CLUSTAL format seed alignment for MF_01547

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RLME_TREPR            ----------------------------------MGRTSEWYARHVGDSFVRTSKAWG--
A9RQI9_PHYPA          -----------------------------------MGKSKTTGKGRLDRFYYLAKEQG--
D0MRD5_PHYIT          --------------------------------------MVKRKKHDKDKYYNLARQQG--
SPB1_DICDI            ----------------------------------MGQKKKKLAKGRLDKFYYMAKEQG--
E3KB01_PUCGT          ----------------------------------MGKREKKTGKGRLDKYYRLAKEQG--
SPB1_USTMA            ---------------------------------MGKKQEKKTAKGRLDKFYWLAKEQG--
SPB1_CRYNJ            ----------------------------------MGKHDKKTGKGRLDKFYRLAKEQG--
A8N1R5_COPC7          ----------------------------------MGKGQKKTGKGRLDKYYKLAKEQG--
SPB1_YARLI            ----------------------------------MGKIQKKHGKGRLDHYYRLAKEKG--
SPB1_CANAL            ----------------------------------MGKQQKKHSKGRLDRYYYLAKEKG--
SPB1_SCHPO            ----------------------------------MGKSQKKTAKGRLDKWYKLAKEQG--
SPB1_ASPFU            -----------------------------------MAIQKKHGKGRLDKWYRLAKEKG--
G4VQU5_SCHMA          -----------------------------------MGKKIKTGKARKDKFYFLAKETG--
Q9N5N9_CAEEL          -----------------------------------MGKKVKIGKQRRDKYYKLAKEAG--
A0A1X7UGH0_AMPQE      -----------------------------------MGKKAKIGKKRKDKFYHLAKETG--
E9G6A2_DAPPU          --------------------------------------MGKKGKARQDKFYHLAKETG--
H2XWZ3_CIOIN          -----------------------------------MGKKKQVAKARKDKYYHLAKETG--
SPB1_CHICK            -----------------------------------MGKKSKVGKSRRDKFYHLAKETG--
B7P3V3_IXOSC          -----------------------------------MGKKTKIGKQRKDKFYHLAKETG--
Q7QD87_ANOGA          -----------------------------------MGKKAKVGKDRRDKFYKLAKESG--
Q9VXK5_DROME          -----------------------------------MGKKTKVGKTRKDKFYQLAKETG--
E0VIT4_PEDHC          -----------------------------------MVQKKKIGKQRKDRYYKLAKETG--
A0A088A7G6_APIME      -----------------------------------MGKKGKIGKQRKDKFYQLAKETG--
C4M6R5_ENTHI          -----------------------------------MGKEGKAGKERLDKYYHLAKQYG--
A5K2F1_PLAVS          -----------------------------------MGKKKKVGKERIDKYYKLAKSAG--
Q8IDF8_PLAF7          -----------------------------------MGKKKKVGKERIDKYYKLAKTAG--
Q4U8L6_THEAN          -----------------------------------MKTKSKTGKNRLDKYYHLAKEHG--
Q4N1B5_THEPA          -----------------------------------MKTKTKTGKNRLDKYYHLAKEHG--
G4LWM3_SCHMA          -------------------------------------------MDCTSTFRSLCKTCSSS
A0EER5_PARTE          ------------------------------------MPRKTKARSRLDKYYNLAKDQG--
Q23MN4_TETTS          -----------------------------------MPRKEKKGKTRKDVHYYMAKEYG--
MRM2_YEAST            ----------MILVYNRIRSIISSSLGRIHVRYNSNSQNRWLNRQLKDPYTKEAKVQN--
MRM2_DROME            MRLVFTGNCVFKRLLHTEIGGKYAKQQPRNLKGRSKSSQEWLTRQLADPYVEKARMMN--
A4I305_LEIIN          ----------------------------------MGVKSKKKAKTRLDAYYRLAKDQG--
K2MLU3_TRYCR          ----------------------------------MGTKSKKKAKTRLDAYYRLAKDQG--
MRM2_CAEEL            ---------------------------MFSTKKSQGNLHKYIQRQSTDEFAVKAREHN--
B9QL21_TOXGV          ------------------------------MAGGDSHRKKKTGKQRLDKFYHLAKEQG--
MRM2_SCHPO            -------------------------------MFGSKTLFSWAAKRSKDFYRKKSKIDN--
RLME_DESPS            ------------------------------------------MRKINDYYAKKAKKDN--
RLME_PICTO            -------------------------------------------MNRKDKYYIRAKREN--
RLME_THEAC            -----------------------------------------MSSDHRDQYYWRAKRDQ--
RLME_THEVO            -----------------------------------------MTGDRRDEYYWKAKKEQ--
B9T000_RICCO          ----------------------------------------MSGAGAPDFFYREAQRLG--
C1N352_MICPC          ------------------------------------MVAAGARKGLTDFYAKEAKRLG--
A5K6F5_PLAVS          --------------------------------------MGKLSKDRRDIYYRKAKENG--
Q8I365_PLAF7          --------------------------------------MGKLSKDRRDIYYRKAKESG--
RLME_PELUB            -------------------------------MKKNRISKNWINKQKRDIYVRQSQVDG--
A8B3D0_GIAIC          -----------------------------------------MSKDKRDIYYRLAKDEG--
TRM72_DROME           --------------------------------------MGRTSKDKRDIFYRLAKEQG--
A2F7C6_TRIVA          ---------------------------------------MEATASQRDTFYRAAKQEG--
Q586L7_TRYB2          --------------------------------------MGRASKDKRDIYYRKAKEEG--
A4HRN5_LEIIN          --------------------------------------MGRASKDKRDIYYRKAKEEG--
A0A0D1CBR1_USTMA      --------------------------------------MGKSTKDKRDIYYRQGKSEG--
I7MGM4_TETTS          --------------------------------------MGKFTKDKRDIYYRKAKEDC--
TRM71_DROME           --------------------------------------MGKTSKDKRDIYYRQAKDEG--
D0NU18_PHYIT          --------------------------------------MGKTSKDKRDIYYRKAKQQG--
TRM7_CAEEL            --------------------------------------MGKTSRDKRDIYYRLAKENK--
D0N6L4_PHYIT          --------------------------------------MTKSTEANRDIYYRKAKEVG--
G4VP71_SCHMA          --------------------------------------MGKSSRDKRDIYYRLAKEEG--
TRM7_DICDI            --------------------------------------MGKSSKDKRDIYYRKAKEEG--
A8J2Y5_CHLRE          --------------------------------------MGKSSKDKRDIFYRKAKEEG--
TRM7_HUMAN            --------------------------------------MGRTSKDKRDVYYRLAKENG--
TRM7_SCHPO            --------------------------------------MGRSSKDKRDAYYRLAKEQG--
I1RY63_GIBZE          --------------------------------------MGKSSKDKRDAYYRLAKEQG--
RLME_TREPA            ----------------------------------------MNVYKRADFWAKKAAAAG--
RLME_TREDE            --------------------------------------MAKNKYSEPDYWSKKAFAEN--
RLME_BDEBA            -----------------------------------------MTYNPRDHYFRKAKQEN--
RLME_DESVH            ------------------------------------------MKKYRDHYFLKAKQEN--
RLME_BORRA            ------------------------------------------MYNVFDEYSQKAKNEG--
RLME_BORAP            ---------------------------------------------MNDEYSQKAKREG--
RLME_BORBP            ------------------------------------------MYHLGDEYSQKAKREG--
RLME_BORBU            ---------------------------------------------MDDEYSKKAKREG--
MRM2_MOUSE            -------MAGHLKLVGVPLKVRRLHTAVCHYRGRTGAEHLWLTRHLKDPFVKAAKVES--
RLME_WOLTR            --------------------MLAIKTRVKTAKGRKLSSTRWLHRHLNDQYVQKTNKDS--
RLME_ANAMM            ---------------------------------------------------MLAKKHG--
RLME_RICFE            -------------MTNNLSGYRNKFVRVKTSKKRTVSSSNWLRRQLNDPYVAKARLEG--
RLME_CAUVC            ---------MVKPPAGGNEGGRGKPARLKTAYGRTPSQQAWLERQINDPFSAKARALG--
RLME_RHIME            ----------MTKSPIGGNRSGRKLGQKVKKGKLKASSRRWIERHINDPYVQRAQLEG--
RLME_BARQU            ---MKKTKKTPTGGYGGSGSHKLYQRVKKKAGTIKASSRRWLERHLNDPYVHQSKVDG--
RLME_NITWN            ---------------MAKDTTGRLHVTVKTGGKRKLSSKLWLERQLNDPYVAQAKRDG--
RLME_ZYMMO            -------------------MKTPGHQRVKTARRRTAASTRWLERQLNDPYVQKAQAEG--
RLME_RUEPO            -----------MAKNTSGRGQRDLKVKVKTARGRKLSSTRWLQRQLNDPYVKRAQAEG--
RLME_WIGBR            --------------------------------MKNMCSNWWLSEHYSDKFVKESKKCK--
RLME_BUCAP            ----------------------------MISKKKSNSSNRWLSEHFQDQYVKEAKKQK--
RLME_BUCBP            -----------------------------MSKKRSSSSNRWLNEHFKDKYVKQVHKNKSD
RLME_FRATT            -------------------------------MSKGSSTKKWLHEHTSDYYVIQANKLG--
RLME_ECOLI            ----------------------------MTGKKRSASSSRWLQEHFSDKYVQQAQKKG--
RLME_BLOFL            ------------------------------------MFIKVNTKYFIDQYALQAQNQK--
RLME_BLOPB            ----------------------------MVNSKYSMCSSGWLQKHFKDQYVKAAQRQK--
RLME_COXBU            ----------------------------------MTHSKRWLEEHEKDPYVKRAKKEG--
RLME_RALSO            -------------------------------MAKNKFNQSWLHDHINDPYVKLAQREG--
RLME_NITEU            -------------------------------MKSARTSRAWIKAHINDNFVRKANHEG--
RLME_LEGPL            -------------------------------MNRTKSSKRWLQEHFDDVYVKKAQAEG--
RLME_XANOR            ------------------------------MPSRSKSSQRWLKEHFADPYVKKARAEG--
RLME_PSYA2            ------------------------MATRIENKKLSKSSSAWMKEHIDDHYVQKAQKDG--
RLME_NEIG1            ------------------------------MAVRSKSSKAWLHEHINDQYVHMAQKDG--
RLME_AROAE            -------------------------------MKRTKTSKAWMQEHVNDPYVQRAKSEG--
RLME_METMP            ---------------------------------MGKKDKRWVLQRKNDHYYNLAKRRN--
RLME_HALSA            ------------------------------------------MGNRKDHYYNKSKQEG--
RLME_NATPD            -------------------------------------------MTRKDDYYNRAKQQG--
RLME_METTH            ------------------------------------MGKRWQAERKRDHYYRSAKKEN--
RLME_ARCFU            ------------------------------------------MKDRQDYYYWKAKKEG--
RLME_METMA            -----------------------------------------MARDRRDYYYHQAKEEG--
                                                                                  

RLME_TREPR            YRARAACKLKRLDAKY--GLMSR----Q------------------------------CD
A9RQI9_PHYPA          FRSRASFKLVQLDRKF--QFLSS----A------------------------------RS
D0MRD5_PHYIT          YRARSAFKLIQLNKKY--DFLST----A------------------------------KV
SPB1_DICDI            YRSRAAFKLIQLNKKY--NFLGT----A------------------------------KA
E3KB01_PUCGT          YRARSAFKLIQLNKRY--QFLES----A------------------------------RC
SPB1_USTMA            YRSRAAFKLVQLNKKF--NFLEK----A------------------------------RC
SPB1_CRYNJ            YRARSAFKLVHLNRKY--DLLSK----A------------------------------RC
A8N1R5_COPC7          YRARSAFKLIQLNKKY--GFLES----A------------------------------RC
SPB1_YARLI            YRARSSFKIIQINQKY-GKFLEK----S------------------------------KV
SPB1_CANAL            YRARSSFKIIQINEKY-GHFLEK----S------------------------------KV
SPB1_SCHPO            YRSRAAFKLVQLNQKY--SFLEK----A------------------------------KV
SPB1_ASPFU            YRARAAFKLIQLNKKY--GFLEK----S------------------------------KV
G4VQU5_SCHMA          FRSRAAFKLIQLNRRF--KFLNS----S------------------------------KV
Q9N5N9_CAEEL          YRSRAAFKLVQLNKRF--EFLEK----S------------------------------RA
A0A1X7UGH0_AMPQE      YRARSAFKLIQLNRKF--QFLQK----S------------------------------RV
E9G6A2_DAPPU          YRSRAAFKLLQLNRKF--EFLEK----S------------------------------RV
H2XWZ3_CIOIN          YRARSAFKLLQLNKKF--NFLQS----S------------------------------QA
SPB1_CHICK            FRSRSAFKLLQLNRKF--QFLQK----A------------------------------RA
B7P3V3_IXOSC          YRSRAAFKLIQLNRKF--EFLQK----S------------------------------RV
Q7QD87_ANOGA          YRSRAAFKLIQLNRRF--GFLQQ----S------------------------------QV
Q9VXK5_DROME          LRSRAAFKLIQLNRKF--GFLQQ----S------------------------------QV
E0VIT4_PEDHC          FRSRAAFKLLQLNRKF--GFLES----S------------------------------KV
A0A088A7G6_APIME      YRSRAAFKLIQLNRKF--EFLQK----S------------------------------RV
C4M6R5_ENTHI          YRARSAFKLVQMNKRY--DFLSS----A------------------------------HI
A5K2F1_PLAVS          YRARSAFKLIQIAQKY--NIFKD----A------------------------------NI
Q8IDF8_PLAF7          YRARSAFKLIQIAQKF--NVFKN----A------------------------------NI
Q4U8L6_THEAN          YRSRSAFKIIQLSKKF--NIFQN----C------------------------------NV
Q4N1B5_THEPA          YRSRSAFKIIQLAKKF--NIFQN----C------------------------------NV
G4LWM3_SCHMA          YRCRSAFKLLQLNDKISGGIFKP----G------------------------------DI
A0EER5_PARTE          YRSRAAFKLFQLNRKY--NFLNN----A------------------------------RT
Q23MN4_TETTS          YRSRACFKLIQINKKY--GFLEK----A------------------------------NA
MRM2_YEAST            LRSRAAFKLMQIDDKY--RLFSK----N---------------------------RTDQR
MRM2_DROME            YRCRSAFKLLEIDDKY--GILRP----G------------------------------DT
A4I305_LEIIN          YRARSAYKLIQLNRKY--DFLAK----S------------------------------RV
K2MLU3_TRYCR          FRARSAFKLIQLNRKY--DFLAK----S------------------------------RV
MRM2_CAEEL            YRARSAFKLIEINEKF--KFLKP----E------------------------------ST
B9QL21_TOXGV          YRARSAFKLLQLSQRF--RLFEK----S-----------------------------CAS
MRM2_SCHPO            FRSRAAYKLIELNSKY--RFINK----E------------------------------DV
RLME_DESPS            YPARSIYKLEEAQKKY--DIISR----G------------------------------DS
RLME_PICTO            YRSRASYKIIEINNKY--NIVSR----G------------------------------DN
RLME_THEAC            FRSRAAYKLEFLIERY--GIIKD----G------------------------------QA
RLME_THEVO            LRSRAAFKLEFLLDRY--RVVRK----G------------------------------DA
B9T000_RICCO          YVARSAFKLLQIQKQH--KLITP----G------------------------------SS
C1N352_MICPC          YVARSAFKLLELSDRF--GILRK----G------------------------------AH
A5K6F5_PLAVS          YRARSSFKLIQINEKF--GIFKLFDPQR------------CGEKEKDKIGSIYNENFCYN
Q8I365_PLAF7          YRARSSFKLIQINEKF--GILKLFKPDI------------YNCNNEKDLINIYNEHYCYN
RLME_PELUB            YRARSAYKLIEIDEKF--KIFKN----G------------------------------IS
A8B3D0_GIAIC          WRARSAYKLLQLDEQY--DLFRG----V------------------------------TR
TRM72_DROME           WRARSAFKLLQADETF--QLLEG----L------------------------------TR
A2F7C6_TRIVA          WRARSAFKLIQVADHF--RLFDN----V------------------------------TR
Q586L7_TRYB2          YRARSAYKLLQLHEEF--GILRR----E---------------------------EIRTG
A4HRN5_LEIIN          YRARSAYKLLQIHEEF--NILDP----A---------------------------EIRTG
A0A0D1CBR1_USTMA      YRARSAYKLLHLNEQY--GFLGGAEDYALDAGAASTCASSSDSANAPKTTSEKRFQTPTR
I7MGM4_TETTS          FRARSAYKLLQIDEVF--GIFEN----A------------------------------ER
TRM71_DROME           WRARSAFKLLHVDEAY--GILNG----V------------------------------QR
D0NU18_PHYIT          YRARSAFKLLQLDDKF--GLLSG----A------------------------------TR
TRM7_CAEEL            WRARSAFKLMQIDDEF--QILKG----V------------------------------RR
D0N6L4_PHYIT          FRARSAFKLLQLDEQF--DFLRN----V------------------------------QR
G4VP71_SCHMA          WRARSAYKLLQIDDEY--GIFSTENTPL------------------------------ER
TRM7_DICDI            WRARSAFKLIQIDEEY--QIFEG----V------------------------------KR
A8J2Y5_CHLRE          WRARSAYKLLQIDEAF--DIFSG----V------------------------------EH
TRM7_HUMAN            WRARSAFKLLQLDKEF--QLFQG----V------------------------------TR
TRM7_SCHPO            WRARSAFKLLQLNEQF--NLFEG----A------------------------------KR
I1RY63_GIBZE          WRARSAFKLLQLDEEF--DLFAD----V------------------------------TR
RLME_TREPA            YRARSVYKLAALDKKY--SLLSR----A------------------------------SR
RLME_TREDE            YPARSVYKLEEMNKKF--NLFSP----N------------------------------DK
RLME_BDEBA            FAARSVFKLEEIDQKF--KMFKP----G------------------------------QV
RLME_DESVH            YPARSVYKLKEIDNRF--KIFRQ----G------------------------------MK
RLME_BORRA            YLARSVYKLIEIDKKF--SLFSS----G-------------------------------N
RLME_BORAP            YLARSVYKLIEINEKF--SLFSY----G-------------------------------N
RLME_BORBP            YLARSVYKLIEINEKF--SLFSS----G-------------------------------N
RLME_BORBU            YLARSVYKLIEINEKF--SLFSS----G-------------------------------N
MRM2_MOUSE            YRCRSAFKLLEMNEKH--QILRP----G------------------------------LR
RLME_WOLTR            YRSRSAYKLIEIDNKF--KLLQA----G------------------------------QK
RLME_ANAMM            YRSRSAYKLIDIDCKF--KLLQR----G------------------------------RY
RLME_RICFE            FRSRAAYKLLEIHGKF--KLFNP----N------------------------------MK
RLME_CAUVC            YRSRAAFKISEIDDKF--HFFSK----G------------------------------AK
RLME_RHIME            YRARAAFKLLEIDEKH--KILAG----A------------------------------KR
RLME_BARQU            YRSRAAYKLIEMNERY--KFLKK----G------------------------------QK
RLME_NITWN            WRSRASFKLIEMDDKH--RFLKP----G------------------------------MT
RLME_ZYMMO            YRSRAAFKLIELDERF--SLLKN----A------------------------------RR
RLME_RUEPO            YRGRAAFKILELDEKY--RFLVP----G------------------------------AR
RLME_WIGBR            YRSRAWFKIDEIQKKN--NIIKP----G------------------------------MV
RLME_BUCAP            IRSRSWFKLEEIDKNN--RLFKP----G------------------------------MN
RLME_BUCBP            IRSRAWFKLDDIQSSN--NFLKV----G------------------------------MT
RLME_FRATT            YRSRASFKILEIQDKY--QLFKP----N------------------------------MF
RLME_ECOLI            LRSRAWFKLDEIQQSD--KLFKP----G------------------------------MT
RLME_BLOFL            LRSRSWFKLQSIDRLD--KLLKQ----G------------------------------MT
RLME_BLOPB            LRSRSWFKLDAINRID--ALFST----G------------------------------MT
RLME_COXBU            YPSRAAYKLLEIHQKY--KLFKP----S------------------------------MN
RLME_RALSO            YRARAAYKLKEIDEQD--KLIKP----G------------------------------QV
RLME_NITEU            YRSRAAYKLREIAEHD--ALFVP----G------------------------------MT
RLME_LEGPL            YRSRAVYKLKEIDDKE--SLIKP----G------------------------------MT
RLME_XANOR            MRSRAAYKLEELLQRD--RLLKP----G------------------------------MV
RLME_PSYA2            YRARAAYKLLEINEKT--NLIKK----G------------------------------MT
RLME_NEIG1            YRARAAYKLLEINEKD--KIIKP----G------------------------------TV
RLME_AROAE            YRSRAAFKLIELDDRD--RLMRS----G------------------------------MV
RLME_METMP            YRSRATYKLFQLNEKF--NLIKE----R------------------------------NV
RLME_HALSA            YRSRAAYKLQQLDDRF--DVLFG----G------------------------------AS
RLME_NATPD            YRSRAAYKLKQLDEAA--DLINE----G------------------------------DT
RLME_METTH            YRSRASYKLLQLNNKY--KLIKK----G------------------------------DR
RLME_ARCFU            YRSRAAYKLLQMNRTF--KLIRE----G------------------------------DL
RLME_METMA            YRSRASFKLKQINEKH--NVIKR----G------------------------------DS
                         *:  *:          ..                                       

