCEE----IKVPVELASVWANGAEGGLALAKTV
FTHS1_STRP8      Q-FKVPVVVAINEFVADTEAEIATLKALCEE----IKVPVELASVWANGAEGGLALAKTA
FTHS1_STRPM      Q-FKVPVVVAINEFVADTEAEIATLKALCEE----IKVPVELASVWANGAEGGLALAKTV
FTHS_STRT1       K-FGIPVVVAINEFVADTEAEIAALKELCSE----IKVPVELASVWANGADGGIDLANTV
FTHS_STRT2       K-FGIPVVVAINEFVADTEAEIAALKELCSE----IKVPVELASVWANGADGGIDLANTV
FTHS_STRPN       K-FGIPAVVAINEFVSDTEAEIAALKELCAS----IDVPVELASVWADGAEGGVALAETV
FTHS_STRR6       K-FGIPAVVAINEFVSDTEAEIAVLKELCAS----IDVPVELASVWADGAEGGVALAETV
FTHS_STRMU       K-YGVPVVVAINEFITDTNDEIAVLRNLCAA----IDVPVELASVWANGADGGVDLANTL
FTHS_ENTFA       R-YDVPVVVAINEFTQDTEKEIQLLKEACQA----LGVPVELTSVWAQGGAGGTNLAKTV
FTHS_LACLA       S-YGLPVIVAINEFASDTKSEISALKDLTEA----LGVPVSLTQVFAKGGEGGLDLAEKL
FTHS_STAAM       K-FGVEPVVAINAFIHDTDAEVEYVKSWAKE----NNVRIALTEVWEKGGKGGVDLANEV
FTHS_STAAN       K-FGVEPVVAINAFIHDTDAEVEYVKSWAKE----NNVRIALTEVWEKGGKGGVDLANEV
FTHS_STAAR       K-FGVEPVVAINAFIHDTDAEVEYVKSWAKE----NNVRIALTEVWEKGGKGGVDLANEV
FTHS_STAAS       K-FGVEPVVAINAFIHDTDAEVEYVKSWAKE----NNVRIALTEVWEKGGKGGVDLANEV
FTHS_STAAW       K-FGVEPVVAINAFIHDTDAEVEYVKSWAKE----NNVRIALTEVWEKGGKGGVDLANEV
FTHS_STAAC       K-FGVEPVVAINAFIHDTDAEVEYVKSWAKE----NNVRIALTEVWKKGGKGGVDLANEV
FTHS_STAHJ       K-FGVEPVIALNAFIHDTDAETEAVKAWAKE----NNVRIALTEVWEKGGKGGVELANQV
FTHS_STAES       K-YGVEPIVALNAFIHDTPSETACVKQWAKD----NQVRIALTEVWEKGGEGGIELANQV
FTHS_STAEQ       K-YGVEPIVALNAFIHDTPSETACVKQWAKD----NQVRIALTEVWEKGGEGGIELANQV
FTHS_BACLD       A-FGLPYVVAVNRFVQDTEDELEAVLGWCRD----NGHPAALCNVWEEGGKGGTDLAREV
FTHS_CORDI       A-FGIEPIVALNKFASDTDAEINQLKAWAET----MSVQLIPVEVWAHGGQGALELADAV
FTHS_CORJK       K-FGVEPVVALNLFSSDTAAERSMVADWGEQ----FGVRVVECSVWAEGGAGAADLATAV
FTHS1_LACAC      S-YNVPVIVLINRFDTDTDKELELLKELVEK----QGIKAEVVTYHNEGSKGGSRAAQEV
FTHS_LACJO       H-YGVPVIVLINKFASDTEQELSKLKELVKA----DGFECEVVSYHDEGSKGGIKAAEKV
FTHS2_LACAC      K-YNLPIVVAINHFNSDTEAEIKTIQDACAE----MGVKAIEVDAWAKGGQGTQDLAKEV
FTHS_LACPL       R-YGVPVVVAINEFTADTDAEIHAVKDYCAD----LGVDAVLADVWGRGGDGATDLAAAV
FTHS_BACFN       S-FGQTVIVAFNKFASDTDEEMELLREHCEQ----LGVGYAINNAFSEGGEGAVDLANLV
FTHS_BACFR       S-FGQTVIVAFNKFASDTDEEMELLREHCEQ----LGVGYAINNAFSEGGEGAVDLANLV
FTHS_BACTN       S-FGQTVVVAFNKFATDTDEEMEMLREHCEQ----LGVGYAINNAFSDGGDGAVDMARLV
FTHS_PORGI       K-FGQQVIVAFNRFDTDEEEEISIVREHCIG----QNVGFAVNNAFAEGGKGAEELAKLV
FTHS_TREDE       K-FGQTVVVALNRYGYDIDSELELVRKHCEA----QGVGFAVNNAFVEGGKGAVELAELV
FTHS_THEMA       K-FNLPVVVALNRFSTDTEKEIAYVVKEC-EK---LGVRVAVSEVFKKGSEGGVELAKAV