RLME_TREPR            VLELGSSPGVWSQYISY------------ERRVS---------GMAWR------------
A9RQI9_PHYPA          VLDLCAAPGGWMQVCSK------------NMPVG---------SL---------------
D0MRD5_PHYIT          CIDLCAAPGGWCQVAAK------------YMPAS---------SI---------------
SPB1_DICDI            CLDLCAAPGGWMQVASK------------YMPVQ---------SL---------------
E3KB01_PUCGT          CIDLCAAPGGWLQVAAK------------WMPAN---------SL---------------
SPB1_USTMA            CIDLCAAPGGWLQVASK------------FMPAN---------SL---------------
SPB1_CRYNJ            CIDLCAAPGGWLQVAEK------------YMPKG---------SL---------------
A8N1R5_COPC7          TIDLCAAPGGWLQVASK------------YMPPN---------SL---------------
SPB1_YARLI            VIDLCAAPGSWCQVASQ------------LCPVN---------SL---------------
SPB1_CANAL            VIDLCAAPGSWCQVASQ------------LCPIN---------SL---------------
SPB1_SCHPO            IIDLCAAPGGWLQVASK------------TCKPG---------SL---------------
SPB1_ASPFU            LLDLCAAPGSWCQVAAE------------CMPTQ---------SI---------------
G4VQU5_SCHMA          LIDLCAAPGGWLQVAAK------------EMPMT---------SH---------------
Q9N5N9_CAEEL          TVDLCAAPGGWMQVASQ------------FMPVS---------SL---------------
A0A1X7UGH0_AMPQE      LIDLCAAPGGWLQVASQ------------HMPVS---------SL---------------
E9G6A2_DAPPU          VIDLCAAPGSWMQVAKQ------------HMPVS---------SL---------------
H2XWZ3_CIOIN          CVDLCAAPGGWLQVASE------------HMPMS---------SI---------------
SPB1_CHICK            LLDLCAAPGGWLQVASK------------FMPVS---------SL---------------
B7P3V3_IXOSC          LIDLCAAPGGWLQVAQK------------YMPVS---------SV---------------
Q7QD87_ANOGA          CLDLCAAPGGWMQVAKQ------------NMPVS---------SI---------------
Q9VXK5_DROME          CLDLCAAPGGWMQVAKQ------------NMPVS---------SI---------------
E0VIT4_PEDHC          LIDLCAAPGGWMQVAKQ------------NMPVS---------SV---------------
A0A088A7G6_APIME      CIDLCAAPGGWMQVARQ------------NMPVS---------SI---------------
C4M6R5_ENTHI          LIDLCAAPGGWCQVATK------------EMPVE---------SK---------------
A5K2F1_PLAVS          LIDLCAAPGGWLQVAYK------------NMKRS---------ST---------------
Q8IDF8_PLAF7          LIDLCAAPGGWLQVAYK------------NMSKQ---------ST---------------
Q4U8L6_THEAN          LVDLCAAPGGWLQVASN------------QLPVS---------ST---------------
Q4N1B5_THEPA          LVDLCAAPGGWLQVASN------------QLPVS---------ST---------------
G4LWM3_SCHMA          VVDCGAAPGSWCQVASS------------LTNCN---------NNNNNLKASNNQNKGL-
A0EER5_PARTE          VVDLCAAPGGWMQVCAQ------------IMPTS---------SI---------------
Q23MN4_TETTS          VIDLCAAPGGWLQVAAK------------FCPVT---------CT---------------
MRM2_YEAST            ILDLGYAPGAWSQVARQ------------RSSPN---------SM---------------
MRM2_DROME            VLECGAAPGSWTQVAVE------------RTNAN---------GKQERAPQGA-------
A4I305_LEIIN          LVDLCAAPGGWCQVAAQ------------HMAIG---------SK---------------
K2MLU3_TRYCR          LVDLCAAPGGWCQVAAK------------HMPVG---------SK---------------
MRM2_CAEEL            VIDIGCAPGSWLQVVVQ------------KCPN----------GY---------------
B9QL21_TOXGV          VVDLCAAPGGWLQVAAK------------HCPVA---------TT---------------
MRM2_SCHPO            VIDVGFAPGSWSQVAKK------------LVGNK---------GK---------------
RLME_DESPS            ILDLGCFPGSWSIYASE------------LAGPK---------GI---------------
RLME_PICTO            VLEFGSSPGGWTQVIEN------------ITQSV--------------------------
RLME_THEAC            VLEIGSSPGGWTQVLVD-------------HGCR--------------------------
RLME_THEVO            VIEIGSSPGGWTQVLNS-------------LARK--------------------------
B9T000_RICCO          VLDLGCAPGAWLQVACQ------------SLGPLKNG------GS---------------
C1N352_MICPC          VLDLGCHPGAWTQVACR------------ALGHPDEG------GG---------------
A5K6F5_PLAVS          VVDLCAAPGSWSQVLKNICLYNYYQMLHWESKNE---------GTPPNCVEHEKFLNDFS
Q8I365_PLAF7          IVDLCAAPGSWSQVLKNICLYNYYQILYMINKYN---------NNENIKNIQHEEFLNKF
RLME_PELUB            VIDLGASPGSWSQYISR------------TVKS----------GR---------------
A8B3D0_GIAIC          AVDLCAAPGSWSQVLSH------------KLPAD---------AI---------------
TRM72_DROME           AVDLCAAPGSWSQVLAK--------RLYEPLPPE---------EREKVK-----------
A2F7C6_TRIVA          VVDLCAAPGSWSQVCAQ------------RLSKV---------PNSA-------------
Q586L7_TRYB2          VVDLCAAPGSWSQVLSN-----------HLCGSQPGSAAEACEGDEAINSEASQRPR---
A4HRN5_LEIIN          AVDLCAAPGSWSQVLAQ------------HFKMI---------GANLTAAAEGDSLPAQT
A0A0D1CBR1_USTMA      VVDLCAAPGSWSQVLSR------------RLASVPG-------SH---------------
I7MGM4_TETTS          VIDLCAAPGSWSQVVSK------------KLTEK---------GLFKDSNGEDVR-----
TRM71_DROME           AVDLCAAPGSWSQVLSR------------KLYDT---------CETDDEKSAVK------
D0NU18_PHYIT          VVDLCAAPGGWSQVIAE------------RVPKD---------ST---------------
TRM7_CAEEL            AVDLCAAPGSWSQVLSK------------RLYEE---------DQEAK------------
D0N6L4_PHYIT          AVDLCAAPGSWSQVLSR------------KLYDA---------SNVQSVDSDDVR-----
G4VP71_SCHMA          VVDLCAAPGSWSQVLSK------------RLWES---------KSPEDQKSVK-------
TRM7_DICDI            VVDLCAAPGSWSQVLSR------------RIYGD---------GKDPDVK----------
A8J2Y5_CHLRE          AVDLCAAPGSWSQVLSR------------KLFLP---------ALRAGN-----------
TRM7_HUMAN            AVDLCAAPGSWSQVLSQ------------KIGGQ---------GSGH-------------
TRM7_SCHPO            VVDLCAAPGSWSQVLSR-----------ELLKNIDTSIAADEKPM---------------
I1RY63_GIBZE          VVDLCAAPGSWSQVLSR------VLIKGEKFGRA---------AWQDKEAKFRQQMLGIL
RLME_TREPA            VLDLGAAPGSWTQYVLG------------TAAAC---------TA---------------
RLME_TREDE            VLDLGAAPGSWTVYVLR------------FLNKE---------GR---------------
RLME_BDEBA            VLDLGASPGSWSQYASK------------MAGEK---------GR---------------
RLME_DESVH            VLDLGAAPGSWSLGAAE------------KVGPR---------GR---------------
RLME_BORRA            ILDIGASPGSFSQYAYA------------NLKN----------GV---------------
RLME_BORAP            VLDIGASPGSFSQYAYK------------KLKR----------GI---------------
RLME_BORBP            VLDIGASPGSFSQYAYK------------KLKR----------GV---------------
RLME_BORBU            VLDIGASPGSFSQYAYK------------KLKR----------GI---------------
MRM2_MOUSE            VLDCGAAPGAWSQVAVQ------------RVNAT---------GADSSSPVGF-------
RLME_WOLTR            IVDLGASPGGWSQVASQ-------------KGVK--------------------------
RLME_ANAMM            VLDLGSCPGGWAQVAAE------------RVAEG---------GKAH-------------
RLME_RICFE            IVDLGAAPGGWSQVASK------------LIKAS---------DNSLNNK----------
RLME_CAUVC            VIDLGCAPGGWLQIAVE------------RGVTT--------------------------
RLME_RHIME            IIDLGAAPGSWSQIAAK------------VTNST---------DADPR------------
RLME_BARQU            IIDLGAAPGGWCQVAQR------------IVGSS---------DEKPS------------
RLME_NITWN            VVDLGAAPGGWSQVAAK------------RVGAAEGK------GR---------------
RLME_ZYMMO            IIDLGIAPGGWSQVARK------------KAPQ----------AK---------------
RLME_RUEPO            VVDLGCAPGGWCQVAVK------------RVNAL---------GERSDKRVGR-------
RLME_WIGBR            VLDIGSSPGGWSKYSSQ------------KVGMS---------GK---------------
RLME_BUCAP            VLDLGSSPGGWSQYAAK------------KIGKK---------GY---------------
RLME_BUCBP            VVDLGSSPGSWSGYAVK------------RVGKK---------GR---------------
RLME_FRATT            VVDLGAAPGGWSEQVIK------------YIGKN---------GK---------------
RLME_ECOLI            VVDLGAAPGGWSQYVVT------------QIGGK---------GR---------------
RLME_BLOFL            VIDLGSTPGGWSSYVIK------------QISNL---------GT---------------
RLME_BLOPB            VIDLGSAPGGWALYVKS------------KIGKT---------GR---------------
RLME_COXBU            VIDLGAAPGGWSQVAKD------------LVGPK---------GV---------------
RLME_RALSO            IVDLGAAPGSWSQYVRN------------KLAASPRAKDGRIDGA---------------
RLME_NITEU            VVDLGAVPGSWSQVALE------------SVGPT---------GK---------------
RLME_LEGPL            VVDLGASPGGWTQYASE------------KMKGS---------GR---------------
RLME_XANOR            VVDLGAAPGGWSQQVRK------------SMGDS---------GR---------------
RLME_PSYA2            VVDLGSAPGSWSQVAGQ------------LVGEK---------GI---------------
RLME_NEIG1            LADLGSAPGSWSQVAAK------------LTGTS---------GA---------------
RLME_AROAE            VVDLGAAPGSWSQVALR------------RVGRE---------GR---------------
RLME_METMP            VVDLGCAPGGWLQAARD------------IVGED---------GF---------------
RLME_HALSA            VVDLGAAPGGWLQVAAE------------RAGAR---------GK---------------
RLME_NATPD            VVDLGAAPGGWLQVANE------------LAGEA---------GT---------------
RLME_METTH            VLDLGAAPGGWSQVALD------------KVGEE---------GL---------------
RLME_ARCFU            VLDLGATPGGWSQVAA-------------LLGAR--------------------------
RLME_METMA            VVDLGAAPGGWLQVAKQ------------LSGGK--------------------------
                        :    ** :                                                 