FTHS_HALMA       K-FGVPVVVSVNRFPDDTDEEVQAVLDHCRED---LGVRAAESNVFSDGSEGGVDLAENV
FTHS_MYCPE       N-LNLNVCIVINKFSDDNKNE----LDYLFNK-SSELTKTVISTMWQDGASKNKSLFETI
FTHS_UREPA       K-YNVSFIVYINVNTNTDSEEDLLTLEKLLDE-HQIEHARSYAYSYGSKKSEEITKKTIT
                         : .*        :                                       

FTHS_THEAC       LASLGSHE-------IKRTYDLKDDIRTKIEKIARNVYGADGVIFEKKALSDMKKAEEIM
FTHS_THEVO       LSSIGDYQ-------IKRTYEVREDLKTKIEKIAVNVYGADGVIFEKKALNDLKKAEEIM
FTHS_PICTO       LKSISDYN-------PRYIYGINDDPEEKISKIAMNVYNANSVEFSHDAVKTMKLIKDDF
FTHS_DEHM1       IDACNEPN------DFHFLYPEDMPLRERIYTIARKVYGADGVSYTQTALEKLARLENTG
FTHS_DEHMC       TDACNEPN------NFHFLYPENMPLKKRIETIARKVYGANGVSYTPIAMEKLARIESMG
FTHS_PHOPR       VKACETPA------NFKPLYSLSQSLEEKLMAVAEVGYGARSIELSDCAKEQLATLKKHG
FTHS_VIBCH       VEQCQHPT------KFTPLYDSGIPLDEKLKAVAVKGYGAAEIALSDKAAQQLAKLQTQG
FTHS_VIBVU       IEACDAPA------NFRPLYRAEQTLEEKIITVCTKGYGCGEVQFSDTAKQQLALYQTLG
FTHS_VIBVY       IEACDAPA------NFRPLYRAEQTLEEKIITVCTKGYGCGEVQFSDTAKQQLALYQTLG
FTHS_VIBPA       VDACEKTT------NFRPLYQKHQSLQEKLMSVCEAGYGATNVEMSELATKQLAHFEKLG
FTHS_ALIF1       IKACQQET------QFTPLYTSEMSLFDKLNAVAIKGYGAERIELSEKAQQQLATFEKLG
FTHS_SHEON       IRACEQPS------EFRLLYPDNMELEAKLSTLAELGYGAAGINLSAVAKQQLQELSALG
FTHS_CUTAK       VAACDHKA------DFRYTYDLEDSLVEKLTKVATKVYGADGIDIAPAAAKELAHFEDLG
FTHS_THET2       LEALDLPH------AYRPLYPLEASLEAKVEAIATRVYGAEGVEWSEEAKRALKAAKKEG
FTHS_MOOTH       LQTLESR-----PSNFHVLYNLDLSIKDKIAKIATEIYGADGVNYTAEADKAIQRYESLG
FTHS_CALS4       IKAADT------PSNFRFLYDVNLPIKDKLHIIATEIYGADGVEYTASALKDIANIEKLG
FTHS_CLOAB       LDTLENE-----KSNFKYLYDEKLSIKEKMDIIAKEIYGADGVQYTPQANKQIKEIEKFN
FTHS_CLOPE       IKTMETE-----PSNFKMIYDSEESIKDKILKIVQTIYGGKGVNYTPQALKQIAEIEKFN
FTHS_CLOTE       VKILETE-----KPNYKPLYDVEDSIPEKLNKIVKELYGGEGVVIESSAMKQIKKLEEIG
FTHS_FUSNN       LKAIDNN-----KTEFDYFYDINLTIKEKIEKICKEIYGADGVIFAPATKKVFDVIEAEG
FTHS_NEIMA       VNAIESQ-----TNNFGFAYDVELGIKDKIRAIAQKVYGAEDVDFSAEASAEIASLEKLG
FTHS_NEIMB       VNAIESQ-----TNNFGFAYDVELGIKDKIRAIAQKVYGAEDVDFSAEASAEIASLEKLG
FTHS_NEIG1       VNAIDNQ-----PNNFGFAYDVELGIKDKIRAIAQKVYGAEDVDFSAEASAEIASLEKLG
FTHS_HAEDU       LKAIDEQ-----QNNFQFAYDVNDRIQHKITAIAQKIYGATDVNFSAEALAEIKNLEKLA
FTHS2_STRP8      VALAEQ------DNQFCFVYEEDDSIETKLTKIVTKVYGGKGIRLTPAAKRELADLERLS
FTHS2_STRPM      VALAEQ------DNQFCFVYEEDDSIETKLTKIVTKVYGGKGIRLTPAAKRELADLERLG
FTHS2_STRP3      VTLAEQ------DNQFRFVYEEDDSIETKLTKIVTKVYGGKGITLSPAAKRELADLERLG
FTHS2_STRP1      VTLAEQ------DNQFRFVYEEDDSIETKLTKIVTKVYGGKGINLSSAAKRELADLERLG
FTHS2_STRP6      VALAEQ------DNQFRFVYNEDDSIETKLTKIVTKIYGGKGIKLTPTAKRELAELERLG
FTHS_SYMTH       VELVEQ------PNRFRFAYDDEDSLKTKIEKVATRIYGADGVDFTREASRMLKKLESEG
FTHS_RHILO       VALAES-G----ASQFAPLYPDAMPLFEKINTIVQRIYRGSEAIADKSVRDQLHAWEQAG
FTHS_RHIME       VDLANA-G----HSQFSPLYPDEMPLFQKIETIAKDIYHASEVIADKLVREQLRTWEDQG
FTHS_RUEPO       VELAES-G----KANFAPIYPDDMSLFEKIETIAKRIYRADEVLADAKIRNQLKEWEEAG
FTHS_PELUB       AELCEK-N----EDKFKFLYESKTPLFKKIETIAKEIYRADEVIADTKIRDQLKSFEDAG
FTHS_METEA       VKLAEG-E----QKPLTFAYETETKITDKIKAIATKLYGAADIQIESKAATKLAGFEKDG
FTHS_ZYMMO       SAILDAPK----EDSFRLLYPDEMPLWKKIETIAKEIYRAGEVVPQGTVLKKLKSFEEQG
FTHS_METCA       ADIVDH-Q----PGRHTFVYGDEATLWNKIETIATKIYGAAGISADAKVKAQLEAW-NAD
FTHS_BACCZ       LKEIEKGE-----NNYAPLYELELPLEEKIRTIAQKVYGAKDIEFAPKARKQLAQYEGEG
FTHS_BACHK       LKEIEKGE-----NNYAPLYELELPLEEKIRTIAQKVYGAKDIEFAPKARKQLAQYEGEG
FTHS_BACAN       LKEIEKGE-----NNYAPLYELELPLEEKIRTIAQKVYGAKDIEFAPKARKQLAQYEGEG
FTHS_BACC1       LKEIEKGE-----NNYAPLYELELPLEEKIRTIAQKVYGAKDIEFAPKARKQLAQYEGEG
FTHS_BACCR       LKEIEKGE-----NNYAPLYELELPLEEKIRTIAQKVYGAKDIEFAPKARKQLAQYEGEG
FTHS_LISMF       IAAVESGE-----ADYKRIYDDAWSIEEKLEAIVTKVYGGIGVELSSKAQKQIVEFKKYG
FTHS_LISMO       IAAVESGA-----ADYKRIYDDAWSMEEKLEAIVTKVYGGIGVELSSKAQKQIVEFKKYG
FTHS_LISIN       IAAVESGE-----EDYKRIYDDAWSIEEKLEAIVTKVYGGIGVELSSKAQKQIVEFKKYG
FTHS_STRA3       ANVIETQS-----SNYKRLYNDEDTIEEKIKKIVTKIYGGNKVHFGPKAQIQLKEFSDNG
FTHS_STRA5       ANVIETQS-----SNYKRLYNDEDTIEEKIKKIVTKIYGGNKVHFGPKAQIQLKEFSDNG
FTHS1_STRP1      VRVIDQEA-----ADYKRLYSDEDTLEEKVINIVTQIYGGKAVQFGPKAKTQLKQFAEFG
FTHS1_STRP3      VRVIDQEA-----ADYKRLYSDEDTLEEKVINIVTQIYGGKAVQFGPKAKTQLKQFAEFG
FTHS1_STRP6      VRVIDQEA-----ADYKRLYSDEDTLEEKVINIVTQIYGGKAVQFGPKAKTQLKQFAEFG
FTHS1_STRP8      VRVIDQEA-----ADYKRLYSDEDTLEEKVINIVTQIYGGKAVQFGPKAKTQLKQFAEFG
FTHS1_STRPM      VRVIDQEA-----ADYKRLYSDEDTLEEKVINIVTQIYGGKAVQFGPKAKTQLKQFTEFG
FTHS_STRT1       VDVVENGN-----ADYKRLYSDDDSLEEKITKIVTEIYGGKSVVFEKKAKNQLKQFAEFG
FTHS_STRT2       VDVVENGN-----ADYKRLYSDDDSLEEKITKIVTEIYGGKSVVFEKKAKNQLKQFAEFG
FTHS_STRPN       VKTIAENP-----ANYKRLYDNDLSVQEKIEKIVTEIYRGSKVNFEKKAQTQIAQIVQNG
FTHS_STRR6       VKTIAENP-----ANYKRLYDNDLSVQEKIEKIVTEIYRGSKVNFEKKSQTQIAQIVQNG
FTHS_STRMU       INTIENNP-----SHYKRLYDNNLSVEEKVTEIAKEIYRADKVIFEKKAKTQIAQIVKNG