RLME_TREPR            ----------------------------TVSVDTRAMV--RVR---GVSFIH-GDITEAE
A9RQI9_PHYPA          ----------------------------IIGIDLVPIR--PIR---GCVTLQ-EDITTPQ
D0MRD5_PHYIT          ----------------------------ILGIDLLPIR--PIR---GVKTFQ-CDITTVR
SPB1_DICDI            ----------------------------IVGVDLVPIR--QVR---NCIGLT-EDITTQK
E3KB01_PUCGT          ----------------------------ILGVDLVPIK--PIP---KVVTAT-EDIRTQS
SPB1_USTMA            ----------------------------IVGVDLVPIK--PIP---RTITFA-EDINSYK
SPB1_CRYNJ            ----------------------------IIGVDLNAIK--PLP---HVTTFV-ADITTPH
A8N1R5_COPC7          ----------------------------IIGVDLVPIK--PIP---RVITFA-SDITTTQ
SPB1_YARLI            ----------------------------IIGCDIVPIK--PLP---NVITFQ-SDITTDH
SPB1_CANAL            ----------------------------IIGVDIVPIK--PLP---NVITFQ-SDITTED
SPB1_SCHPO            ----------------------------IVGVDLAPIK--PIP---NCHTFV-EDITSDK
SPB1_ASPFU            ----------------------------IIGVDLAPIK--PIP---RVITFQ-SDITTEK
G4VQU5_SCHMA          ----------------------------IIGVDLVPIH--PIP---KVKTFV-ADITTDK
Q9N5N9_CAEEL          ----------------------------IVGVDLAPIK--PIK---NCIALQ-GDITTNE
A0A1X7UGH0_AMPQE      ----------------------------IIGVDLVSIK--PIP---NAITIQ-ADITTPN
E9G6A2_DAPPU          ----------------------------IIGIDLFPMK--PIQ---GCLTLQ-EDITTEK
H2XWZ3_CIOIN          ----------------------------IVGVDLVPIR--PVP---KCVTFQ-DDITKES
SPB1_CHICK            ----------------------------VIGVDLVPIK--PIP---NVVTLQ-EDITTEK
B7P3V3_IXOSC          ----------------------------IVGVDLVPIR--AIP---NVITIQ-DDITTGS
Q7QD87_ANOGA          ----------------------------VIGVDLYPIK--NVP---GCISLI-GDITSDK
Q9VXK5_DROME          ----------------------------VIGVDLFPIR--PIA---GCIGLV-EDITTEK
E0VIT4_PEDHC          ----------------------------IVGVDLFPIK--PIP---GCISLV-EDITTSK
A0A088A7G6_APIME      ----------------------------VIGVDLFPIK--PIP---GCISLI-EDITTDK
C4M6R5_ENTHI          ----------------------------IFGVDLEPIL--PIP---RCTTYV-GDITTGM
A5K2F1_PLAVS          ----------------------------IIGVDLVPIR--KID--NNVITLK-CDITTGA
Q8IDF8_PLAF7          ----------------------------IIGVDLVPIR--KID--DNVITIK-SDITTSD
Q4U8L6_THEAN          ----------------------------IIGVDLVPIK--PIK---GVTTFQ-ADIRTPK
Q4N1B5_THEPA          ----------------------------IIGVDLVPIK--PIK---GVITFQ-ADIRTPK
G4LWM3_SCHMA          ----------------------------VIAFDLLNFA--PLP---GVITHCGVDLNNWS
A0EER5_PARTE          ----------------------------IIGLDLVHIK--PIP---GCKAFT-QDITTPQ
Q23MN4_TETTS          ----------------------------KIGLDLVPIK--PIP---GVKTYV-QDITAPV
MRM2_YEAST            ----------------------------ILGVDILPCE--PPH---GVNSIQ-ANILAKR
MRM2_DROME            ----------------------------VFSIDLLHFH--AVP---GATIFGGMDFTSSL
A4I305_LEIIN          ----------------------------IVGVDLVPIA--PIR---GVKTFV-GDITDDK
K2MLU3_TRYCR          ----------------------------IVGVDLVPIA--PIR---GVKTFV-GDITDDK
MRM2_CAEEL            ----------------------------ASGVDLQNVL--PIR---GADILSLSDITDPA
B9QL21_TOXGV          ----------------------------IVGVDLVPIS--PIR---GVQTFT-GDITTPQ
MRM2_SCHPO            ----------------------------VIGIDIQHIA--PPE---GVLPIY-GDIRDPN
RLME_DESPS            ----------------------------VVGVDLQQAVGGGRADAAPIHWIC-EDIREPA
RLME_PICTO            ----------------------------IIAVDINRMD--PVK---NTVFIK-MNIFDDD
RLME_THEAC            ----------------------------VVAVDIQPMD--EIP---GVIFLK-LNILRED
RLME_THEVO            ----------------------------IISIDLQEME--EIA---GVRFIR-CDIFKET
B9T000_RICCO          ----------------------------VVGIDLKKVKVPNPYCDARVKTVC-ADVMNLP
C1N352_MICPC          ----------------------------VLGVDLRETELGTLRHVDRRARFAVADATTL-
A5K6F5_PLAVS          LYINFNDELEKRIESLAKNNFVKMPK--IIAVDLQEIG--NMK---YVQIIQ-GDITKAS
Q8I365_PLAF7          SLYINYNEELENKIKNLKIKCSNIKEPNIVAVDLQEIG--NMN---YVKIIQ-GDITKMS
RLME_PELUB            ----------------------------LVSIDLKGME--EIE---NTIQIK-GDFTDLE
A8B3D0_GIAIC          ----------------------------IISVDLAPMA--PLP---RVTQIQ-GDITRKE
TRM72_DROME           ----------------------------IIAVDLQGMA--PIE---GVKQLR-ADISKES
A2F7C6_TRIVA          ----------------------------IVAVDLQPMA--PIP---GVIQIR-GDITSKE
Q586L7_TRYB2          ----------------------------IVAVDLQEMM--PID---GVQLLQ-GDITSEW
A4HRN5_LEIIN          PR--------------------------VVAVDLQEMA--PID---GVTLLQ-GDITSEV
A0A0D1CBR1_USTMA      ----------------------------LVAVDLQAMA--PLP---GVTQII-GDITTPA
I7MGM4_TETTS          ----------------------------IISIDLQEMA--PID---NVVQLQ-GDITKKE
TRM71_DROME           ----------------------------IIAVDLQAMA--PIR---GILQLQ-GDITKQS
D0NU18_PHYIT          ----------------------------IIAVDLMEMA--PLD---GVVQLK-GDITHKA
TRM7_CAEEL            ----------------------------IVAIDLQPMA--PIP---GVIQLQ-GDITSVD
D0N6L4_PHYIT          ----------------------------IMSVDLQEMA--PIA---GVQLLQ-GDITSKR
G4VP71_SCHMA          ----------------------------IVAVDLQAMA--PIP---GVIQIQ-GDITSQD
TRM7_DICDI            ----------------------------IVAVDLQEMA--PLK---GVVQIK-GDITKYE
A8J2Y5_CHLRE          -----------------------PNPPTIVAVDLQPMA--PIE---GVVQLQ-GDITSEA
TRM7_HUMAN            ----------------------------VVAVDLQAMA--PLP---GVVQIQ-GDITQLS
TRM7_SCHPO            ----------------------------IVAVDLQPMA--PID---GVCTLQ-LDITHPN
I1RY63_GIBZE          PKDGDDEQQTTEIQQNEEEPAKPREDVKIVSIDLQPIS--PLA---GITTLR-ADITHPA
RLME_TREPA            ----------------------------VCAVDVQPIA--SDIQDARLQRVQ-GDLCAAD
RLME_TREDE            ----------------------------VTAVDLKPLD--SSVYDERLNFFQ-GDMFDKG
RLME_BDEBA            ----------------------------VLGVDLSPVTV-KLK---NAVFIQ-ADLRDLN
RLME_DESVH            ----------------------------VLACDLQETDTVFPD---NVTFMQ-ENVFERS
RLME_BORRA            ----------------------------LVAVDLNDVNLNFTS---NFYFIK-GNIYLDE
RLME_BORAP            ----------------------------LVAVDINDIGLRHVD---NFYFVK-GDIFSDD
RLME_BORBP            ----------------------------LVSVDINDISLRYVN---NFYFIK-GDIFSDD
RLME_BORBU            ----------------------------LVSVDINDIG---LRYDDNFYFIK-GDIFLDD
MRM2_MOUSE            ----------------------------VLGVDLLHIF--PLA---GATFLCPADVTDPR
RLME_WOLTR            ----------------------------VVAIDIKPVN--TIS---GVKYIQ-YDINELE
RLME_ANAMM            ----------------------------VVAVDMAPME--RIP---NVDFVQ-CDVEH--
RLME_RICFE            ----------------------------IISIDLLEIE--PIA---EVEFFQ-KDFFEEN
RLME_CAUVC            ----------------------------LAGIDLLPVD--PVA---PAHLLE-MDFTADG
RLME_RHIME            ----------------------------VAAIDFLEMD--PIP---GVRFLQ-MDFLDPE
RLME_BARQU            ----------------------------VVGIDYLPVV--PLP---GVIMLE-MDFLHTD
RLME_NITWN            ----------------------------VIAIDLLEMP--EIV---GVTFAR-LDFLDDS
RLME_ZYMMO            ----------------------------IVGIDLLEAA--PIE---GVTIFQ-NDFTDPE
RLME_RUEPO            ----------------------------VLGIDLQEVE--PIA---GAEIHQ-LDFLDDG
RLME_WIGBR            ----------------------------VIACDIDLMN--PIP---NVSFIL-GNIFEKI
RLME_BUCAP            ----------------------------ILACDILPMK--KIK---GVDFFQ-GDFCNKK
RLME_BUCBP            ----------------------------VIACDMRPML--PIK---DVVFFQ-GNIKNKC
RLME_FRATT            ----------------------------LIALDLLEMA--PIA---GVEFIQ-GDFSSDE
RLME_ECOLI            ----------------------------IIACDLLPMD--PIV---GVDFLQ-GDFRDEL
RLME_BLOFL            ----------------------------IVSCDILPMK--KIA---GVKFLQ-GDCSNIN
RLME_BLOPB            ----------------------------IVACDILSMR--NIS---GVNFLK-GDCSNPN
RLME_COXBU            ----------------------------VIAIDLLPMQ--SML---DVIFIQ-GDFNEPE
RLME_RALSO            ----------------------------IVAIDILPME--PVA---DVTFIQ-GDFREES
RLME_NITEU            ----------------------------VFALDMLDMQ--PLP---GMTFIQ-GDFRENE
RLME_LEGPL            ----------------------------LVALDILPMD--ALP---NVEFIL-GDFREDN
RLME_XANOR            ----------------------------VVALDILDMP--ALA---GVEFLH-GDFREQA
RLME_PSYA2            ----------------------------LIASDILPMD--TLP---DVTFIQ-GDFREPE
RLME_NEIG1            ----------------------------VFALDILPME--AIG---GVSFIQ-GDFREND
RLME_AROAE            ----------------------------VFALDLLPLD--PLG---GVEFIQ-GDFQEEP
RLME_METMP            ----------------------------IVGIDLQTVK--PLPHD-NIIAIK-GDMTKEE
RLME_HALSA            ----------------------------VVGVDFQSIT--QFETDAGLETVR-GDMTEDE
RLME_NATPD            ----------------------------VVGVDLQRID--PIE---GVETVR-GDMTEDA
RLME_METTH            ----------------------------VVAVDLQRIKGFPAE---NFRAIR-GDFTDPE
RLME_ARCFU            ----------------------------VVAVDINPMK--PLE---NVTFIR-GDITLPE
RLME_METMA            ----------------------------VLGVDLQRID--PIE---GVETIQ-GDINAES
                                                    . *                     :     

RLME_TREPR            -TMAEVSSRL--------------------------------------------------
A9RQI9_PHYPA          -CRAAIKKVL--------------------------------------------------
D0MRD5_PHYIT          -CRQIIKQEM--------------------------------------------------
SPB1_DICDI            -CRTEIKKAL--------------------------------------------------
E3KB01_PUCGT          -CRMWLRSEL--------------------------------------------------
SPB1_USTMA            -CRDQLRQIL--------------------------------------------------
SPB1_CRYNJ            -CRQTLRQHM--------------------------------------------------
A8N1R5_COPC7          -CRNYLRGEM--------------------------------------------------
SPB1_YARLI            -CRQQLRQYM--------------------------------------------------
SPB1_CANAL            -CRSRLRGHM--------------------------------------------------
SPB1_SCHPO            -CRSQLRGYL--------------------------------------------------
SPB1_ASPFU            -CRATIRQHL--------------------------------------------------
G4VQU5_SCHMA          -CKQILRSEL--------------------------------------------------
Q9N5N9_CAEEL          -TRAAIKKEL--------------------------------------------------
A0A1X7UGH0_AMPQE      -CRHLIQKEL--------------------------------------------------
E9G6A2_DAPPU          -CYQSLKKEL--------------------------------------------------
H2XWZ3_CIOIN          -CRTQLRREL--------------------------------------------------
SPB1_CHICK            -CRQALRKEL--------------------------------------------------
B7P3V3_IXOSC          -CRFKLKKEL--------------------------------------------------
Q7QD87_ANOGA          -TKADLAKEL--------------------------------------------------
Q9VXK5_DROME          -CRQSLTKEL--------------------------------------------------
E0VIT4_PEDHC          -CKSSLTKAL--------------------------------------------------
A0A088A7G6_APIME      -CRVSITREL--------------------------------------------------
C4M6R5_ENTHI          -CFAEMKKLM--------------------------------------------------
A5K2F1_PLAVS          -CIKQIKNII--------------------------------------------------
Q8IDF8_PLAF7          -CIKKIKNII--------------------------------------------------
Q4U8L6_THEAN          -CLSLITNHL--------------------------------------------------
Q4N1B5_THEPA          -CHSLITNQL--------------------------------------------------
G4LWM3_SCHMA          ECINLINQSI--------------------------------------------------
A0EER5_PARTE          -CVQLLKKEI--------------------------------------------------
Q23MN4_TETTS          -TYQLLKREL--------------------------------------------------
MRM2_YEAST            -THDLIRLFF------------------------------SKHFQLNRHDDLHKDHGYFQ
MRM2_DROME            -AQKRLREAL--------------------------------------------------
A4I305_LEIIN          -TRKMIVTYL--------------------------------------------------
K2MLU3_TRYCR          -TRKMIVTYL--------------------------------------------------
MRM2_CAEEL            -VKLKIREKL--------------------------------------------------
B9QL21_TOXGV          -CAAKLRKLV--------------------------------------------------
MRM2_SCHPO            -TLTKLFEAL--------------------------------------------------
RLME_DESPS            -MLEAVRRIR-------------------------------P------------------
RLME_PICTO            -IFKSIDHAM--------------------------------------------------
RLME_THEAC            -AAERIREEM--------------------------------------------------
RLME_THEVO            -IFDDIDRAL--------------------------------------------------
B9T000_RICCO          --RDQVRALS--------------------------------------------------
C1N352_MICPC          -CEKRLRALR--------------------------------------------------
A5K6F5_PLAVS          -TVHQILRCM--------------------------------------------------
Q8I365_PLAF7          -TIDKILKCM--------------------------------------------------
RLME_PELUB            -SQEKIKALF--------------------------------------------------
A8B3D0_GIAIC          -VADKIIELC--------------------------------------------------
TRM72_DROME           -TAEAIIEFF--------------------------------------------------
A2F7C6_TRIVA          -TAQQVIDAM--------------------------------------------------
Q586L7_TRYB2          -TAREIIRLLNGDSSSVPECSDATALSTAGAINDFNNGRGNNVSEEGKSSQQRSDCGVGL
A4HRN5_LEIIN          -TAREIIRLL--------------------------------------------------
A0A0D1CBR1_USTMA      -TADAVSTAL--------------------------------------------------
I7MGM4_TETTS          -TVDEILHKF--------------------------------------------------
TRM71_DROME           -TAEAIIGHF--------------------------------------------------
D0NU18_PHYIT          -TADEIVAQF--------------------------------------------------
TRM7_CAEEL            -TANQVIKHF--------------------------------------------------
D0N6L4_PHYIT          -TAEQIISHF--------------------------------------------------
G4VP71_SCHMA          -TAQQIIKHF--------------------------------------------------
TRM7_DICDI            -TSKQIISHF--------------------------------------------------
A8J2Y5_CHLRE          -TAKQVISHF--------------------------------------------------
TRM7_HUMAN            -TAKEIIQHF--------------------------------------------------
TRM7_SCHPO            -TLSIILSHF--------------------------------------------------
I1RY63_GIBZE          -TVPLLLSAL--------------------------------------------------
RLME_TREPA            -TRARVACNA--------------------------------------------------
RLME_TREDE            -IIKSVKELG--------------------------------------------------
RLME_BDEBA            -LEDIFKEHG--------------------------------------------------
RLME_DESVH            EAFENLLDEI--------------------------------------------------
RLME_BORRA            -VYQKIKIFS--------------------------------------------------
RLME_BORAP            -TVFKINTLG--------------------------------------------------
RLME_BORBP            -TASKINKFG--------------------------------------------------
RLME_BORBU            -TVFKINTFK--------------------------------------------------
MRM2_MOUSE            -TFQKILELL--------------------------------------------------
RLME_WOLTR            ----TLRERF--------------------------------------------------
RLME_ANAMM            -SPELLRAAL--------------------------------------------------
RLME_RICFE            -TEELIIQAL--------------------------------------------------
RLME_CAUVC            -APEKLLELL--------------------------------------------------
RLME_RHIME            -APENLKQAI--------------------------------------------------
RLME_BARQU            -APQKLIDAL--------------------------------------------------
RLME_NITWN            -APDKLLAMM--------------------------------------------------
RLME_ZYMMO            -AQKKLIEAL--------------------------------------------------
RLME_RUEPO            -ADDRIKEWL--------------------------------------------------
RLME_WIGBR            -TIKKIKKVK--------------------------------------------------
RLME_BUCAP            -TLNLILTNL--------------------------------------------------
RLME_BUCBP            -FFNFIETYL--------------------------------------------------
RLME_FRATT            -TYQKLNTLV--------------------------------------------------
RLME_ECOLI            -VMKALLERV--------------------------------------------------
RLME_BLOFL            -FLNEIDLKI--------------------------------------------------
RLME_BLOPB            -ISKILYKWV--------------------------------------------------
RLME_COXBU            -IFNQLEAIV--------------------------------------------------
RLME_RALSO            -VFQQLETIV--------------------------------------------------
RLME_NITEU            -VLAMLEAAL--------------------------------------------------
RLME_LEGPL            -VLQELINLI--------------------------------------------------
RLME_XANOR            -VLSQFEAML--------------------------------------------------
RLME_PSYA2            -VFDHIMAEV--------------------------------------------------
RLME_NEIG1            -VLAQFETLL--------------------------------------------------
RLME_AROAE            -VLAELESRL--------------------------------------------------
RLME_METMP            -ILKQAKDLL--------------------------------------------------
RLME_HALSA            -TRQRVRDAA--------------------------------------------------
RLME_NATPD            -TREKVRALV--------------------------------------------------
RLME_METTH            -VKDKIIREL--------------------------------------------------
RLME_ARCFU            -TLEKIREIS--------------------------------------------------
RLME_METMA            -TIKKIIKIV--------------------------------------------------
                                                                                  

RLME_TREPR            --------------------------------------PSG------VGLILSDIC---P
A9RQI9_PHYPA          --------------------------------------KEKKHD--MVQVVLHDGS---P
D0MRD5_PHYIT          --------------------------------------QSW-----QADVVLCDGA---P
SPB1_DICDI            --------------------------------------KTW-----KVDVCLHDGA---P
E3KB01_PUCGT          --------------------------------------KDW-----KADVVLHDGA---P
SPB1_USTMA            --------------------------------------KDW-----KADIVIHDGA---P
SPB1_CRYNJ            --------------------------------------HDW-----KADLVLHDGA---P
A8N1R5_COPC7          --------------------------------------KDW-----KADVVLHDGA---P
SPB1_YARLI            --------------------------------------KTW-----KADTVMHDGA---P
SPB1_CANAL            --------------------------------------KTW-----KADTVLHDGA---P
SPB1_SCHPO            --------------------------------------KTW-----KADVVLHDGA---P
SPB1_ASPFU            --------------------------------------KHW-----KADTVLHDGA---P
G4VQU5_SCHMA          --------------------------------------NDL-----KADVVLHDGA---P
Q9N5N9_CAEEL          --------------------------------------KTW-----SADCVLHDGA---P
A0A1X7UGH0_AMPQE      --------------------------------------KTW-----KVDCVLNDGA---P
E9G6A2_DAPPU          --------------------------------------TTW-----KADVVLHDGA---P
H2XWZ3_CIOIN          --------------------------------------HKW-----KVDCFLHDGA---P
SPB1_CHICK            --------------------------------------QTW-----KVDVVLNDGA---P
B7P3V3_IXOSC          --------------------------------------KTW-----KADIVLNDGA---P
Q7QD87_ANOGA          --------------------------------------KTW-----KVDVVLNDGA---P
Q9VXK5_DROME          --------------------------------------QSW-----KADVVLHDGA---P
E0VIT4_PEDHC          --------------------------------------QTW-----KADVVLHDGA---P
A0A088A7G6_APIME      --------------------------------------KTW-----KADVVLHDGA---P
C4M6R5_ENTHI          --------------------------------------KGE-----HADVVLHDGS---P
A5K2F1_PLAVS          --------------------------------------KNE-----KADVILNDGA---P
Q8IDF8_PLAF7          --------------------------------------KMD-----KADVILNDGA---P
Q4U8L6_THEAN          --------------------------------------NGM-----NVDVVLHDGS---P
Q4N1B5_THEPA          --------------------------------------NGL-----SVDVVLHDGS---P
G4LWM3_SCHMA          ------------------------------SSHFNNNNNND-----GVDVVLSDIA---P
A0EER5_PARTE          --------------------------------------P-Q-----KADVFLHDGA---P
Q23MN4_TETTS          --------------------------------------KGG-----KADVVLNDGA---P
MRM2_YEAST            NMLEEELTHVKDTELYREIFTSDDIYETPNTNSTLIEREKF-----PVDVIISDMYEPWP
MRM2_DROME            --------------------------------------QDR-----KVNCVLSDMA---P
A4I305_LEIIN          --------------------------------------KKE-----PVDCVIHDGA---P
K2MLU3_TRYCR          --------------------------------------KKE-----PVDCVIHDGA---P
MRM2_CAEEL            --------------------------------------AHR-----QVDVVLSDMA---P
B9QL21_TOXGV          --------------------------------------KFG-----EVDLVLHDGS---P
MRM2_SCHPO            -------------------------------RLLHEPNTNDSIDCRVVDAVISDML---H
RLME_DESPS            ----------------------------------------------SFRVLISDMA---P
RLME_PICTO            --------------------------------------AENNIK--NFDSILSDAM---S
RLME_THEAC            --------------------------------------ARSLVQ--RFDVVLSDAM---A
RLME_THEVO            --------------------------------------REEGIE--KVDDVVSDAM---A
B9T000_RICCO          -------------------------------------LQQK-----GFSVVLSDMC---P
C1N352_MICPC          ------------------GGDGDGDGDGDGDESIATRRRTR-----PFTVVLSDMA---P
A5K6F5_PLAVS          ------------------RDGTSADDTVLGSAQLDEQNSQRNNSPTYAHAVVSDGA---P
Q8I365_PLAF7          -------------------NNKINSDEENVNVFYNMEQQKKENNFSYAHTVVSDGA---P
RLME_PELUB            --------------------------------------KS------KVDVVVSDMA---V
A8B3D0_GIAIC          --------------------------------------HGE-----MCQLVVCDGA---P
TRM72_DROME           --------------------------------------GGE-----KAQIVVSDGA---P
A2F7C6_TRIVA          --------------------------------------NGK-----KADLVISDGA---P
Q586L7_TRYB2          MNERNNASECVDGDNNNNNSNNNDDRNGGDAGASTRPVAGR-----KADLVVCDGA---P
A4HRN5_LEIIN          ---------NAPTPTGVALTDDEQQQPANSSFSSPAPSPALGASPRKADIVLCDGA---P
A0A0D1CBR1_USTMA      ---------------------------SDGPLSNSTCVKGKGKGKARAQLIVCDGA---P
I7MGM4_TETTS          --------------------------------------KGN-----KANLVIDDGA---P
TRM71_DROME           -------------------------G------------GNE-----KAQLVVCDGA---P
D0NU18_PHYIT          --------------------------------------RGQ-----KAQVVVSDGA---P
TRM7_CAEEL            --------------------------------------SGE-----KSDIVICDGA---P
D0N6L4_PHYIT          --------------------------------------HGA-----KAQVVVSDGA---P
G4VP71_SCHMA          --------------------------------------DGK-----LAQLVVCDGA---P
TRM7_DICDI            --------------------------------------DGS-----LADLIISDGA---P
A8J2Y5_CHLRE          --------------------------------------HGQ-----PADLVVCDGA---P
TRM7_HUMAN            --------------------------------------KGC-----PADLVVCDGA---P
TRM7_SCHPO            --------------------------------------GNE-----PADLVVSDGA---P
I1RY63_GIBZE          --------------------------DSSYDPKAAGTQASH-----PVDLVLSDGA---P
RLME_TREPA            ----------------------------------------------PFDLILSDAA---P
RLME_TREDE            ----------------------------------------------PYDAVICDAA---P
RLME_BDEBA            --------------------------------------FVP-----PFDIVMSDMA---P
RLME_DESVH            ---------------------------------------------APFDVVISDMA---P
RLME_BORRA            ----------------------------------------------PYSLIVSDAA---P
RLME_BORAP            ----------------------------------------------PYSLVISDAA---P
RLME_BORBP            ----------------------------------------------PYSLVISDVA---P
RLME_BORBU            ----------------------------------------------PYSLVISDVA---P
MRM2_MOUSE            --------------------------------------PSR-----RADVILSDMA---P
RLME_WOLTR            --------------------------------------KDQ-----KFDVILSDMA---P
RLME_ANAMM            --------------------------------------QDR-----KFDVVLSDMA---P
RLME_RICFE            ---------------------------------------DG-----KADIVMSDMA---S
RLME_CAUVC            ---------------------------------------GG-----EPDLVMSDMA---P
RLME_RHIME            ---------------------------------------GG-----APDIVLSDMA---A
RLME_BARQU            ---------------------------------------GT-----KPDVVLSDMA---A
RLME_NITWN            ---------------------------------------DG-----AADVVLSDMA---A
RLME_ZYMMO            ---------------------------------------GG-----AADLVLSDMA---A
RLME_RUEPO            ---------------------------------------GG-----KADVVMSDMA---A
RLME_WIGBR            --------------------------------------KKV-------HIILCDIS---P
RLME_BUCAP            --------------------------------------SNV-----NLNLIMSDMA---P
RLME_BUCBP            --------------------------------------CHK-----KVHVIISDMA---P
RLME_FRATT            --------------------------------------NNQ-----KIDCVISDMA---P
RLME_ECOLI            --------------------------------------GDS-----KVQVVMSDMA---P
RLME_BLOFL            --------------------------------------KHK-----RAQVVLSDMS---P
RLME_BLOPB            --------------------------------------GQK-----QVNVVLSDMA---P
RLME_COXBU            ------------------------------AKKT----LTG-----QVDLVISDMA---P
RLME_RALSO            ----------------------------------LDATGGG-----KVDLVLSDMA---P
RLME_NITEU            --------------------------------------GGK-----RADLVISDMS---P
RLME_LEGPL            --------------------------------------PQR-----TLDLLLSDMA---P
RLME_XANOR            --------------------------------------GDV-----PVDLVLSDMA---P
RLME_PSYA2            --------------------------------------GDR-----QVDVVLSDMA---P
RLME_NEIG1            --------------------------------------DNR-----PLDLVICDMA---P
RLME_AROAE            --------------------------------------GGL-----PVDVVLSDMA---P
RLME_METMP            --------------------------------------PEK-----P-DVIICDAS---P
RLME_HALSA            --------------------------------------NGS------ADVVVSDMA---P
RLME_NATPD            --------------------------------------GEA-------DVVISDMA---P
RLME_METTH            ---------------------------------------GG-----RADVVISDAA---P
RLME_ARCFU            --------------------------------------PDY-------DVVMSDAS---P
RLME_METMA            --------------------------------------GEK-----GADVVLCDAA---P
                                                                         : *      

RLME_TREPR            HPSCERYL------------------DSIATAKVAETLLMVSR-----------------
A9RQI9_PHYPA          NVGGAWSS------------------ESSAQTALVLDSLKLAT-----------------
D0MRD5_PHYIT          NVGTEYSK------------------DAYVQNELALIALKLAV-----------------
SPB1_DICDI            NMGTSWVQ------------------DAYQQAELTLHALKLAT-----------------
E3KB01_PUCGT          NVGTAWVQ------------------DAFSQSELVLHSLKLAT-----------------
SPB1_USTMA            NVGTAWVQ------------------DAYAQSELTLQSLRLAV-----------------
SPB1_CRYNJ            NVGSAWVQ------------------DAFTQNELVLQSLKLAT-----------------
A8N1R5_COPC7          NVGTAWVQ------------------DAYSQSELVLMSLKLAV-----------------
SPB1_YARLI            NVGMAWAQ------------------DAFTQSELVLQSLKLAV-----------------
SPB1_CANAL            NVGLGWVQ------------------DAFTQSQLTLQALKLAV-----------------
SPB1_SCHPO            NVGSAWLQ------------------DAYGQAQLVLMSMKLAC-----------------
SPB1_ASPFU            NVGTAWVQ------------------DAFSQAELVLQSMKLAT-----------------
G4VQU5_SCHMA          NVGAAWSI------------------DEYTQAVLSLNSFAIAT-----------------
Q9N5N9_CAEEL          NVGLNWVH------------------DAFQQNCLTLSALKLAT-----------------
A0A1X7UGH0_AMPQE      NVGSAWIQ------------------DAFSQARLTLSALKLAT-----------------
E9G6A2_DAPPU          NVGQNWIY------------------DAFIQNQLVLSALKLAT-----------------
H2XWZ3_CIOIN          NVGKNWLH------------------DAYSQSVLTLAALKLAS-----------------
SPB1_CHICK            NVGASWVH------------------DAYSQANLTLMALKLAC-----------------
B7P3V3_IXOSC          NVGKSWVH------------------DAYGQNVLTLHAVKLAT-----------------
Q7QD87_ANOGA          NVGKNWLH------------------DAYQQVCLTLSAVKLAT-----------------
Q9VXK5_DROME          NVGRNWLY------------------DAYQQICLTLNALKLST-----------------
E0VIT4_PEDHC          NVGTNWIH------------------DAYQQVCLTLSALKLGT-----------------
A0A088A7G6_APIME      NVGKNWLH------------------DAYQQIVLTLSALKMAT-----------------
C4M6R5_ENTHI          NMGKSWIQ------------------DAYTQSELCIAALKFAV-----------------
A5K2F1_PLAVS          NVGTTYSY------------------DSFNQNVLVLNSIKIAN-----------------
Q8IDF8_PLAF7          NVGTTYSY------------------DSFNQNVLVLNSIKIAY-----------------
Q4U8L6_THEAN          NMGCNWNL------------------DAFNQNVLVLTACKMAC-----------------
Q4N1B5_THEPA          NMGCNWNL------------------DAFNQNVLVLTAAKLAC-----------------
G4LWM3_SCHMA          NVAGMREI------------------DIPAMMKLAYNILRVAI-----------------
A0EER5_PARTE          NVGASWAK------------------DAYNQNDLVLSALRLAS-----------------
Q23MN4_TETTS          NVGANWQK------------------DAFNQIELTLAALKLAV-----------------
MRM2_YEAST            QTTGFWNNITNQAYFRMANTSGVSIRDHYQSIDLCDAALVTAI-----------------
MRM2_DROME            NATGVRML------------------DQESITNLCYEVLRFAL-----------------
A4I305_LEIIN          NVGGVWSR------------------DLFDQNALVLASAKMAC-----------------
K2MLU3_TRYCR          NVGGVWSR------------------DLFEQNALVLHAAKMAA-----------------
MRM2_CAEEL            NPTGDNAT------------------DHLRLIELCRSVFRLFS-----------------
B9QL21_TOXGV          NMGTDWSV------------------DAFSQNVLVLCAAKLAC-----------------
MRM2_SCHPO            KATGIRIR------------------DHALSMELCASALHVAL-----------------
RLME_DESPS            KTTGNRWT------------------DAQQSLNLCYQTLEIAE-----------------
RLME_PICTO            RTSGIEDR------------------DHYNSYKICERVMDISI-----------------
RLME_THEAC            KTSGIRSS------------------DHAASVMIGNAVMKIAM-----------------
RLME_THEVO            KVSGIPSR------------------DHAVSYQIGQRVMEIAV-----------------
B9T000_RICCO          PVSGITTK------------------DAALSMELGMQALDIAIGGAASAHPDDENQNDDS
C1N352_MICPC          STTGAADV------------------DAARSYELAEAAVRIAL-----------------
A5K6F5_PLAVS          DITGMNDI------------------DEFIQSQLILSSLKVCC-----------------
Q8I365_PLAF7          DITGMNDI------------------DEFIQSQLILSSLKVCC-----------------
RLME_PELUB            NTTGIKDI------------------DAIYTGELAMEAMNFSK-----------------
A8B3D0_GIAIC          DVTGVHDL------------------DEYVQAGLVDHAMTLAR-----------------
TRM72_DROME           DSTGMHDF------------------DSYVQGELLLSALSIST-----------------
A2F7C6_TRIVA          DVTGLHDL------------------DEYMQSQLVFSAFNIAC-----------------
Q586L7_TRYB2          DVTGMHEL------------------DEYLQHHLLLAALNITT-----------------
A4HRN5_LEIIN          DVTGMHEL------------------DEYLQHHLLLAALHITT-----------------
A0A0D1CBR1_USTMA      DVTGLHDL------------------DEYLQSQLLLAATQITF-----------------
I7MGM4_TETTS          DVTGFHDI------------------DQYLQSQLMVAALNICN-----------------
TRM71_DROME           DVTGVHEM------------------DEYMQHQLLVAALSIAT-----------------
D0NU18_PHYIT          DVLGLHDL------------------DEYLQAQLVLAGLNISL-----------------
TRM7_CAEEL            DVTGIHSL------------------DEFMQAELILAAFNITS-----------------
D0N6L4_PHYIT          DVTGVHDI------------------DEFVQAELLAAALNITT-----------------
G4VP71_SCHMA          DVTGLHDL------------------DEYVQSHLILAAVTICS-----------------
TRM7_DICDI            DVTGLHDI------------------DFYGQSQLILSALNITT-----------------
A8J2Y5_CHLRE          DVTGLHDL------------------DEYVQAQLLLAALSIVC-----------------
TRM7_HUMAN            DVTGLHDV------------------DEYMQAQLLLAALNIAT-----------------
TRM7_SCHPO            DVTGLHDL------------------DEYIQAQILLAAFNLAV-----------------
I1RY63_GIBZE          DVTGLHDL------------------DIYVQSQLLFAALNLAL-----------------
RLME_TREPA            RTTGNRTV------------------DTSASACLAAGVCAYVN-----------------
RLME_TREDE            ATTGNKTV------------------DTARSSGLVELALYYAQ-----------------
RLME_BDEBA            KTTGIRMT------------------DQARSMELCELALDVAR-----------------
RLME_DESVH            RTTGTRFT------------------DQARSLELCLEALAVAD-----------------
RLME_BORRA            STTGNRLV------------------DTSNSFNLNIRIFELAC-----------------
RLME_BORAP            RTTGNRLV------------------DTSNSFNLSMRIIDLSL-----------------
RLME_BORBP            KTTGNRLV------------------DTSNSFNLNMRIIDLSF-----------------
RLME_BORBU            KTTGNRLV------------------DTSNSFNLSMRIIDLSL-----------------
MRM2_MOUSE            NATGIRDL------------------DHDKLISLCLTLVDMAV-----------------
RLME_WOLTR            ESCGLKSL------------------DHIRIMLLCEAALNFAK-----------------
RLME_ANAMM            KSCGHRQV------------------DHANIINLCEMALDLAV-----------------
RLME_RICFE            NTIGHKAT------------------DHIRTLLLCEQAFEFAL-----------------
RLME_CAUVC            NTVGHRET------------------DHLRIVGLIEIAAEFAI-----------------
RLME_RHIME            PTTGHRQT------------------DHIRTMHLCEVAAHFAV-----------------
RLME_BARQU            PTTGHRQT------------------DYLRTTYLCEVAADFAL-----------------
RLME_NITWN            NTTGHRKT------------------DQLRIVGLVESAAAFTS-----------------
RLME_ZYMMO            NTIGHAQT------------------DHLRTMALVEEAAVFAS-----------------
RLME_RUEPO            SSSGHKQT------------------DHMRIIALCEAAAYLAF-----------------
RLME_WIGBR            NITGLSII------------------DHSRWISLNNNILNICK-----------------
RLME_BUCAP            NITGCSSI------------------DMPRIIEICKTVFTISD-----------------
RLME_BUCBP            NMTGHYFI------------------DHIQAILLSKLALKMSI-----------------
RLME_FRATT            NLSGNKTS------------------DQAKSIYLLELALDFAN-----------------
RLME_ECOLI            NMSGTPAV------------------DIPRAMYLVELALEMCR-----------------
RLME_BLOFL            NTTGISTV------------------DVCKSIYLGKIALNMCC-----------------
RLME_BLOPB            NTTGISII------------------DVSRSIHLGNLALNICR-----------------
RLME_COXBU            NISGIKNV------------------DQSRSLHLVELAWDCAQ-----------------
RLME_RALSO            NLSGVASA------------------DAARMEHIAELAVEFAQ-----------------
RLME_NITEU            NLTGIRVS------------------DQAQGMYLAELALIFCR-----------------
RLME_LEGPL            NMSGSSAI------------------DIPRAMYLVELAFDFAE-----------------
RLME_XANOR            NKSGMDAV------------------DQPRMMHLAELAMEFAD-----------------
RLME_PSYA2            NTAGNSAI------------------DQPRMMYLCELAVDFAL-----------------
RLME_NEIG1            NMSGNAVS------------------DQARSFYLCELALDFAS-----------------
RLME_AROAE            NMSGIDTT------------------DQARSIYLGELALEFAG-----------------
RLME_METMP            NISGVWDV------------------DHVRSLELTTMALMTAT-----------------
RLME_HALSA            DMTGEYDL------------------DHARSVHLARQALETAR-----------------
RLME_NATPD            NMTGEYSL------------------DHARSVHLARMAFETAL-----------------
RLME_METTH            SLSGIRDI------------------DHLRSVDLVENVLDIAY-----------------
RLME_ARCFU            KISGKWTI------------------DHLRSIDLARASFSIAK-----------------
RLME_METMA            NLSGNWSY------------------DHARSIELATSALECAK-----------------
                                                :      :                          