FTHS_ENTFA       VAEIEADT-----KQFQPLYNPRQTIEEKIQAIVQTIYGGEQAIFSPKAQKQIADFTKNG
FTHS_LACLA       SGMLQEK------SDFSYLYDLKEPLSAKIDKVVTEIYGGSKVNYSPKAKRQMREIEENG
FTHS_STAAM       LEVIDQP------NSFKPLYELELPLEQKIEKIVTEIYGGSKVTFSSKAQKQLKQFKENG
FTHS_STAAN       LEVIDQP------NSFKPLYELELPLEQKIEKIVTEIYGGSKVTFSSKAQKQLKQFKENG
FTHS_STAAR       LEVIDQP------NSFKPLYELELPLEQKIEKIVTEIYGGSKVTFSSKAQKQLKQFKENG
FTHS_STAAS       LEVIDQP------NSFKPLYELELPLEQKIEKIVTEIYGGSKVTFSSKAQKQLKQFKENG
FTHS_STAAW       LEVIDQP------NSFKPLYELELPLEQKIEKIVTEIYGGSKVTFSSKAQKQLKQFKENG
FTHS_STAAC       LEVIDQP------NSFKPLYELELPLEQKIEKIVTEIYGGSKVTFSSKAQKQLKQFKENG
FTHS_STAHJ       LEVIEQP------NDFKFLYDLDQSLEEKIETIVKDIYGGSSVTFSKKAKKQLKEFTDNG
FTHS_STAES       FDVMQEP------QNFKHLYELKQPLEAKIETIVKEIYGGSKVNFSSKAQKQLKQFKENG
FTHS_STAEQ       FDVMQEP------QNFKHLYELKQPLEAKIETIVKEIYGGSKVNFSSKAQKQLKQFKENG
FTHS_BACLD       IHVMEQKD-----NRFSYLYELTDSIEDKLAKISRTVYGAEGVEFTEKAKKQLLELKKNG
FTHS_CORDI       AVSMQNQT-------SHHLYDPELGIEASLLTIAQKIYGAADVELSKQARQDLAYLQENG
FTHS_CORJK       LEVVDGVSDEDASSSSHQIYQPVDGVEATLHTLATEIYGAADVQFGPQALKDLAFLKDNG
FTHS1_LACAC      INLADSGK-----AELISTYNEDDDIKSKIKKIATKIYHADGVEYTDKAEEQIKELAKIG
FTHS_LACJO       VELTNKA------SDFTSVYEPTDSVEEKISKIAHNIYHAKDIEYSDKAKDQLAEIKKMG
FTHS2_LACAC      VKLADEE------LEFHELYKNSDSIEDKLSAIATKIYGAKRVVLSKKAKRQIKTFNEQG
FTHS_LACPL       VDLCAQP------SHFQPLSPADADLKTKINDIVTKTYGGANVEYSAKAQRQLRTFAKQG
FTHS_BACFN       VETIENKP----SEPLQFTYNDEDSVQQKIEKVATNLYGASVVTYSTLTRNKIKLIEEMG
FTHS_BACFR       VETIENKP----SEPLQFTYNDEDSVQQKIEKVATNLYGASVVTYSTLTRNKIKLIEEMG
FTHS_BACTN       VDTIENNP----SEPLRYTYKEEDSIQQKIEKVATNLYGASVITYSSIARNRIKLIEKMG
FTHS_PORGI       VEMVENKP----SQPLKYAYEPENPVKMKIEKIAKEIYSAGSVVYSSKADGKLKKIAMQS
FTHS_TREDE       VKTIETNP----SKPLKFVYEDKDSIKTKIGKICKEIYGAADVTYSGAADKMIKKIEEAG
FTHS_THEMA       AEAAKDV----EPA---YLYEMNDPVEKKIEILAKEIYRAGRVEFSDTAKNALKFIKKHG
FTHS_HALMA       IEATEES----NEEDFRMLYDDDDSIKEKIHTVATEIYGADDVKYTGGALDDIEQMNDLD
FTHS_MYCPE       IESVQEPK------PINWTYDLKDNAVNKINDLSTKVYNGATITYSDLATAKLKDNENWI
FTHS_UREPA       LTNQINDH------ELKLIYDIKDHLSYKLKKICENVYGADGYELSYEAKEQLNRYE--H
                                              :  :    *              :       

FTHS_THEAC       ENP--YVCMAKTQYSFSDDASLLNDPHGFTIKVQSINISSGAGFVVPILGEIMTMPGLPK
FTHS_THEVO       NDP--YVCMAKTQYSFSDDASLLNDPHGFKVRVQSVNISSGAGFVVPILGEIMTMPGLPK
FTHS_PICTO       SDL--YVCMAKTQSSISDNAKLINVPEGFTVKINGININSGSGFIIPLLGNIMTMPGLPR