RLME_TREPR            -------RFLLDGGALLHKTFV---------------------IRA--EHIASVMERHFS
A9RQI9_PHYPA          -------DVLCPGGTFVTKIFR---------------------SQDY-NALLFAFKQLFE
D0MRD5_PHYIT          -------DVMGRGGTFVSKVFR---------------------SQDY-NALLWVFKQLFK
SPB1_DICDI            -------EFLTTGGWFVTKVFR---------------------GSDY-NSLIWVFNKLFK
E3KB01_PUCGT          -------EMLAQNGTFITKVFR---------------------SKDY-NSLLYIFNQLFK
SPB1_USTMA            -------EFLTAGGTFVTKVFR---------------------SKDY-NNLLWVFNQLFK
SPB1_CRYNJ            -------EFLAKGGSFVTKVFR---------------------SQDY-NSLLWVFGQLFK
A8N1R5_COPC7          -------EFLAKGGTFVTKVFR---------------------SVDY-NSLIWVFSQLFS
SPB1_YARLI            -------EFLNKGGTFVTKVFR---------------------SKDY-NNLMWVFQQFFE
SPB1_CANAL            -------ENLTAGGTFVTKIFR---------------------SRDY-NNLMWVFQQLFE
SPB1_SCHPO            -------EFLVAGGTFVTKVFR---------------------SRDY-NNLLWVFKQLFN
SPB1_ASPFU            -------EFLVEGGTFVTKVFR---------------------SKDY-NPLLWVFKQLFT
G4VQU5_SCHMA          -------EFLRRGGWFVTKVFR---------------------SRDY-EPLKWVLSQFFR
Q9N5N9_CAEEL          -------QILRKGGTFVTKVFR---------------------SNDY-SCLIRVFEKLFK
A0A1X7UGH0_AMPQE      -------DFLKPGGWFVTKVFR---------------------SKDY-QQLLNVFQKLFK
E9G6A2_DAPPU          -------EFLVKGGWFVTKIFR---------------------SKDY-NSLMWVLRQLFK
H2XWZ3_CIOIN          -------EFLCKGGWFITKVFR---------------------SKDY-QALMWIFGQLFN
SPB1_CHICK            -------EFLCKGGWFITKVFR---------------------SRDY-QPLLWIFQQFFH
B7P3V3_IXOSC          -------EFLTKGGWFITKVFR---------------------SKDY-QALMWVLKKLFR
Q7QD87_ANOGA          -------QFLRPGGWFITKVFR---------------------SKDY-NALIWVLKQLFR
Q9VXK5_DROME          -------QFLRNGGWFVTKVFR---------------------SKDY-NALLWVLKQLFK
E0VIT4_PEDHC          -------EFLREGGWFITKVFR---------------------SSDY-NSLLWVFKQLFK
A0A088A7G6_APIME      -------HFLRSGGWFITKVFR---------------------SKDY-HPLIWVLKQLFK
C4M6R5_ENTHI          -------TFLKKGGWFISKVFR---------------------SQDY-YAILFVFEKFFK
A5K2F1_PLAVS          -------LFLKKRGIFITKVFR---------------------NEEY-VSLIWVMEKLFG
Q8IDF8_PLAF7          -------IFLKKNGIFITKVFR---------------------NEEY-ISLIWVLEKLFG
Q4U8L6_THEAN          -------SLLRKGGIFVTKVFR---------------------SSDY-NSLVWMLSNCFD
Q4N1B5_THEPA          -------SLLRKGGIFVTKVFR---------------------SSDY-NSLVWMLGNCFE
G4LWM3_SCHMA          -------SVSKEGATFVIKLFQ---------------------SQEA-EEFKQTVSQFYT
A0EER5_PARTE          -------QFLKKGGVFVTKVFR---------------------STDY-NSLMWVFNKFFS
Q23MN4_TETTS          -------NFLRRGGTFVTKVFR---------------------SKDY-NALIWVCNKFFR
MRM2_YEAST            -------DLLRPLGSFVCKLYT---------------------GEEE-NLFKKRMQAVFT
MRM2_DROME            -------AMSAPQAHLVVKVWD---------------------NGDV-PKLERDMLRFYE
A4I305_LEIIN          -------SMLKANGWFVTKVFR---------------------SPDF-HNLLWVFKQLFE
K2MLU3_TRYCR          -------SMLKPSGWFVTKVFR---------------------SQDF-HKLMWVLKQLFE
MRM2_CAEEL            ---VENEIELVKNGVYLCKIWD---------------------GSAR-AEFVRELSDRFS
B9QL21_TOXGV          -------QLLAAGATFVSKVFR---------------------SADY-AALLYVLQTLFE
MRM2_SCHPO            -------TFLKSNGSFICKFYM---------------------GDED-ADLQNLLKSHFR
RLME_DESPS            -------QVLLNKGNYICKVFQ---------------------GGDF-PDFVDAVKKRFE
RLME_PICTO            -------PRLKNGGNIILKQFQ---------------------GDMT-NEFIKKWSGYFN
RLME_THEAC            -------DTLRRGGVAVVKQFQ---------------------GDMT-GDFIKNWGHYFR
RLME_THEVO            -------RYLRNGGNVLLKQFQ---------------------GDMT-NDFIAIWRKNFS
B9T000_RICCO          TSGENDNGVLQAGGHLVIKLLE---------------------SEDI-QEFTRICKPLFR
C1N352_MICPC          ------GERALDGGSLVVKLLE-------------------GPGGGK-ADLQAVCARAFD
A5K6F5_PLAVS          -------SVLKIGGNFISKIFR---------------------GEHT-GLLILHLNKFFE
Q8I365_PLAF7          -------SVLKVGGNFISKIFR---------------------GEHT-GLLILHLNKFFQ
RLME_PELUB            -------EMLVKEGRFVSKIFL---------------------GSSF-NEIVALGKKLFK
A8B3D0_GIAIC          -------QILAPGGTFVSKVFR---------------------GECLESLLRRNALSFFK
TRM72_DROME           -------FILEEGGSFVSKIYR---------------------ADRT-SRLYTQLKRFFK
A2F7C6_TRIVA          -------FMLREGGTFMAKIFT---------------------GRDI-QDLYSSLSPFFE
Q586L7_TRYB2          -------FVLRRGGTFVTKMFR---------------------GPNT-PFLVAKAEVFFR
A4HRN5_LEIIN          -------FVLRAGGCFLTKMFR---------------------GPNT-AFLVAKSGLFFQ
A0A0D1CBR1_USTMA      -------RLLEIGGTFVAKIFTQHPQAGLGASLGNMDLKAARPATSG-ALLADQLRTFFD
I7MGM4_TETTS          -------ETLKKGGHFVAKIFK---------------------GTDI-KFLYSQFKLFFK
TRM71_DROME           -------CVLETGGTFVAKIFK---------------------GNAT-SLLSSQMQIFFK
D0NU18_PHYIT          -------QILEDGGTFVAKLFR---------------------GKEV-SLLYAQLRRFFS
TRM7_CAEEL            -------HVLKEGGNFLAKIFR---------------------SRNS-SLLYAQMKKYFK
D0N6L4_PHYIT          -------HVLEEGGAFVAKIFR---------------------CEQY-DLLATQLSVFFE
G4VP71_SCHMA          -------RVLELGGTFVAKVFR---------------------GRDS-GLLGSQLRCLFS
TRM7_DICDI            -------HTLKIGGTFVAKMFK---------------------GDDM-SLMYSQMKLFFE
A8J2Y5_CHLRE          -------AVLRPGGTFVAKIFR---------------------GKDV-ALLYSQLKMLFP
TRM7_HUMAN            -------HVLKPGGCFVAKIFR---------------------GRDV-TLLYSQLQVFFS
TRM7_SCHPO            -------CVLKPGGKFVAKIFR---------------------GRDV-SLLYSQLRLMFR
I1RY63_GIBZE          -------CVLKPGGKFVAKIFR---------------------GRNV-DVLYAQLKIFFE
RLME_TREPA            --------FLSSDGGLVFKVFQ---------------------GSEH-LAILTHLRAHFG
RLME_TREDE            -------EQLKQGGSFVVKIFQ---------------------GGDQ-QIHLNNLRKCFK
RLME_BDEBA            -------RFLKKDGHFVCKLFH---------------------SDDF-GKLRDEMKKTFA
RLME_DESVH            -------RCLIKGGSFVVKIFM---------------------GPDV-QELVQAMRQRFS
RLME_BORRA            -------ESLMRGGNLLIKVFQ---------------------GGEE-EQIFYKLKSCFR
RLME_BORAP            -------EVLIKKGNLLVKVFQ---------------------GGDE-IQIFKKFEKYFK
RLME_BORBP            -------EVLLKKGNLLVKVFQ---------------------GGDE-MQIFKKFEKYFK
RLME_BORBU            -------EVLLKKGNLLVKVFQ---------------------GGDE-MQIFKKFEKYFK
MRM2_MOUSE            -------DILHPGGTLLCKTWA---------------------GSKS-HLLQKRLTQEFQ
RLME_WOLTR            -------HFLNYGGKFVVKIFQ---------------------GESD-KDFYNELKKMFK
RLME_ANAMM            -------EFLRSGGSFVTKILQ---------------------GEYE-QEFRRSLQYYFA
RLME_RICFE            -------KVLKPSGHFIAKIFR---------------------GGAE-NELLNKVKREFR
RLME_CAUVC            -------DVLKPGGAFVAKAFQ---------------------GGET-AEIIGKLKRHFD
RLME_RHIME            -------EVLAEGGHFLAKTFQ---------------------GGTE-RDLLNMLKQNFR
RLME_BARQU            -------SVLKSGGHFLVKAFQ---------------------GGAE-NTLLTTLKQNFK
RLME_NITWN            -------DVLRPGGTFIAKVFQ---------------------SGAD-AGLLVQLKRDFQ
RLME_ZYMMO            -------ETLREGGSFVAKVLA---------------------GGAD-KDLVALLKRLFG
RLME_RUEPO            -------DVLEEGGTFVAKVLA---------------------GGAE-GDLQKLLKQKFT
RLME_WIGBR            -------YLLLKNGKLIIKSFN---------------------SVEI-KNFCKKIENSFK
RLME_BUCAP            -------HVLSRNGVVLVKSFQ---------------------GEGF-NEFFAQMKNLFS
RLME_BUCBP            -------KVLSKGGSLLVKSFY---------------------GQEF-NSFIQDVHVTFS
RLME_FRATT            -------TNLNKNGSFVAKVFQ---------------------GQGS-DEYLKLVRESFN
RLME_ECOLI            -------DVLAPGGSFVVKVFQ---------------------GEGF-DEYLREIRSLFT
RLME_BLOFL            -------RFLAPGGSFLVKIFQ---------------------GDGF-DQYLYNLKCLFH
RLME_BLOPB            -------NVLMHRGAFLVKVFQ---------------------GKGL-DKYLCDVHSLFN
RLME_COXBU            -------KLLARGGTFLVKVFQ---------------------GPGV-DRFLINLRPYFN
RLME_RALSO            -------AHLKPEGALLIKCFH---------------------GSGY-SQIVEMFKRHFR
RLME_NITEU            -------EHLNPGKNFLVKVFQ---------------------GSDF-EAFRQMMQTDFS
RLME_LEGPL            -------KMLKPGGNMLVKIFH---------------------GSGF-DELVKQARASFE
RLME_XANOR            -------AHLKPGGAFLIKLFQ---------------------GVGS-DDYIRELRRRYE
RLME_PSYA2            -------ATLPEGGALIMKVFQ---------------------GEGT-QELRKQMQADFS
RLME_NEIG1            -------QHLKTGGSFLVKVFQ---------------------GAGY-QEYMAAMREIFG
RLME_AROAE            -------HHLKPGGGFVVKVFQ---------------------GQGF-MEYRNEAAKHFH
RLME_METMP            -------KMLKKGGNFVVKVFQ---------------------GDLF-EKYVQLVSEYFD
RLME_HALSA            -------ELLDAGGHFVVKVFD---------------------GRDF-QDLLADIEDEFA
RLME_NATPD            -------DLLAPNGDLVAKVFE---------------------GPDT-DDLRADIDREFE
RLME_METTH            -------RVLDRKGNILIKAFQ---------------------GPEL-DRVIKELRKDFW
RLME_ARCFU            -------EVLKPGGNFVVKVFQ---------------------GEEI-QKFFNELKPHFR
RLME_METMA            -------KILKPKGNFAVKVFQ---------------------GDMF-NDYLDEVRNNFV
                                        *                                       : 

RLME_TREPR            -SVEV------YRDASSRSFNSEAYLLCVGD-----------------------------
A9RQI9_PHYPA          -KVEV------TKPIASRATSAEIYVICQKYRAPAKID----PRLLDAKHLFKETIEAPK
D0MRD5_PHYIT          -KVSA------TKPLSSRNESAEIFVVCEQFLAPHSID----PKLFDPKYVFDQVDSQEK
SPB1_DICDI            -KVES------TKPPSSRNASAEIFVVCQGFLNPKRID----PKLLDPKFVFKEIQEVK-
E3KB01_PUCGT          -KVEA------TKPPSSRNVSAEIFVVCQGYLAPKKID----PRLLDPAHVFKDVDLTKK
SPB1_USTMA            -KVEA------TKPSSSRNVSAEIFVVCQGYKNPARID----PKFLDPRHVFKELDPASL
SPB1_CRYNJ            -SVEA------TKPPSSRNVSAEIFVVCRDFIAPKHID----PKFLDPKHVFKDIASLPT
A8N1R5_COPC7          -KVEA------TKPPSSRNVSAEIFVVCRDFLAPKFID----PKFLDPKHVFKDLSSLIS
SPB1_YARLI            -KVEA------TKPPSSRNVSAEIFVVCLKFKAPKKID----PRLLDAKYVFEEVSQGNN
SPB1_CANAL            -KVEA------TKPPASRNVSAEIFVVCKGFKAPKKLD----PRLLDPKEVFEELGGGNE
SPB1_SCHPO            -KVEA------TKPPSSRNVSAEIFVVCRGYKAPKKLD----PRFTDPRTVFEEVQEPVT
SPB1_ASPFU            -SVEA------TKPPSSRNVSAEIFVVCRGFKAPKRID----PKFLDPKHVFAELTDSTP
G4VQU5_SCHMA          -TVRA------IKPEASRLESAEIFLVGQNYIAPARID----PKFLDARHVFGEVDAPK-
Q9N5N9_CAEEL          -RVHV------WKPAASRLESAEIFVVCEVYQKPDKVG----AEYLDPKKVFANPDGSEG
A0A1X7UGH0_AMPQE      -KVHA------TKPQASRSESAEIFVVCQEYLVKGKPD----EKLLDPKFVFEEQEPLEK
E9G6A2_DAPPU          -RVHS------TKPHASRMESAEIFVICQGYRAPDKLD----PKFLDPKHVFQEVENISN
H2XWZ3_CIOIN          -KVHA------TKPQASRNVSAEIFVVCQGFKSPDKID----KKFFDPKSVFQEVEAKTR
SPB1_CHICK            -KVQA------TKPQASRNESAEIFVVCQGYQAPDKID----SKFFDPKYAFKEVEVHAK
B7P3V3_IXOSC          -KISA------TKPQASRHESAEIFVVCQYYIAPDKID----SKFLDPAYVFGDVDTGEA
Q7QD87_ANOGA          -KVHA------TKPSASRKESAEIFVVCQYYKAPDKID----PRFLDSKYVFEELDIQSK
Q9VXK5_DROME          -KVHA------TKPSASRKESAEIFVVCQGYLAPDHID----PRLLDSKYVFEELDLDAK
E0VIT4_PEDHC          -KVQA------TKPQASRSESAEIFVACKHFFAPDKID----PKFFQPQYVFKELDLKSP
A0A088A7G6_APIME      -KVHA------TKPQASRTESAEIFVVCQYYIAPDKLD----PKFLDPKYVFSELEIEPT
C4M6R5_ENTHI          -SVIA------TKPPASRNTSAEVYLVCKDFLAPSKYD----PNLLDPKFVFAKEEET--
A5K2F1_PLAVS          -QVKH------IKPRSSREISSEIYLIGLNFLSAKVDK-----KLFDYTYVFSEQFKQDS
Q8IDF8_PLAF7          -DVKH------IKPRSSREISSEIYLVGLNFLG-KKVD--KKL--FDYTYIFSDQFKKNS
Q4U8L6_THEAN          -KVKV------TKPQSSRNVSAEIFAVCIGFKTLKLID----QRLFNPDYVFQNSDVPIE
Q4N1B5_THEPA          -RVKV------TKPQSSRNVSAEIFAVCIGFKSLKLID----PRLFNADFVFQSSNTPLS
G4LWM3_SCHMA          LNSKCPSFTRFIKPEASRKESSEIYLVARGFQLPQSKQ-DN-------------------
A0EER5_PARTE          -KVEA------TKPLASRFVSAEIFVVCLDYLAPEYID----EKLFDSKHVFKDTETDML
Q23MN4_TETTS          -KIEA------NKPKASRFTSAEIFIVCTDFIDPDFID----DKLFDAKYIFKDTEDDYY
MRM2_YEAST            -NVHK------FKPDASRDESKETYYIGLKKK----------------------------
MRM2_DROME            -KVKR------VKPRASRGDSAEHFLVARNFKGATDS-----------------------
A4I305_LEIIN          -KVEA------TKPQASRMESAEIFVVCAGFKAPKSID----PAFFNPQKVFAEVGQEKI
K2MLU3_TRYCR          -KVEA------TKPLASRMESAEIFVVCAGFKAPKQLD----PSMFNAQKVFSDVGEEKI
MRM2_CAEEL            -TVKT------VKPTACRDNSAELYLFCRNFKK---------------------------
B9QL21_TOXGV          -RVDA------TKPQASRAVSAEIFVVCRGFRKPPVLD----ERLFDPKHVFLQGSDDGD
MRM2_SCHPO            -FVQV------MKPKASLKESREAYFVCLERKP---------------------------
RLME_DESPS            -SARV------IKPQSSRIESREVFVLGLNYRKPQK------------------------
RLME_PICTO            -YYKI------TKPKASRQHSREIYIIFLNRI----------------------------
RLME_THEAC            -DHRI------TKPPASRKESSEVYIIFYGFSGKETDN-SVQ---G--------------
RLME_THEVO            -SYKI------SKPPASRGSSSEIYIMFFGFKAP--------------------------
B9T000_RICCO          -KASW------LRPKATRSSSREIYLICQGLK----------------------------
C1N352_MICPC          -RVRW------YRPRATRRDSSEVFLVARGRR----------------------------
A5K6F5_PLAVS          -RVYV------CKPQSSRNKSLESFLVCLNFSLPLSSI----------------------
Q8I365_PLAF7          -RVYI------CKPQSSRNKSLESFLVCLNFSLPRSNI----------------------
RLME_PELUB            -EVKV------FKPKSSRKESKESFIICKILR----------------------------
A8B3D0_GIAIC          -TVDI------SKPDASRASSMECFMVCADYVPEGIPY----------------------
TRM72_DROME           -NVCV------FKPSASRNSSIEAFVVAREFCLPDGYK----------------------
A2F7C6_TRIVA          -TVTA------MKPRASRVASLESFVVCQGFKLPEGYT----------------------
Q586L7_TRYB2          -QVTI------AKPKSSRNASMEAFMVCQNYDPPASYQPSFERPLTQTTSCFTPAAPALH
A4HRN5_LEIIN          -QVRV------VKPKSSRNASMESFLLCQGFRMPLGYV----------------------
A0A0D1CBR1_USTMA      -RVDI------AKPRSSRLGSVEHFLVCLGFKPPQNLP----------------------
I7MGM4_TETTS          -SVYV------VKPKSSRASSVENFLVCLQYDPPQSFE----------------------
TRM71_DROME           -KFDI------YKPPSSRPSSIEAFVVCSDFCLPEGYI----------------------
D0NU18_PHYIT          -KVTC------AKPKTSRNSSFEAFVVCQDFHLPKDFV----------------------
TRM7_CAEEL            -KVYL------AKPRSSRQSSCEAFVLCLDYSPPEGFV----------------------
D0N6L4_PHYIT          -SVSC------SKPMSSRAQSNEAFVVCQGFRLPENYT----------------------
G4VP71_SCHMA          GEVSF------AKPRASRNSSLESFVICRGFMGPRLRT----------------------
TRM7_DICDI            -HVSF------VKPSSSRESSLENFILCRNYQPPLNYN----------------------
A8J2Y5_CHLRE          -EVYV------AKPKSSRNSSIEAFVVCRRFDPPPGLA----------------------
TRM7_HUMAN            -SVLC------AKPRSSRNSSIEAFAVCQGYDPPEGFI----------------------
TRM7_SCHPO            -KVSC------AKPRSSRASSIESFVVCEDFNPPSNFQ----------------------
I1RY63_GIBZE          -KVIV------AKPRSSRASSVEAFIVCINFQPPAGFR----------------------
RLME_TREPA            -AVCS------FKPPASRPRSCELYVVARFFRGTCGK-----------------------
RLME_TREDE            -TARA------FKPEACRSSSFETYLIGLDFKG---------------------------
RLME_BDEBA            -KVEA------VKPDSTRKISKEIFLVGLSKK----------------------------
RLME_DESVH            -AVKS------FKPKSSRAESKETFYVCLGYRGVETSD----------------------
RLME_BORRA            -VVKK------VRPKAVRKNSFEIYFLAKDFAKL--------------------------
RLME_BORAP            -FVKK------IRPKAVRKNSFEIYFLGKSFGK---------------------------
RLME_BORBP            -FVKK------IRPKAVRKNSFEIYFLGKSFGK---------------------------
RLME_BORBU            -FVKK------IRPKAVRKNSFEIYFLGKSFGK---------------------------
MRM2_MOUSE            -STRV------VKPEASRKESSEVYLLATQYRGGKGTR----------------------
RLME_WOLTR            -IVKY------FKPKSSRSESTEMYLVGLGFISNSFPI----------------------
RLME_ANAMM            -SVTY------FKPKSSRSESSEIYLVGTKFKNPEHPY----------------------
RLME_RICFE            -TVKH------FKPSSSRSESTEIYLVALNKK----------------------------
RLME_CAUVC            -KVQH------FKPKASRQDSSEVFLVATGFKGR--------------------------
RLME_RHIME            -QVVH------VKPASSRAESVEMFLLAKGFKGRHALE----------------------
RLME_BARQU            -TVHH------VKPPASRTESVELYLLALEFKAKTEVK----------------------
RLME_NITWN            -TVRH------VKPAASRQDSSERYVMATGFRGGRRDK-C--------------------
RLME_ZYMMO            -QVKH------AKPPASRRESSEWYVIAQNFRGEAYQG----------------------
RLME_RUEPO            -KVAN------VKPPASRSDSSEKFVVATGFRG---------------------------
RLME_WIGBR            -KIKI------FKPISSRSRSKEIYIVAVNYKL---------------------------
RLME_BUCAP            -KIKI------CKPKTSRSRSREIFMLATR------------------------------
RLME_BUCBP            -KVKI------CKPNSSRARSREVYILASGRKM---------------------------
RLME_FRATT            -KVIQ------FKPKSSRAKSREFYVIATEFKG---------------------------
RLME_ECOLI            -KVKV------RKPDSSRARSREVYIVATGRKP---------------------------
RLME_BLOFL            -KVKV------RKPSSSRSHSREVYIVSKDFKYKRINI----------------------
RLME_BLOPB            -IVRI------RKPDASRSHSREVYIVAKERK----------------------------
RLME_COXBU            -QVKF------LKPSASRSRSSEIYILAGEFLGYNQRV----------------------
RLME_RALSO            -VVAP------RKPKASRDKSSETFLLGRQLKHPG-------------------------
RLME_NITEU            -KVVI------RKPKASRDRSKELYLLGLEKII---------------------------
RLME_LEGPL            -KVVI------RKPSASRSRSKETYLLAKGYNL---------------------------
RLME_XANOR            -KVTI------RKPAASRKRSPEVYALGQGKRVQIK------------------------
RLME_PSYA2            -KIRS------IKPGASRPRSKEMFWIAIK------------------------------
RLME_NEIG1            -TVQT------RKPEASRNRSSEIYLLGKNKR----------------------------
RLME_AROAE            -ALHV------RKPKASRDRSAEVYLVGVGYRGS--------------------------
RLME_METMP            -KAFT------TKPRASRDESAEVYVIGKRFNGKKFDM----------------------
RLME_HALSA            -FVAT------HSPDASRDASSELYVVGKNHIVAPIAE----------------------
RLME_NATPD            -YVRT------IHPDASRDSSSELFMVAKGRLTAPVRE----------------------
RLME_METTH            -KLKT------TKPASSRKASAEMYIVGRDFKGKEKWERIIH------------------
RLME_ARCFU            -FKKF------HSPQASRKRSAEVYFIGKRFRKI--------------------------
RLME_METMA            -RVKA------YSPQASRSQSAEIYIIGKKFLTAPLRK----------------------
                                     :    . * :                                   