FTHS_DEHM1       NTQFMPSCMVKTHLSLSHDPALKGRPGGFTLPIRDILTYMGAGLVVPVAGDIKLMPGTSS
FTHS_DEHMC       DTQFMPTCMVKTHLSLSHDPALKGRPSGFTLPIRDILTYMGAGLVVPVAGDIKLMPGTSS
FTHS_PHOPR       HDN-LAVCLAKTPLSITTDPGIKGAPSDFVVPVRELKLCAGAGFVYALCGNVMTMPGLPE
FTHS_VIBCH       FDH-LAVCLAKTPLSISTDPAIKGAPRDFIVPIRELRLCAGAEFVYALCGSVMTMPGLPE
FTHS_VIBVU       FGE-LAVCMAKTPLSISSDSSLKGAPSGFTIMVREVRLCAGAGFVYALTGNVMTMPGLPD
FTHS_VIBVY       FGE-LAVCMAKTPLSISSDSSLKGAPSGFTIMVREVRLCAGAGFVYALTGNVMTMPGLPD
FTHS_VIBPA       FNE-LAVCIAKTPLSVTTDSSVKGAPVGFTVPIRELRLCAGAGFVYALSGSVMTMPGLPD
FTHS_ALIF1       YQS-LSVCMAKTPASISTDGNIKGAPTDFIVPIRELKLCAGAGFIYALCGNVMTMPGLPE
FTHS_SHEON       YAH-LPVCMAKTPLSISHDPQLKGVPQGFIVPVRELVLNAGAGFITALVGNVMTMPGLGL
FTHS_CUTAK       YGT-FPVVIAKTHLSLSHDPSLKGAPTGWRLPVREVRAAVGAGYIYAICGDMRTMPGLGR
FTHS_THET2       CEA-LPVVVAKAATSLSDNPRLRGRPRGFTVRVTDLRCRLGAGFVVVYMGGIETLPGLPK
FTHS_MOOTH       YGN-LPVVMAKTQYSFSDDMTKLGRPRNFTITVREVRLSAGGRLIVPITGAIMTMPGLPK
FTHS_CALS4       LDK-MPIVVAKTQYSLSDDPKLLGRPRGFKITVRELRISRGAGFIVALTGDIMTMPGLPK
FTHS_CLOAB       LDK-LPICVAKTQYSLSDNPALLGRPTNFTINVKEVRVSNGAGFVVVQTGNIMTMPGLPK
FTHS_CLOPE       LDK-LPICMAKTQYSLSDNPSLLGRPENFDITVKEVRVSNGAGFIVVLTGDVMTMPGLPK
FTHS_CLOTE       LDK-LPICMAKTQFSFSDDATLMGAPKGFNITIKNVRVSAGAGFIVCETGNIMVMPGLPK
FTHS_FUSNN       LNK-LPVCMSKTQKSISDNPALLGKPTGFKVTINDLRLAVGAGFVIAMAGDIIDMPGLPK
FTHS_NEIMA       LDK-MPICMAKTQYSLSDNAKLLGCPEDFRIAVRGITVSAGAGFIVALCGNMMKMPGLPK
FTHS_NEIMB       LDK-MPICMAKTQYSLSDNAKLLGCPEDFRIAVRGITVSAGAGFIVALCGNMMKMPGLPK
FTHS_NEIG1       LDK-MPICMAKTQYSLSDNAKLLGCPEGFRIAVRGITVSAGAGFIVALCGNMMKMPGLPK
FTHS_HAEDU       LDK-LPICMAKTQYSLSDSAKLLGCPTGFNITVRSITVSAGAGFIVAICGSIMRMPGLPK
FTHS2_STRP8      FGN-YPICMAKTQYSFSDDAKKLGAPTDFTVTISNLKVSAGAGFIVALTGAIMTMPGLPK
FTHS2_STRPM      FGN-YPICMAKTQYSFSDDAKKLGAPTDFTVTISNLKVSAGAGFIVALTGAIMTMPGLPK
FTHS2_STRP3      FGN-YPICMAKTQYSFSDDAKKLGAPTDFTVTISNLKVSAGAGFIVALTGAIMTMPGLPK
FTHS2_STRP1      FGN-YPICMAKTQYSFSDDAKKLGAPTDFTVTISNLKVSAGAGFIVALTGAIMTMPGLPK
FTHS2_STRP6      FGN-YPICMAKTQYSFSDDAKKLGAPTDFIVTISNLKVSAGAGFIVALTGAIMTMPGLPK
FTHS_SYMTH       FGR-APVCIAKTQYSFSDDPKKLGAPTGWRLTVREVRPSAGAGFVVALTGEIMTMPGLPP
FTHS_RHILO       YGN-LPVCMAKTQYSFSTDPNLRGAPTGHTVPVREVRLSAGAGFVVIICGEVMTMPGLPK
FTHS_RHIME       YGD-LPICMAKTQYSFSTDPNLRGAPTGHAVPIREVRLAAGAGFIVVITGEIMTMPGLPK
FTHS_RUEPO       YRN-LPVCMAKTQYSFTTDPNRRGAPTGHSVPVREVRLSAGAGFIVVVCGEIMTMPGLPR
FTHS_PELUB       YGD-FPICIAKTQYSFSTDPSLKGAPTGHSLPIREIKLSSGAEFIVVICGAVMTMPGLPR
FTHS_METEA       YGG-LPVCMAKTQYSFSTDPTLMGAPSGHLVSVRDVRLSAGAGFVVVICGEIMTMPGLPK
FTHS_ZYMMO       FGD-LPVCIAKTQSSFSADPKAKNAPTGHIFPIREVRLNAGAGFIVAISGNIMTMPGLPR
FTHS_METCA       YGH-YPVCMAKTQMSFSTDPNAKGAPSGHTVAIREVRLANGAGFVVAIAGDMMTMPGLPK
FTHS_BACCZ       WSN-LPICMAKTQYSLSDDATKLGRPSDFIVTIRELKPSIGAGFIVALTGTMLTMPGLPK
FTHS_BACHK       WSN-LPICMAKTQYSLSDDATKLGRPSDFIVTIRELKPSIGAGFIVALTGTMLTMPGLPK
FTHS_BACAN       WSN-LPICMAKTQYSLSDDATKLGRPSDFIVTIRELKPSIGAGFIVALTGTMLTMPGLPK
FTHS_BACC1       WSN-LPVCMAKTQYSLSDDATKLGRPSDFIVTIRELKPSIGAGFIVALTGTMLTMPGLPK
FTHS_BACCR       WSN-LPVCMAKTQYSLSDDVTKLGRPSDFIVTIRELKPSIGAGFIVALTGTMLTMPGLPK
FTHS_LISMF       WDR-YPICMAKTQYSLSDDPTLLGRPTDFVIHIREFIPKLGAGFVVALTGDVMTMPGLPK
FTHS_LISMO       WDR-YPICMAKTQYSLSDDPTLLGRPTDFVIHIREFIPKLGAGFVVALTGDVMTMPGLPK
FTHS_LISIN       WDR-YPICMAKTQYSLSDDPTLLGRPTDFVIHIREFIPKLGAGFVVALTGDVMTMPGLPK
FTHS_STRA3       WDK-MPICMAKTQYSFSDNPNLLGAPTDFDITVREFVPKTGAGFIVALTGDVLTMPGLPK
FTHS_STRA5       WDK-MPICMAKTQYSFSDNPNLLGAPTDFDITVREFVPKTGAGFIVALTGDVLTMPGLPK
FTHS1_STRP1      WDK-LPVCMAKTQYSFSDNPSLLGAPTDFDITIREFVPKTGAGFIVGLTGDVMTMPGLPK
FTHS1_STRP3      WDK-LPVCMAKTQYSFSDNPSLLGAPTDFDITIREFVPKTGAGFIVGLTGDVMTMPGLPK
FTHS1_STRP6      WDK-LPVCMAKTQYSFSDNPSLLGAPTDFDITIREFVPKTGAGFIVGLTGDVMTMPGLPK
FTHS1_STRP8      WDK-LPVCMAKTQYSFSDNPSLLGAPTDFDITIREFVPKTGAGFIVGLTGDVMTMPGLPK
FTHS1_STRPM      WDK-LPVCMAKTQYSFSDNPSLLGAPTDFDITIREFVPKTGAGFIVGLTGDVMTMPGLPK
FTHS_STRT1       WDK-LPVCMAKTQYSFSDNQFLLGAPEGFDITIREFVPKTGAGFIVALTGDVMTMPGLPK
FTHS_STRT2       WDK-LPVCMAKTQYSFSDNQFLLGAPEGFDITIREFVPKTGAGFIVALTGDVMTMPGLPK
FTHS_STRPN       WDK-LPICMAKTQYSFSDNPNALGAPENFEITIRELVPKLGAGFIVALTGDVMTMPGLPK
FTHS_STRR6       WDK-LPICMAKTQYSFSDNPNALGAPENFEITIRELVPKLGAGFIVALTGDVMTMPGLPK
FTHS_STRMU       WDN-LPICMAKTQYSFSDDPKLLGAPTGFDITIRELVPKLGAGFIVALTGDVMTMPGLPK
FTHS_ENTFA       WDQ-LPICMAKTQYSLSDDPQKLGRPEGFTITIRELVPKIGAGFIVALTGDILTMPGLPK
FTHS_LACLA       WND-LPVCMAKTQYSFSDQPNLLAAPEGFEVTVRELLPKIGAGFIVALLGDVMTMPGLPK
FTHS_STAAM       WDN-YPVCMAKTQYSFSDDQTLLGAPSGFEITIRELEAKTGAGFIVALTGAIMTMPGLPK
FTHS_STAAN       WDN-YPVCMAKTQYSFSDDQTLLGAPSGFEITIRELEAKTGAGFIVALTGAIMTMPGLPK
FTHS_STAAR       WDN-YPVCMAKTQYSFSDDQTLLGAPSGFEITIRELEAKTGAGFIVALTGAIMTMPGLPK
FTHS_STAAS       WDN-YPVCMAKTQYSFSDDQTLLGAPSGFEITIRELEAKTGAGFIVALTGAIMTMPGLPK
FTHS_STAAW       WDN-YPVCMAKTQYSFSDDQTLLGAPSGFEITIRELEAKTGAGFIVALTGAIMTMPGLPK
FTHS_STAAC       WDN-YPVCMAKTQYSFSDDQTLLGAPSGFEITIRELEAKTGAGFIVALTGAIMTMPGLPK