RLME_TREPR            ------------------------------------------------------------
A9RQI9_PHYPA          V-----------------------------------------------------IDVMKA
D0MRD5_PHYIT          TITI--------------------------------------------------FHPKFG
SPB1_DICDI            ------------------------------------------------------KVDVLS
E3KB01_PUCGT          PTDDQAEASSSKLTPNA-------------------------------------QNVFKP
SPB1_USTMA            ADQDQEAGVPLSLKGTSAGNAH--------------------------------ANVFEP
SPB1_CRYNJ            SITEPTDTSIAPTSSSTASAAAAAARLAANSHAH--------------------SNVYAP
A8N1R5_COPC7          ADKGPTVNDTQ-------------------------------------------SNVFHP
SPB1_YARLI            NNE---------------------------------------------------AKVFNP
SPB1_CANAL            SKQNNEAK----------------------------------------------IFNPEK
SPB1_SCHPO            NVD---------------------------------------------------AKVFHP
SPB1_ASPFU            NNE---------------------------------------------------ARVFNP
G4VQU5_SCHMA          -------------------------------------DRAA-------------LISSFL
Q9N5N9_CAEEL          T------------------------------------KPNP-------------QNLLIG
A0A1X7UGH0_AMPQE      PKI---------------------------------------------------TLQNIQ
E9G6A2_DAPPU          TV----------------------------------------------------MGLQAH
H2XWZ3_CIOIN          PVN---------------------------------------------------ILDFEP
SPB1_CHICK            ------------------------------------------------------SVSELV
B7P3V3_IXOSC          AK----------------------------------------------------LNAAHP
Q7QD87_ANOGA          DISSNN------------------------------------------------ILKELE
Q9VXK5_DROME          KKS---------------------------------------------------SLLHPE
E0VIT4_PEDHC          ATL---------------------------------------------------NIFNPR
A0A088A7G6_APIME      NK----------------------------------------------------LNIFNP
C4M6R5_ENTHI          ------------------------------------------------------QVPDLF
A5K2F1_PLAVS          NKAVTN----------DASEDDIFSNSSDNEKEDKKKSKKK-------------KGLSTI
Q8IDF8_PLAF7          NKSSLLETKQESYLDNNENYFSDEESNDEEKVGEKIDKKKK-------------KGLSTI
Q4U8L6_THEAN          QNELSQSNKLLSNTPKSLSNTPKTLTHTSKTPNHV-------------------SKTLNQ
Q4N1B5_THEPA          IEDDKSAKTKNQA-----------------------------------------PKTLNQ
G4LWM3_SCHMA          ------------------------------------------------------------
A0EER5_PARTE          -------------------------------------QQQI-------------QKEIVS
Q23MN4_TETTS          TQQVEHEVN---------------------------------------------SIDKIM
MRM2_YEAST            ------------------------------------------------------------
MRM2_DROME            ------------------------------------------------------------
A4I305_LEIIN          VS----------------------------------------------------ASGMLV
K2MLU3_TRYCR          LT----------------------------------------------------PSGALV
MRM2_CAEEL            ------------------------------------------------------------
B9QL21_TOXGV          APAAAQKAVRRSGGDDGAAQRLAEGDEADDGEAAKEEEEDEEREGIFFGSRGGRKGQFAE
MRM2_SCHPO            ------------------------------------------------------------
RLME_DESPS            ------------------------------------------------------------
RLME_PICTO            ------------------------------------------------------------
RLME_THEAC            ------------------------------------------------------------
RLME_THEVO            ------------------------------------------------------------
B9T000_RICCO          ------------------------------------------------------------
C1N352_MICPC          ------------------------------------------------------------
A5K6F5_PLAVS          ------------------------------------------------------------
Q8I365_PLAF7          ------------------------------------------------------------
RLME_PELUB            ------------------------------------------------------------
A8B3D0_GIAIC          ------------------------------------------------------------
TRM72_DROME           ------------------------------------------------------------
A2F7C6_TRIVA          ------------------------------------------------------------
Q586L7_TRYB2          LAAV--------------------------------------------------------
A4HRN5_LEIIN          -----------------------------------------------------PRFVGAV
A0A0D1CBR1_USTMA      ------------------------------------------------------------
I7MGM4_TETTS          ------------------------------------------------------------
TRM71_DROME           ------------------------------------------------------------
D0NU18_PHYIT          ------------------------------------------------------------
TRM7_CAEEL            ------------------------------------------------------------
D0N6L4_PHYIT          ------------------------------------------------------------
G4VP71_SCHMA          ------------------------------------------------------------
TRM7_DICDI            ------------------------------------------------------------
A8J2Y5_CHLRE          ------------------------------------------------------------
TRM7_HUMAN            ------------------------------------------------------------
TRM7_SCHPO            ------------------------------------------------------------
I1RY63_GIBZE          ------------------------------------------------------------
RLME_TREPA            ------------------------------------------------------------
RLME_TREDE            ------------------------------------------------------------
RLME_BDEBA            ------------------------------------------------------------
RLME_DESVH            ------------------------------------------------------------
RLME_BORRA            ------------------------------------------------------------
RLME_BORAP            ------------------------------------------------------------
RLME_BORBP            ------------------------------------------------------------
RLME_BORBU            ------------------------------------------------------------
MRM2_MOUSE            ------------------------------------------------------------
RLME_WOLTR            ------------------------------------------------------------
RLME_ANAMM            ------------------------------------------------------------
RLME_RICFE            ------------------------------------------------------------
RLME_CAUVC            ------------------------------------------------------------
RLME_RHIME            ------------------------------------------------------------
RLME_BARQU            ------------------------------------------------------------
RLME_NITWN            ------------------------------------------------------------
RLME_ZYMMO            ------------------------------------------------------------
RLME_RUEPO            ------------------------------------------------------------
RLME_WIGBR            ------------------------------------------------------------
RLME_BUCAP            ------------------------------------------------------------
RLME_BUCBP            ------------------------------------------------------------
RLME_FRATT            ------------------------------------------------------------
RLME_ECOLI            ------------------------------------------------------------
RLME_BLOFL            ------------------------------------------------------------
RLME_BLOPB            ------------------------------------------------------------
RLME_COXBU            ------------------------------------------------------------
RLME_RALSO            ------------------------------------------------------------
RLME_NITEU            ------------------------------------------------------------
RLME_LEGPL            ------------------------------------------------------------
RLME_XANOR            ------------------------------------------------------------
RLME_PSYA2            ------------------------------------------------------------
RLME_NEIG1            ------------------------------------------------------------
RLME_AROAE            ------------------------------------------------------------
RLME_METMP            ------------------------------------------------------------
RLME_HALSA            ------------------------------------------------------------
RLME_NATPD            ------------------------------------------------------------
RLME_METTH            ------------------------------------------------------------
RLME_ARCFU            ------------------------------------------------------------
RLME_METMA            ------------------------------------------------------------
                                                                                  

RLME_TREPR            ------------------------------------------------------------
A9RQI9_PHYPA          SKQKRHREGYEEGTTVLRKEVKASDFVWSEKPLDMLGSITSMSF-------------KDP
D0MRD5_PHYIT          DRKRHREGYDEALGVTLTNECSVTQFIDAHDPIRLLTDTTRVKF-------------LPE
SPB1_DICDI            EKKKVNRAGYEDGVTVLYKKGFISDFVNSNEHLQDLANFNAFEF-------------DEA
E3KB01_PUCGT          EKKRRTREGYDEGDYTLHKSSTASALINAKDPVSILGVANCIKF-------------DNS
SPB1_USTMA            KKIRRNREGYADGDYTLFHSLDAMDFIKGQDVIGMLGSYNQISF-------------ESD
SPB1_CRYNJ            EKKRRHREGYAEGDYTLHHTASAEEFVRGQDPVLLLGNMNKIEF-------------RNE
A8N1R5_COPC7          EKKRRHRDGYNDGDYTLYHSIPVTKFIHSPEPIAILGTYNKITF-------------DTD
SPB1_YARLI            EVKRRKREGYEEGEYLQHKRLSILDFITDSTPIDNLGETNEMTWTPRSIKEGEVDEEEEK
SPB1_CANAL            FSSQRQRQGYQEGDYTLFHTMPIMDFIKQDDPINQLGSLNKFDL-------------PAP
SPB1_SCHPO            EKRKRSREGYADDDYTLHKTVLASEFVTANDPIQILGTSAEIVF-------------PKD
SPB1_ASPFU            EKKKRKREGYEEGDYTQFKEIPVTEFINTTDPIAILGTYNKLSF-------------EQS
G4VQU5_SCHMA          KESRKKKAEGYDEGDTLYHELPLSKFLESSDPLEALAKANKVIF-------------DV-
Q9N5N9_CAEEL          KQKKAKAEGYDTDSLAIHSTINATDFIKSSGYLDILGTANVITL-------------DD-
A0A1X7UGH0_AMPQE      KHTKSSSTGYPEGQHVLFNSLPVVDFILSDDHMSVLASSHQFVF-------------DKT
E9G6A2_DAPPU          EKSKPKAGGYEEGITSLHKSAQISDFVHKENFVDILNNATVLNM-------------ND-
H2XWZ3_CIOIN          KKKKKAKGYGDEAKDLLYMKKTVSEFLGCSQPMQMLSEISEIVF-------------ED-
SPB1_CHICK            SKKKPKAEGYADGDTTLYHRFTLMDFLKAPNPVDFLSKANEITL-------------GD-
B7P3V3_IXOSC          EKQKAKAEGYPEGDYTLYHRVSVLDFIRCEDHLELLGQCSEVVL-------------DN-
Q7QD87_ANOGA          RKTPKKPKVEGYDSTDVRKIITALEYMQSDKPLALLSRVTEITF-------------TKA
Q9VXK5_DROME          KQKRIKAEGYTAQDIALRNDLAATEFLKAENALAALQGIGSIRI-------------DD-
E0VIT4_PEDHC          KQKKAKPEGYEEGDYTLHHTINVTEFLKSENAIEVLQRASTIVF-------------DD-
A0A088A7G6_APIME      TKKKDKVEGYPENDYTLYHKLSVKDFIAHENVVEALQNTSEIVF-------------DD-
C4M6R5_ENTHI          STKRPKPQGYDTSKALVYNVGNAKEFLQAEDPKAWLATHTAIQF-------------DEG
A5K2F1_PLAVS          LKEKKKKNRQGYDLGDDYRVTDICNFIHSDNYVDLLIKTNKFTF-------------DKD
Q8IDF8_PLAF7          LKEKKKKNRQGYDVGDDYRATDICTFIKSDNYVDLLIKNNKFTF-------------DKN
Q4U8L6_THEAN          LLKEQKKINREGYEGPIYSEISVIDFLKSKEPAVILVTYNKLLFTTTNSNTIGTKSTDEE
Q4N1B5_THEPA          LLKEQKKTNREGYDGAIYSEISVIDFLKSKEPATILVTHNKLLF-------------TTT
G4LWM3_SCHMA          ------------------------------------------------------------
A0EER5_PARTE          RTQRHRSGYADDVHQTVYQMIDFEEFLHAENPYPIFIEYAGIKM-------------TEE
Q23MN4_TETTS          AKRRKRVGYGDDVKQTVFQPITFEEFVNIDNPFAVFLTHNSISF-------------PKD
MRM2_YEAST            ------------------------------------------------------------
MRM2_DROME            ------------------------------------------------------------
A4I305_LEIIN          APKSNVPTGYDEFATVSHHVASFSDFLNADDPKVFLKTHHELRF----------------
K2MLU3_TRYCR          VPKSNVPTGYSEFATVSHHVASFSEFLHCSDPKSFLRSHHELRF-------------SAA
MRM2_CAEEL            ------------------------------------------------------------
B9QL21_TOXGV          LVRRRLKRHRNGDLLAGLRRVTVDEFFRSKDPTTLLVEQAREIF-------------FQT
MRM2_SCHPO            ------------------------------------------------------------
RLME_DESPS            ------------------------------------------------------------
RLME_PICTO            ------------------------------------------------------------
RLME_THEAC            ------------------------------------------------------------
RLME_THEVO            ------------------------------------------------------------
B9T000_RICCO          ------------------------------------------------------------
C1N352_MICPC          ------------------------------------------------------------
A5K6F5_PLAVS          -------------TALSSHTGEGEKFNRQNMPQEELRKMHAKLI----------------
Q8I365_PLAF7          ------------------------------------------------------------
RLME_PELUB            ------------------------------------------------------------
A8B3D0_GIAIC          ------------------------------------------------------------
TRM72_DROME           ------------------------------------------------------------
A2F7C6_TRIVA          ------------------------------------------------------------
Q586L7_TRYB2          ------------------------------------------------------------
A4HRN5_LEIIN          APAAASSAATGCSRGAASTSAGCGSRVEADNEQGMKGERSETAT-------------VS-
A0A0D1CBR1_USTMA      ------------------------------------------------------------
I7MGM4_TETTS          ------------------------------------------------------------
TRM71_DROME           ------------------------------------------------------------
D0NU18_PHYIT          ------------------------------------------------------------
TRM7_CAEEL            ------------------------------------------------------------
D0N6L4_PHYIT          ------------------------------------------------------------
G4VP71_SCHMA          ------------------------------------------------------------
TRM7_DICDI            ------------------------------------------------------------
A8J2Y5_CHLRE          ---------GPGCALQALLAGAAEDYFNTAA-----------------------------
TRM7_HUMAN            ------------------------------------------------------------
TRM7_SCHPO            ------------------------------------------------------------
I1RY63_GIBZE          --------------------------ASLEEPLGVGGRLEEM------------------
RLME_TREPA            ------------------------------------------------------------
RLME_TREDE            ------------------------------------------------------------
RLME_BDEBA            ------------------------------------------------------------
RLME_DESVH            ------------------------------------------------------------
RLME_BORRA            ------------------------------------------------------------
RLME_BORAP            ------------------------------------------------------------
RLME_BORBP            ------------------------------------------------------------
RLME_BORBU            ------------------------------------------------------------
MRM2_MOUSE            ------------------------------------------------------------
RLME_WOLTR            ------------------------------------------------------------
RLME_ANAMM            ------------------------------------------------------------
RLME_RICFE            ------------------------------------------------------------
RLME_CAUVC            ------------------------------------------------------------
RLME_RHIME            ------------------------------------------------------------
RLME_BARQU            ------------------------------------------------------------
RLME_NITWN            ------------------------------------------------------------
RLME_ZYMMO            ------------------------------------------------------------
RLME_RUEPO            ------------------------------------------------------------
RLME_WIGBR            ------------------------------------------------------------
RLME_BUCAP            ------------------------------------------------------------
RLME_BUCBP            ------------------------------------------------------------
RLME_FRATT            ------------------------------------------------------------
RLME_ECOLI            ------------------------------------------------------------
RLME_BLOFL            ------------------------------------------------------------
RLME_BLOPB            ------------------------------------------------------------
RLME_COXBU            ------------------------------------------------------------
RLME_RALSO            ------------------------------------------------------------
RLME_NITEU            ------------------------------------------------------------
RLME_LEGPL            ------------------------------------------------------------
RLME_XANOR            ------------------------------------------------------------
RLME_PSYA2            ------------------------------------------------------------
RLME_NEIG1            ------------------------------------------------------------
RLME_AROAE            ------------------------------------------------------------
RLME_METMP            ------------------------------------------------------------
RLME_HALSA            ------------------------------------------------------------
RLME_NATPD            ------------------------------------------------------------
RLME_METTH            ------------------------------------------------------------
RLME_ARCFU            ------------------------------------------------------------
RLME_METMA            ------------------------------------------------------------
                                                                                  