FTHS_STAHJ       WGQ-YPICMAKTQYSFSDDATALGAPTDFDITIRELEAKTGAGFIVALTGAIMTMPGLPK
FTHS_STAES       WDE-YPICMAKTQYSFSDDQTLLGAPNDFEITIRELEAKTGAGFIVALTGAIMTMPGLPK
FTHS_STAEQ       WDE-YPICMAKTQYSFSDDQTLLGAPNDFEITIRELEAKTGAGFIVALTGAIMTMPGLPK
FTHS_BACLD       LDG-LPVCVAKTQYSLSDDPGKIGRPQDFSITVRELKPSRGAGFIVALTGSILTMPGLPK
FTHS_CORDI       WDR-LPVCISKTQYSFSDDPSQLGRPEGHTLHVRNLLPRIGAGFIVALTGDVMTMPGLPK
FTHS_CORJK       WDK-LPVCVSKTQYSFSDDPSALGAPSGHTLHVRELVPRIGAGFVVALTGDVMTLPGLPK
FTHS1_LACAC      KDK-LPVIIAKTQYSFSDDKKKLGAPGGFNLHVKGVSLKNGARFIVVTTGNVLDMPGLPK
FTHS_LACJO       KDN-LPVIMAKTQYSFTDKKSILGAPKDFTLHVKNLALKNGAGFIVVATGSILDMPGLPK
FTHS2_LACAC      WND-LPVCIAKTQYSFTDDQTKLGAPTDFDFHIRDLVPKLGAGFIVALSGTMMTMPGLAK
FTHS_LACPL       WDH-LPVCMAKTQYSLSDDPKRLGAPTGFTINVREFVPKLGAGFIVALTGNVLTMPGLPK
FTHS_BACFN       IGH-YPVCIAKTQYSFSADPKVYGAVDNFELHIKDIVINNGAEMIVAIAGEIMRMPGLPK
FTHS_BACFR       IGH-YPVCIAKTQYSFSADPKVYGAVDNFELHIKDIVINNGAEMIVAIAGEIMRMPGLPK
FTHS_BACTN       ITH-YPVCIAKTQYSFSADPKIYGAVNNFEFHIKDIVINNGAEMIVAIAGEILRMPGLPK
FTHS_PORGI       LDH-LPVCIAKTQYSFSSDPKAKGDVRGFELKVSDIIINRGAGMLVVIIGEIMRMPGLPK
FTHS_TREDE       MAD-FPVCVAKTQYSFSSDPKLYGVPTGFEMNVRDIVLNSGSEMIVAIMGDMMRMPGLPK
FTHS_THEMA       FDE-LPVIVAKTPKSISHDPSLRGAPEGYTFVVSDLFVSAGAGFVVALSGDINLMPGLPK
FTHS_HALMA       FDD-YPVVMSKTFHSLSDDASQKGAPEGWELEISEVYPSAGAGFLVALTADALTMPGLPA
FTHS_MYCPE       QDY--YVCGAKTPYSPSIKNEYMDTNK-HDIHVEDIEINHAVKFIIPIFSKTFLMPGLPK
FTHS_UREPA       LDF--YLCIAKTPYSISDDAKLLNNPKNFKIHIERFEINYAAKLIIAITTTIYRMPGLNK
                           *:  * : .           . :  .    .   :         :**   

FTHS_THEAC       HPAAENIDLTDS-GEITGLF-
FTHS_THEVO       RPAAENIDLAED-GEITGLF-
FTHS_PICTO       RPASENIDIDDY-GNITGLQ-
FTHS_DEHM1       DPNFRRIDIDTHTGKVKGLF-
FTHS_DEHMC       DPNFKRIDVDTQTGKVKGLF-
FTHS_PHOPR       KPAYMNLDIDAD-GNIVGLS-
FTHS_VIBCH       KPSFMALDIDQH-GNIVGLS-
FTHS_VIBVU       IPAFMALDIDEN-GDIVGLS-
FTHS_VIBVY       IPAFMALDIDEN-GDIVGLS-
FTHS_VIBPA       KPAFMNLDLDED-GNIIGLS-
FTHS_ALIF1       KPAFMNLDIDGD-GNIVGLS-
FTHS_SHEON       TPGYLKIDIDVD-GEIIGLG-
FTHS_CUTAK       HPAAERIDIDDN-GETIGLF-
FTHS_THET2       TPQAFGIDVDEE-GNIRGMDY
FTHS_MOOTH       RPAACNIDIDAD-GVITGLF-
FTHS_CALS4       HPAAENIDIDEN-GRIKGLF-
FTHS_CLOAB       TPAANKMDIFED-GSIVGLF-
FTHS_CLOPE       VPAANRMDIKDN-GEIVGLF-
FTHS_CLOTE       VPAAEKMDVDEN-GNISGLF-
FTHS_FUSNN       KPSAEVIDIDEN-GVISGLF-
FTHS_NEIMA       VPAAEKIDVDAE-GVIHGLF-
FTHS_NEIMB       VPAAEKIDVDAE-GVIHGLF-
FTHS_NEIG1       VPAAEKIDVDEH-GVIHGLF-