RLME_TREPR            ------------------------------------------------------------
A9RQI9_PHYPA          DC--------------------------KVIKEHDLTTDEIKILCEDLRVLGKTEFKQLL
D0MRD5_PHYIT          D---------------------------DVYRDHKDTSIEIVTCLSDLKVLGKSDFKSLL
SPB1_DICDI            A---------------------------KIFEQHELTTPEIKELVKDLKVLNKNDFQKII
E3KB01_PUCGT          QQD-------------------------QAIYKLKATTAEIKTTLTDLKVLGKGDFKKIL
SPB1_USTMA            ES--------------------------KKLLSLPDTNDEMRENCSDLKVLGKKDFRNLM
SPB1_CRYNJ            TE--------------------------KGWLKSRHTTPDIIANFEDLKVLGKGDFKALM
A8N1R5_COPC7          EE--------------------------KEWLKLDITKPDVKLNCDDLKVLGKGDFKSLL
SPB1_YARLI            EKDKEARDERGNVQYVLDDKVYSDEDALKMVSKLPQTTPELLECLKDLKVLGRKEFRAIL
SPB1_CANAL            KDDDNDDDDHDHEW--------------KILSKLKLCTPELLECIKDLKVLGRKEFKMIL
SPB1_SCHPO            DEEC------------------------QRLYNLDVTTEEILLCCSDLQVLGKKEFRDIL
SPB1_ASPFU            PGGDLAL---------------------ATLNRLEETTDEIRTCCEDLKILGKKEFRSLL
G4VQU5_SCHMA          ----------------------------PEIACHPLTTSLIKEDFNDIQVLGKGDIKNLL
Q9N5N9_CAEEL          ----------------------------EKWKNHEKTTEEVIEYMNDVKVLGPRELRVLL
A0A1X7UGH0_AMPQE      S---------------------------EVFNKHPLTTEEIKELCSDIKVLGLKELKVLI
E9G6A2_DAPPU          ----------------------------PEIANHPLTTIEIKECCKDIKVLGRKDLKALL
H2XWZ3_CIOIN          ----------------------------DDQKVHPLVTDEIKEHVKDIKRLGKKEIKTLL
SPB1_CHICK            ----------------------------GELENHSSTTEELRQCCKDIRVLGRKELRALL
B7P3V3_IXOSC          ----------------------------QEVLDHPSTTEEIKECCKDIKVLGRGDIKNLL
Q7QD87_ANOGA          D---------------------------EAIANHPRTTTELKECCKDIKILGRKDIKELL
Q9VXK5_DROME          ----------------------------QRIANHKKTTPEILECCKDLKVLGRKDIKGLV
E0VIT4_PEDHC          ----------------------------ETILNHPKTTKELVECFKDIKVLNRKDVRLIL
A0A088A7G6_APIME      ----------------------------EIITNHEKTTKEIKECCKDIKVLGKKDLRNLI
C4M6R5_ENTHI          LP----------------------------------VTEDIKGYGSDIRMLGSAELKLLL
A5K2F1_PLAVS          YLTSEDPLVKSTY---------------TAIYKNPSTTQEILQLCKDLKVLGKSDLFHLI
Q8IDF8_PLAF7          YKNNSDPMIKTIY---------------ECIYKNECTTKEIFFLCNDLKVLGKSDLYNLI
Q4U8L6_THEAN          IL--------------------------EMVKENPLTTEEIKLLCSDLKVAGKSDLQSLL
Q4N1B5_THEPA          HNCINSNHNSVNSSINSTTGTIGDDDVLSMVEESPLTTEEIKLLCSDLKVAGKSDLQSLL
G4LWM3_SCHMA          ------------------------------------------------------------
A0EER5_PARTE          AK--------------------------QKYLGLAKPPQDYEILMEDIKVLGKREIIQLL
Q23MN4_TETTS          QL--------------------------EKYIPMTDPPKDWEIICEDILVIGKREIAQLI
MRM2_YEAST            ------------------------------------------------------------
MRM2_DROME            ------------------------------------------------------------
A4I305_LEIIN          -----------------------SDDADKEYLKSKSSKKELVYLCGDLQQVGEADLRRML
K2MLU3_TRYCR          ED--------------------------KVYLKSKHSKKELVYLCGDLQQVGDADLRRML
MRM2_CAEEL            ------------------------------------------------------------
B9QL21_TOXGV          PAVALE----------------------EAVRNHRLTTPETLACLADVQVLGKAELAALL
MRM2_SCHPO            ------------------------------------------------------------
RLME_DESPS            ------------------------------------------------------------
RLME_PICTO            ------------------------------------------------------------
RLME_THEAC            ------------------------------------------------------------
RLME_THEVO            ------------------------------------------------------------
B9T000_RICCO          ------------------------------------------------------------
C1N352_MICPC          ------------------------------------------------------------
A5K6F5_PLAVS          ------------------------------------------------------------
Q8I365_PLAF7          ------------------------------------------------------------
RLME_PELUB            ------------------------------------------------------------
A8B3D0_GIAIC          ------------------------------------------------------------
TRM72_DROME           ------------------------------------------------------------
A2F7C6_TRIVA          ------------------------------------------------------------
Q586L7_TRYB2          ------------------------------------------------------------
A4HRN5_LEIIN          ----------------------------DGPLRASGFTPEAPLYCYD-------------
A0A0D1CBR1_USTMA      ------------------------------------------------------------
I7MGM4_TETTS          ------------------------------------------------------------
TRM71_DROME           ------------------------------------------------------------
D0NU18_PHYIT          ------------------------------------------------------------
TRM7_CAEEL            ------------------------------------------------------------
D0N6L4_PHYIT          ------------------------------------------------------------
G4VP71_SCHMA          ------------------------------------------------------------
TRM7_DICDI            ------------------------------------------------------------
A8J2Y5_CHLRE          ------------------------------------------------------------
TRM7_HUMAN            ------------------------------------------------------------
TRM7_SCHPO            ------------------------------------------------------------
I1RY63_GIBZE          ------------------------------------------------------------
RLME_TREPA            ------------------------------------------------------------
RLME_TREDE            ------------------------------------------------------------
RLME_BDEBA            ------------------------------------------------------------
RLME_DESVH            ------------------------------------------------------------
RLME_BORRA            ------------------------------------------------------------
RLME_BORAP            ------------------------------------------------------------
RLME_BORBP            ------------------------------------------------------------
RLME_BORBU            ------------------------------------------------------------
MRM2_MOUSE            ------------------------------------------------------------
RLME_WOLTR            ------------------------------------------------------------
RLME_ANAMM            ------------------------------------------------------------
RLME_RICFE            ------------------------------------------------------------
RLME_CAUVC            ------------------------------------------------------------
RLME_RHIME            ------------------------------------------------------------
RLME_BARQU            ------------------------------------------------------------
RLME_NITWN            ------------------------------------------------------------
RLME_ZYMMO            ------------------------------------------------------------
RLME_RUEPO            ------------------------------------------------------------
RLME_WIGBR            ------------------------------------------------------------
RLME_BUCAP            ------------------------------------------------------------
RLME_BUCBP            ------------------------------------------------------------
RLME_FRATT            ------------------------------------------------------------
RLME_ECOLI            ------------------------------------------------------------
RLME_BLOFL            ------------------------------------------------------------
RLME_BLOPB            ------------------------------------------------------------
RLME_COXBU            ------------------------------------------------------------
RLME_RALSO            ------------------------------------------------------------
RLME_NITEU            ------------------------------------------------------------
RLME_LEGPL            ------------------------------------------------------------
RLME_XANOR            ------------------------------------------------------------
RLME_PSYA2            ------------------------------------------------------------
RLME_NEIG1            ------------------------------------------------------------
RLME_AROAE            ------------------------------------------------------------
RLME_METMP            ------------------------------------------------------------
RLME_HALSA            ------------------------------------------------------------
RLME_NATPD            ------------------------------------------------------------
RLME_METTH            ------------------------------------------------------------
RLME_ARCFU            ------------------------------------------------------------
RLME_METMA            ------------------------------------------------------------
                                                                                  

RLME_TREPR            ------------------------------------------------------------
A9RQI9_PHYPA          KWRLQIRKNLEP---------------------TPASDKEDDSNEKKKGSDEDNDDEEEL
D0MRD5_PHYIT          KWRTRMLKYKEELLKA-------------KKPEEEKEEEEKPEKEPERELTEKEKDALVR
SPB1_DICDI            KWKKAMAAY------------------------KEKLDNPDEEETEKPEEKKELTAEEME
E3KB01_PUCGT          KWRTAVRELLGI--------------------------DSKPVNQAPSEAPVEVEPLDEE
SPB1_USTMA            NWRKEVRLALGI-----------------------DLPKSKHQDLAEQTQTVEVEEMDED
SPB1_CRYNJ            KWRLAIRLEIGL--------------------------DVKADKTQDATEEVVVEPMDEE
A8N1R5_COPC7          KWRLALREELGL-------------------------EVTTKQTEDATEVIDVTEEVDEE
SPB1_YARLI            KWRLSARDLL-------------------------------QIDKPEAGVEVEEEELDED
SPB1_CANAL            KFRKQARDILGI--------------------------DKDEKEEEEENPKIEVEPLTEE
SPB1_SCHPO            RWRLKIRDEMGI---------------------------GKKVEDEQKTVVEEIPEMDEE
SPB1_ASPFU            RWRLKVREKFGL------------------------VVKKGQAKADEPEEVAEVAPMDEE
G4VQU5_SCHMA          KWRMKILSVLKA----------------ESKESKDSIEESNLPKRDTGEDEEDLEVETEV
Q9N5N9_CAEEL          RWRKSMLETL--------------------EEQRKAVEGEAKEVEIEENLTEEQLEDRAM
A0A1X7UGH0_AMPQE      KWRAKMKEFL---------------------------DQVSDSEDESGTKGAGSDNEMDL
E9G6A2_DAPPU          GWRKAIQKSLDD-----------------KAEQLKLEENASIEKPVPMEEDACSDDEEDL
H2XWZ3_CIOIN          KWHKKWQKL--------------------------------NAPQVEEVEENEEEEVDSE
SPB1_CHICK            NWRTKLRRFLTKKLKE------QAKELDINLSSGEEEEGREEEEKTSPKAAADEMVKEEE
B7P3V3_IXOSC          TWRKKLKTWF----------------------EEKAKAEGKVDEAEVEEVADDEGSEDEE
Q7QD87_ANOGA          RWHKLLSPEFTE------------AGEDKADDKKKKGEGEDGAKDDDDEETDVDEEIVEL
Q9VXK5_DROME          QWWKDVRELF--------------------VEKETPLVVGNAADEKPKPLTQAEIEDMED
E0VIT4_PEDHC          TWWKALREEAKL------------------KYMKEMEEKKAKEKKNQPEPTLSDEEEKEL
A0A088A7G6_APIME      NWWKIIKESLK-----------------EKEPIDENTQNLLDETVETAPMSQEELEDIED
C4M6R5_ENTHI          KWRDIIVKKI-----------------------KKEQEEADKIKAEEEKMKMEDKILTEQ
A5K2F1_PLAVS          KWRYKVRKGVASLGGE--------TQLSKTSDAEEEASQGVDPVKENLPTEETRTATTKA
Q8IDF8_PLAF7          KWRYKIKKSVLNQTSKKNNLDFDNHDVEQTTQELSDVKESSQIDDFNTIVDK-NISENEL
Q4U8L6_THEAN          KWRFKLINTIPNLKTK--------SNPSDSTKPGIDGSEPTISDTTVSTTTDPTAMDTVD
Q4N1B5_THEPA          KWRFKLINSIPSLNRKSSEQSESLKPEDESVAETKSTSNKSTSDKSTSNKSTSSKSTSNE
G4LWM3_SCHMA          ------------------------------------------------------------
A0EER5_PARTE          KWRSKIKHFLSKQKKE------QKQLEKQEQQESAEYEDLDEAEGEGQDDEVNEEEAEEQ
Q23MN4_TETTS          KWRNKILHIQRKNKEQEKKNKLKAITDGDQQGDEKQDQEQSSEMDVEENEEDWEDEKGNS
MRM2_YEAST            ------------------------------------------------------------
MRM2_DROME            ------------------------------------------------------------
A4I305_LEIIN          RWREQLLREKTH--RIQVDAAGTEEGGDVDSMAGGNGSDDEDDEDDGKGKRDYHFDFDSP
K2MLU3_TRYCR          RWREQLLREQAA----------------MAKEADEEEDADDEEMGDDDDGDSVGNGSDDE
MRM2_CAEEL            ------------------------------------------------------------
B9QL21_TOXGV          KWRFRVKKDVFLALGL-----------------RTHAAAEKPPAGANDDGEERDRDEADS
MRM2_SCHPO            ------------------------------------------------------------
RLME_DESPS            ------------------------------------------------------------
RLME_PICTO            ------------------------------------------------------------
RLME_THEAC            ------------------------------------------------------------
RLME_THEVO            ------------------------------------------------------------
B9T000_RICCO          ------------------------------------------------------------
C1N352_MICPC          ------------------------------------------------------------
A5K6F5_PLAVS          ---------------------------AQKDDEGGIRRGGKSLGREEKRNDTSGEELSAE
Q8I365_PLAF7          --------------------------------------ISMNNHNAENKINDKYLSEEQM
RLME_PELUB            ------------------------------------------------------------
A8B3D0_GIAIC          ------------------------------------------------------------
TRM72_DROME           ------------------------------------------PCNLTTEWHDQPESWVGR
A2F7C6_TRIVA          -------------------------------------------------PILTSDPQTDF
Q586L7_TRYB2          ---------------------------------DAQRMSSDNVNNGELHHSGVTDIVDEA
A4HRN5_LEIIN          -----------------------------TTASFSHASDGGAAAAATVHDVAHHNQRTSC
A0A0D1CBR1_USTMA      -------------------------------------------AGLVGSLAGTLSSTSTE
I7MGM4_TETTS          ---------------------------------NSTTKSLYTFQPEIEKIQEVNEQISKQ
TRM71_DROME           -----------------------------------------PQVINPARDDIRLLAQKTG
D0NU18_PHYIT          -----------------------------PDMERNLLDLQYVEDAKYEDDEDWYTSDVSA
TRM7_CAEEL            ----------------------------------------------PTMGKTSLDATDAS
D0N6L4_PHYIT          --------------------------------------------PVMTSYLLPRYGLEEG
G4VP71_SCHMA          ------------------------------DLKPSTPCENHSSNDNLLLLWYDKDNFEDV
TRM7_DICDI            ----------------------PKIIDPALENHNKILNNNNNNSNNNNNCNIDNENDNEF
A8J2Y5_CHLRE          ---------------------------------AEEEQAAAAAGGGAGQGTGQASGRGGV
TRM7_HUMAN            -----------------------------------------PDLSKPLLDHSYDPDFNQL
TRM7_SCHPO            -------------------------------------------------PDLTKPLCVID
I1RY63_GIBZE          ----------------------------LKEKGDVDMQDSMAKDEGVVEMEVYDEVPEDT
RLME_TREPA            ------------------------------------------------------------
RLME_TREDE            ------------------------------------------------------------
RLME_BDEBA            ------------------------------------------------------------
RLME_DESVH            ------------------------------------------------------------
RLME_BORRA            ------------------------------------------------------------
RLME_BORAP            ------------------------------------------------------------
RLME_BORBP            ------------------------------------------------------------
RLME_BORBU            ------------------------------------------------------------
MRM2_MOUSE            ------------------------------------------------------------
RLME_WOLTR            ------------------------------------------------------------
RLME_ANAMM            ------------------------------------------------------------
RLME_RICFE            ------------------------------------------------------------
RLME_CAUVC            ------------------------------------------------------------
RLME_RHIME            ------------------------------------------------------------
RLME_BARQU            ------------------------------------------------------------
RLME_NITWN            ------------------------------------------------------------
RLME_ZYMMO            ------------------------------------------------------------
RLME_RUEPO            ------------------------------------------------------------
RLME_WIGBR            ------------------------------------------------------------
RLME_BUCAP            ------------------------------------------------------------
RLME_BUCBP            ------------------------------------------------------------
RLME_FRATT            ------------------------------------------------------------
RLME_ECOLI            ------------------------------------------------------------
RLME_BLOFL            ------------------------------------------------------------
RLME_BLOPB            ------------------------------------------------------------
RLME_COXBU            ------------------------------------------------------------
RLME_RALSO            ------------------------------------------------------------
RLME_NITEU            ------------------------------------------------------------
RLME_LEGPL            ------------------------------------------------------------
RLME_XANOR            ------------------------------------------------------------
RLME_PSYA2            ------------------------------------------------------------
RLME_NEIG1            ------------------------------------------------------------
RLME_AROAE            ------------------------------------------------------------
RLME_METMP            ---------------------------------------NSKSPIVKLLDTKPVEEEITS
RLME_HALSA            -------------------------------------GDEHTVEIVDTGDEGDGIARIEG
RLME_NATPD            -------------------------------------GDTLEVEIDNLGDEGDGVAKVDG
RLME_METTH            ------------------------------------------------------------
RLME_ARCFU            ------------------------------------------------------------
RLME_METMA            -------------------------------------GDKFVVDIEKLGSSGDGAVLIEG
                                                                                  