FTHS_HAEDU       NPATNRIDVDEN-GVISGLF-
FTHS2_STRP8      VPASETIDIDEE-GNITGLF-
FTHS2_STRPM      VPASETIDIDEE-GNITGLF-
FTHS2_STRP3      VPASETIDIDEE-GNITGLF-
FTHS2_STRP1      VPASETIDIDEE-GNITGLF-
FTHS2_STRP6      VPASETIDIDEE-GNITGLF-
FTHS_SYMTH       VPAAESIDVSDD-GEITGLF-
FTHS_RHILO       APSSEKIFLNEA-GQIEGLF-
FTHS_RHIME       VPSSERIRLNEQ-GYIEGLF-
FTHS_RUEPO       KPAAETIRLNDA-GQIEGLF-
FTHS_PELUB       VPAADSIKLNKD-GEIEGLF-
FTHS_METEA       VPAADTIRLDAN-GQIDGLF-
FTHS_ZYMMO       HPAAENIDINED-NEIIGLA-
FTHS_METCA       VPAAEHIDVDDD-GRISGLF-
FTHS_BACCZ       QPAALQMDVNED-GKAVGLF-
FTHS_BACHK       QPAALQMDVNED-GKAVGLF-
FTHS_BACAN       QPAALQMDVNED-GKAVGLF-
FTHS_BACC1       QPAALQMDVNED-GKAVGLF-
FTHS_BACCR       QPAALQMDVNED-GKAVGLF-
FTHS_LISMF       KPAALNMDVDEN-GNAQGLF-
FTHS_LISMO       KPAALNMDVDEN-GNAQGLF-
FTHS_LISIN       KPAALNMDVDEN-GNAQGLF-
FTHS_STRA3       KPAALNMDVLED-GTAIGLF-
FTHS_STRA5       KPAALNMDVLED-GTAIGLF-
FTHS1_STRP1      VPAAMAMDVAEN-GTALGLF-
FTHS1_STRP3      VPAAMAMDVAEN-GTALGLF-
FTHS1_STRP6      VPAAMAMDVAEN-GTALGLF-
FTHS1_STRP8      VPAAMAMDVAEN-GTALGLF-
FTHS1_STRPM      VPAAMAMDVAEN-GTALGLF-
FTHS_STRT1       APAALKMDVTED-GTAVGLF-
FTHS_STRT2       APAALKMDVTED-GTAVGLF-
FTHS_STRPN       RPAALNMDVESD-GTVLGLF-
FTHS_STRR6       RPAALNMDVESD-GTVLGLF-
FTHS_STRMU       KPAALNMDVAAD-GTALGLF-
FTHS_ENTFA       VPAALNMDVDET-GQASGLF-
FTHS_LACLA       NPASLKMDVTDD-GKISGLF-
FTHS_STAAM       KPAALNMDVTDD-GHAIGLF-
FTHS_STAAN       KPAALNMDVTDD-GHAIGLF-
FTHS_STAAR       KPAALNMDVTDD-GHAIGLF-
FTHS_STAAS       KPAALNMDVTDD-GHAIGLF-
FTHS_STAAW       KPAALNMDVTDD-GHAIGLF-
FTHS_STAAC       KPAALNMDVTDD-GHAIGLF-
FTHS_STAHJ       KPAALNMDVTED-GHAVGLF-
FTHS_STAES       KPAALNMDVTDD-GKAIGLF-
FTHS_STAEQ       KPAALNMDVTDD-GKAIGLF-
FTHS_BACLD       HPAALKMDVDES-GRAKGLF-
FTHS_CORDI       KPAAENIGVE-N-GEIKGLF-
FTHS_CORJK       KPAAERIDVNAQ-GVISGLF-
FTHS1_LACAC      HPAALDIDVDND-GKISGLF-
FTHS_LACJO       YPAALDIDVDNN-GKISGLF-
FTHS2_LACAC      HPAAENMDIDDN-GQIAGLF-
FTHS_LACPL       HPAALDMDISDD-GKISGLF-
FTHS_BACFN       EPQALHIDIV-D-GNIEGLS-
FTHS_BACFR       EPQALHIDIV-D-GNIEGLS-
FTHS_BACTN       EPQALHIDIV-D-GEIEGLS-
FTHS_PORGI       EPQAVHIDIV-D-GFIEGLS-
FTHS_TREDE       DPQAVRIDLV-N-GNVEGLS-
FTHS_THEMA       KPNALNMDVDDS-GNIVGVS-
FTHS_HALMA       RPAAADMDIDGD-GNISGLF-
FTHS_MYCPE       VPNAKKIKINFDKFKYE----
FTHS_UREPA       EPAAKNFVMK-----------
                  *    : :