RLME_TREPR            ------------------------------------------------------------
A9RQI9_PHYPA          ATMEELKEYVESQKRKERKKKAKAKEKAKARSATGMQIDVMEDGVADTELFNIKAIKGKK
D0MRD5_PHYIT          EELSQLRANVQAKKKREKKKERERKQKLRIRAALGMNADGIDVTEAESAFSLKELKLSKS
SPB1_DICDI            ENLQEEMKEYLALVEKKKRKEKKRQNELKRKHQRKIELTMHIPGDKIEETTDGDLYSMKG
E3KB01_PUCGT          QIMKEELARIQTEKALENKRERRRLNEKRTRDVQRMQLQMTTPMDIGIENTDGEVFGLQN
SPB1_USTMA            DQIDDELARLNEEAARKARKERRRKNELRQKKILKMQLQMTTPMDIGMDVMDDQLGAGNG
SPB1_CRYNJ            EQITEELQKLQQAKLAKTKRERKRANEKKARELLKLQLNMTVPDDLDQNDLALQGEEEIF
A8N1R5_COPC7          QQLSEELERLNAEAAARLKRERRKANEIRTRTIQRMQLQMTAPLDIGLEQHDAALNLGQE
SPB1_YARLI            QLIDKELSELGEREKARKKRERRRRNEMKQREIQRMQMNMTTPTELGIEAAKMESLFNLK
SPB1_CANAL            QKIDQELQDLINKQKQKAKRLKKNANELKQKEIIRNQMNMLTDMNIGIEAAQIGADSLFN
SPB1_SCHPO            ERLDQELQDLSEAERVKLKRERRKANQRKQREIVRMQMGMLAPMDIGLEHEAMGEDSLFG
SPB1_ASPFU            LAIQEELQRLQEKESAKRKKERRKENEKKRKEIIRMQMHMTTPMDIGMEQLGPGGDDATF
G4VQU5_SCHMA          QRLWDEEEKLKKKKMKKVRKEKRKLAERYVLKMSHESDYIEQNDDELFSLAAIKDLVGLE
Q9N5N9_CAEEL          AEIDELIAKASEDEKAALKKKKKKMLKAKARVLKRRELKMIIDGDEGPQAE---------
A0A1X7UGH0_AMPQE      SEVDARVKELAKEEKAELKSILRYKRKQRRKVEERLKSQQEEDDPVTGEVTSGGKEKLFS
E9G6A2_DAPPU          SQVERQIKELEDAKVQDAKRKKKKLMNERRKLQEKMRLKMVIPGDGGPSVLEAKPLFALD
H2XWZ3_CIOIN          EEMERKIQEIQENETRELKKKKKVVTKERQKLRERMS-----------------------
SPB1_CHICK            EEVELALAEMKAKELAELKRKKKKILKEQRKQRERVELKMDLPGVSIADDGDTSMFSLQT
B7P3V3_IXOSC          LQLLKHAEEVTAEQAKEEKKKRKKMLKQRKKLRDRMNLQMVLKDDDPIVERDDDLFKLKA
Q7QD87_ANOGA          KQIEKEIATLQKEEERSSKRMRKKTNKERAKLNEKLSLKMVIKGDAGPTEQGEDMVFSL-
Q9VXK5_DROME          AELQTQIETIVEEEKKDLKRKRKKTLKTKAKLHEKMNLNMVIKGDDGPVEEMEHEIFDLK
E0VIT4_PEDHC          NEIDAHISAVKKEELQAQKKKKKIAEKERKKLQEKMNLKMVLNKYENPGMQDEDAIFRLS
A0A088A7G6_APIME      EQIRKQIEELKENEARDLKRKKKKANKQRQKLNERLNLKMIHKGNEGPILEGDDMFSLKE
C4M6R5_ENTHI          EELQKELEREEEEEREEEIAKNKKTAKQKRAEEKKKRKEQRIKEGGMDIANSSGYDEVDQ
A5K2F1_PLAVS          SLQDDELSGSSDADSEKDEINEFSTQMEKKNKKEQKKKEKKLKKELEKRKMNKSITPDYD
Q8IDF8_PLAF7          DNTSDEATEKDEKDQVDEIEEFSAYIEKKKKKEQKKKEKKLKKELEKKKKSNRGHQLDFD
Q4U8L6_THEAN          STIDSTVIEMDKKIKNKIESEKRRLERKQRKMLKKLKIGKNSNSSLITPDPDLFSLNSSN
Q4N1B5_THEPA          SVEIDPEAVDSSVLSLDKKLKSKIIQEKRRLERKQRKMLKKLKPGTSSTFVGPDPDLFSL
G4LWM3_SCHMA          ------------------------------------------------------------
A0EER5_PARTE          DDLDKLVDKQKEALEQQYIEEQKKELKEQRKQKQKQAQQEKKLSGRGIGFTPQEEDQELF
Q23MN4_TETTS          EEEEDDDEEEEDDDEEEDEEEEDVDEDVEEGDDEKEDDEEEEQENKEDVDEQLAKEIRED
MRM2_YEAST            -RNVDKLDVFSNS-----------------------------------------------
MRM2_DROME            ------------------------------------------------------------
A4I305_LEIIN          EGVTQIARELLEIRKKKAKELKKKQKKVVDRKLKQIKGLINYDPNMSVEHMTEADGLTYK
K2MLU3_TRYCR          EGIDLDSAEGVAKIARELLELRKRQSKLLKKKQRKIVDRKLKQIKGLINFDPNTSTEDMT
MRM2_CAEEL            ------------------------------------------------------------
B9QL21_TOXGV          AEIDEELTRLHASVTRREAKQQKRQAQKQKQLEMRKKLTRGAFFDEAEGPLDPDLFQFDR
MRM2_SCHPO            ------------------------------------------------------------
RLME_DESPS            ------------------------------------------------------------
RLME_PICTO            ------------------------------------------------------------
RLME_THEAC            ------------------------------------------------------------
RLME_THEVO            ------------------------------------------------------------
B9T000_RICCO          ------------------------------------------------------------
C1N352_MICPC          ------------------------------------------------------------
A5K6F5_PLAVS          GEDDSQVESEGNKGEEKGENELAHINECASDDETGNILKGDKQNDCGSGRGD--------
Q8I365_PLAF7          RKFHAQLITYKDKDDQESEEKKENYNSHDNIDYNLCHTTKHNKNISDEIETKEVSSPYEH
RLME_PELUB            ------------------------------------------------------------
A8B3D0_GIAIC          --SKDREVYYSQCGDFRMLDSNRSYPT---------------------------------
TRM72_DROME           KKESPPVVQVPFVAYKGELDSDRTYDLGEN------------------------------
A2F7C6_TRIVA          EATSPLSPSFVAFGDLSGFDKAKDKIEW--------------------------------
Q586L7_TRYB2          YAVESVIVPFLACGDLTGYDADMCYDRGES------------------------------
A4HRN5_LEIIN          ALADRVLAPFLSCGDLSGFDADMCYDRDED------------------------------
A0A0D1CBR1_USTMA      EEARDDLVRYAQKLRSELQRPDVPTSGMAQSKRELSAILSFVVHGDLSGFDQ--------
I7MGM4_TETTS          TKEDQKYYKFVTCGDLSGFDEAD-------------------------------------
TRM71_DROME           SEVNRRLVPFIACGDLNGLSDPEEGKTSSSDESKSNLE----------------------
D0NU18_PHYIT          ERGVCADVVFMGAGDVFGYDADQSYPLDEDEGDTATQGDAAK------------------
TRM7_CAEEL            AISPDIIDGFVTCGDLSGWDSEKSYPLDIDACFPKGEIDEEQKKR---------------
D0N6L4_PHYIT          EKHDPLLVPFLASGDLSGYDAYQQFY----------------------------------
G4VP71_SCHMA          NSSQQALLPFIACGDLRGFDPDVTYTLAPD------------------------------
TRM7_DICDI            LKTDSLIVPFIACGDLNLGYHLV-------------------------------------
A8J2Y5_CHLRE          APLLARAVPFLSCGDLSGGDADRTYDLDPAT-----------------------------
TRM7_HUMAN            DGPTRIIVPFVTCGDLSSYDSDRSYPLDLEGGSE--------------------------
TRM7_SCHPO            PTNAHEIAPFIACGDLDGYDADATYPVEINMK----------------------------
I1RY63_GIBZE          ERNSRWVAPFIACGDLSAFDSDASYQLPED------------------------------
RLME_TREPA            ------------------------------------------------------------
RLME_TREDE            ------------------------------------------------------------
RLME_BDEBA            ------------------------------------------------------------
RLME_DESVH            -TDK--------------------------------------------------------
RLME_BORRA            ------------------------------------------------------------
RLME_BORAP            ------------------------------------------------------------
RLME_BORBP            ------------------------------------------------------------
RLME_BORBU            ------------------------------------------------------------
MRM2_MOUSE            -RP---------------------------------------------------------
RLME_WOLTR            ------------------------------------------------------------
RLME_ANAMM            ---GNSEDAPSEC-----------------------------------------------
RLME_RICFE            ------------------------------------------------------------
RLME_CAUVC            ------------------------------------------------------------
RLME_RHIME            ---SDEPAEGAAEE----------------------------------------------
RLME_BARQU            ------------------------------------------------------------
RLME_NITWN            ------------------------------------------------------------
RLME_ZYMMO            ------------------------------------------------------------
RLME_RUEPO            ------------------------------------------------------------
RLME_WIGBR            ------------------------------------------------------------
RLME_BUCAP            ------------------------------------------------------------
RLME_BUCBP            ------------------------------------------------------------
RLME_FRATT            ------------------------------------------------------------
RLME_ECOLI            ------------------------------------------------------------
RLME_BLOFL            ------------------------------------------------------------
RLME_BLOPB            ------------------------------------------------------------
RLME_COXBU            ------------------------------------------------------------
RLME_RALSO            ------------------------------------------------------------
RLME_NITEU            ------------------------------------------------------------
RLME_LEGPL            ------------------------------------------------------------
RLME_XANOR            ------------------------------------------------------------
RLME_PSYA2            ------------------------------------------------------------
RLME_NEIG1            ------------------------------------------------------------
RLME_AROAE            ------------------------------------------------------------
RLME_METMP            PSLRKEISKEDSGLMIKRIKEMRSKKE---------------------------------
RLME_HALSA            YTLFVDDAAEGDTVDVTVTDLKPNYGFAERRDGA--------------------------
RLME_NATPD            YTLFVSGAEPGDAPEVRVTDVKPRFGFAETLE----------------------------
RLME_METTH            ------------------------------------------------------------
RLME_ARCFU            ------------------------------------------------------------
RLME_METMA            FVVFVKEVEVGEKVRIKISDVKPNFAFADVEERIESSETENREKSD--------------
                                                                                  

RLME_TREPR            ------------------------------------------------------------
A9RQI9_PHYPA          DLARMEV----------------------------EDDEDDNDSVDEMLNDGPQQAEDDS
D0MRD5_PHYIT          KVDELENAGADSSSDEELQFETSDEEDEDAGLEDSDAEYDELLEASMEKAYEQFLTRRGD
SPB1_DICDI            KDEFDEDIVADHSDISSDEFDSDDSDDDDDDDNNGDSKLIDDDEYLEQQLDEQYKLYQQR
E3KB01_PUCGT          VDSQDLSSDDDMEDIDGAEGSESPLDTDPEEDEDEEELSEDEAKLQTLEEGLDLAYDEYQ
SPB1_USTMA            DMFEISSGERVSKKALIQQADVSDDESETIVSSQHTDDDDPETRARRLDAEMDALYDEFK
SPB1_CRYNJ            DLEEGENEARRRGKNGGLATLVDDGEGMDLASESEEEEDEDEEDDEVLDSDEERERKTAA
A8N1R5_COPC7          DIFDLEHTQKSLRNRQEFITDADGDILVDDDEGLAGPDDDGDDEVLDTEDERERKVAQLE
SPB1_YARLI            QAERTGKLSELQKGKRSHVSETGDEHVTLEEAERVDYGSDDEANGLEDELESMYTEYLEN
SPB1_CANAL            LKTAE------------------------------KTGQLDKLAKGKKKMIFNDEELAKD
SPB1_SCHPO            LA----------------------------------------TAEKHGLKELENGTLPVT
SPB1_ASPFU            SLKRVERDGARDVIASGKLAEIESDSEDDQTESDYDESDDEGDRLERELDSLYEQYQERR
G4VQU5_SCHMA          ESNKLLGDTSNTGVDDLAREQIDAALKAKRKRLADERCSAVEGKKRVHFERRSGNQSDED
Q9N5N9_CAEEL          -----------------------------------DQEVFQLKKIRKAKELAEITKDTQA
A0A1X7UGH0_AMPQE      LNHIK------------------------------TSSQLEEVEGEDIDGDALETDDEET
E9G6A2_DAPPU          QIKTDQACIFNRFNNQTELNQIADQEADELAEEPREKPAPFPKKAKYDKETFQLDSKGRY
H2XWZ3_CIOIN          -----------------------------------NMVTSTNSQEDMELFALSKINSARK
SPB1_CHICK            I----------------------------------QRTQLLNEVARGDMASADALLEMRP
B7P3V3_IXOSC          IK---------------------------------SKKQLSKVEEADPSVLDPVQPLEED
Q7QD87_ANOGA          -----------------------------------KDVGTRQQLESILDQAPDFVVEDKS
Q9VXK5_DROME          -----------------------------------NIRTSAELDELLDVQPDFAVDESQP
E0VIT4_PEDHC          MIRSGKELDKVLDQKPEILPESDHSDDEQIKPKKIKYSKENSYLDNSGLYYKKKGEDDDD
A0A088A7G6_APIME      IKTHQQLENIM------------------------DQDPNILAESDIDSDTEQKKTKRII
C4M6R5_ENTHI          LFSI-------------------------------DDLKSQQDLDNFFNMTNPVELEEEE
A5K2F1_PLAVS          ENEIHFNKNMLKLLDEQSFEDHLNILSGSKHNDRLEINQENDSSSEKEDNAQPNDAGGES
Q8IDF8_PLAF7          ENEIHFNKDILKLLNKQKFEDHLKILNNDQKDD-LEIDHYEDTSSETEKLEHLNQL-KNS
Q4U8L6_THEAN          LQSYPEALPDGSESEETDIESKETDPESEETDVESQLPADIESEDTVIDSQLTDIESDIA
Q4N1B5_THEPA          ESLNLESLTELSQSHSNVESPAHSDRGSDLQSDLQSDVQSDIGSDVQSDIGSDVQSDIGS
G4LWM3_SCHMA          ------------------------------------------------------------
A0EER5_PARTE          QFSKHKNILKLGYVDVEDKQEEKLKKEKLEFNNQKQLDKNLELIYENKKQKKENALERIR
Q23MN4_TETTS          QKKQLKKQRKQKEKLLKGIAKKAIGVEFANDIVDEELYNMNQHKEVMNMEYVEMSDEDNK
MRM2_YEAST            ------------------------------------------------------------
MRM2_DROME            ------------------------------------------------------------
A4I305_LEIIN          GTNTDAFDDDGDAAAGGEDGEADELDHFTVEQLGLIPEKELAHIMDKTWTEPEDRGNDPL
K2MLU3_TRYCR          ETDGLMRDTEGNMQDEGDADDDDLDGNDDEGFTVEKLATVDEARLAKMFDKHVEELDERP
MRM2_CAEEL            ------------------------------------------------------------
B9QL21_TOXGV          KAIDLLEKKEAKMVDAELLLTGGEDDDGNRRGRHADGGEGEAVVAGSESEAEEEGSLEEL
MRM2_SCHPO            ------------------------------------------------------------
RLME_DESPS            ------------------------------------------------------------
RLME_PICTO            ------------------------------------------------------------
RLME_THEAC            ------------------------------------------------------------
RLME_THEVO            ------------------------------------------------------------
B9T000_RICCO          ------------------------------------------------------------
C1N352_MICPC          ------------------------------------------------------------
A5K6F5_PLAVS          --------------------------------------------------TLTGGKFQSK
Q8I365_PLAF7          -----------------------------------NNIVENNVTPNSDMLKNINKIINEY
RLME_PELUB            ------------------------------------------------------------
A8B3D0_GIAIC          ------------------------------------------------------------
TRM72_DROME           ------------------------------------------------------------
A2F7C6_TRIVA          ------------------------------------------------------------
Q586L7_TRYB2          ------------------------------------------------------------
A4HRN5_LEIIN          ------------------------------------------------------------
A0A0D1CBR1_USTMA      ------------------------------------------------------------
I7MGM4_TETTS          ------------------------------------------------------------
TRM71_DROME           ------------------------------------------------------------
D0NU18_PHYIT          ------------------------------------------------------------
TRM7_CAEEL            ------------------------------------------------------------
D0N6L4_PHYIT          ------------------------------------------------------------
G4VP71_SCHMA          ------------------------------------------------------------
TRM7_DICDI            ------------------------------------------------------------
A8J2Y5_CHLRE          ------------------------------------------------------------
TRM7_HUMAN            ------------------------------------------------------------
TRM7_SCHPO            ------------------------------------------------------------
I1RY63_GIBZE          ------------------------------------------------------------
RLME_TREPA            ------------------------------------------------------------
RLME_TREDE            ------------------------------------------------------------
RLME_BDEBA            ------------------------------------------------------------
RLME_DESVH            ------------------------------------------------------------
RLME_BORRA            ------------------------------------------------------------
RLME_BORAP            ------------------------------------------------------------
RLME_BORBP            ------------------------------------------------------------
RLME_BORBU            ------------------------------------------------------------
MRM2_MOUSE            ------------------------------------------------------------
RLME_WOLTR            ------------------------------------------------------------
RLME_ANAMM            ------------------------------------------------------------
RLME_RICFE            ------------------------------------------------------------
RLME_CAUVC            ------------------------------------------------------------
RLME_RHIME            ------------------------------------------------------------
RLME_BARQU            ------------------------------------------------------------
RLME_NITWN            ------------------------------------------------------------
RLME_ZYMMO            ------------------------------------------------------------
RLME_RUEPO            ------------------------------------------------------------
RLME_WIGBR            ------------------------------------------------------------
RLME_BUCAP            ------------------------------------------------------------
RLME_BUCBP            ------------------------------------------------------------
RLME_FRATT            ------------------------------------------------------------
RLME_ECOLI            ------------------------------------------------------------
RLME_BLOFL            ------------------------------------------------------------
RLME_BLOPB            ------------------------------------------------------------
RLME_COXBU            ------------------------------------------------------------
RLME_RALSO            ------------------------------------------------------------
RLME_NITEU            ------------------------------------------------------------
RLME_LEGPL            ------------------------------------------------------------
RLME_XANOR            ------------------------------------------------------------
RLME_PSYA2            ------------------------------------------------------------
RLME_NEIG1            ------------------------------------------------------------
RLME_AROAE            ------------------------------------------------------------
RLME_METMP            ------------------------------------------------------------
RLME_HALSA            ------------------------------------------------------------
RLME_NATPD            ------------------------------------------------------------
RLME_METTH            ------------------------------------------------------------
RLME_ARCFU            ------------------------------------------------------------
RLME_METMA            ------------------------------------------------------------
                                                                                  

RLME_TREPR            ------------------------------------------------------------
A9RQI9_PHYPA          DFDPEQDRQRYDQELDQYFERAYSKYCSTTDGSTKRRRRAKLGEAGDLWEDNEVTGQDDE
D0MRD5_PHYIT          DVKTRKAVKRTKVAKRALAGEALVQDSEMFDGDMKQYQKMINPDESSDESDDDEDDLNVS
SPB1_DICDI            IRKKAAKLDDVKVKKDKIGQDGYNEDDEEFVEEQEESNPLLVGNKRKEPDAQAVSSLFFD
E3KB01_PUCGT          ENQLRKDAKRKAREEARRSRHNEDQESEWAGCNDQDDQVDEEDDEIGSGDDIEVVRQKRA
SPB1_USTMA            QKQSERDAKFRAKQARLQDAKNDSWHGIKDDEENDEDDDEANLSDESEGGYDLVQRRKEQ
SPB1_CRYNJ            LEGELDGLYDSYVERKKERDAKWKVKQDRLKDKNFDAWHGIQEKSDEEGSDDDDGQDDDE
A8N1R5_COPC7          ADIDNLYDAYQERLRERDLKFKAKEARRKNAEREEWNGIAEKGSDDEDSDEDSEGGYDLV
SPB1_YARLI            KAARTAKSVVQRKKANVETEEWFGISDKKDGDESDGEMSADDVDMATIDDGEDEDDGKTA
SPB1_CANAL            NEIHIDEEEINDNDKDSADELDELENQLDDMYHQYQARKAERDANYRAKQARGDADDEAW
SPB1_SCHPO            ESVDEEVSTDNEVEYDSDDERDRLEADLDSMYSDYTKRKAESDVKYRVKKARGDLDDEEW
SPB1_ASPFU            EDRDSKVRAKKARKDYEAEEWDGFSDSDKEDDEESEEDGASQAVVKPAPPNSGTLSSKAA
G4VQU5_SCHMA          LSDNEPFGEIYAHNERDDLYLSSEESSEGESGKENGEDRNSTLSSEDESSEIDEDPNITS
Q9N5N9_CAEEL          PDFDMMEDGDSDEEEGLGEGEWETHGEEGENSDEDENELIHTEKSGMSKMEKRNARTESW
A0A1X7UGH0_AMPQE      ASAQRPLLVEEDYNIREDSSNEEEENEEGEIEYEESDDDDNDEDMELDNEDKSNPLVVSL
E9G6A2_DAPPU          RREEDSDEELIFDSDDEYESDVPQDSLGLDNATDESDGESKKQPKKVRFTEAIKAATKAV
H2XWZ3_CIOIN          MGTVMENVEEFELEEGSDEEGSGSSEEEEEEEEDEGDNEGNPLIHSLEDKVEDDYQTKLW
SPB1_CHICK            GDDDICVSDADDEDDVSLASDLDPEELVEIEARQRRLERERREQGVKRVKPKVEEEEEEE
B7P3V3_IXOSC          DDVCDSKRKLASYSKDRVNEDWYAEDDVSSETNENADSDDEEHEELLEFESDKEESGDEE
Q7QD87_ANOGA          DDEGAEDGEYVRYDRETKGDLFEDDKLLSTQRADSDSEIDSDFDEKGLAMESDDEELSFE
Q9VXK5_DROME          EETKLPKYKYFDKDEGNINDDLNYDDDNDEEQSEASDDEDQINDKQGLGLSDDDNDEGNA
E0VIT4_PEDHC          DDNDGEEEEMSIDSDEGLGLQSESDDDDDDDGGQKKKKGIKKNENP--------------
A0A088A7G6_APIME      YKKDKGHLDSSGLYYKSEDSEPDDSDDVSDNDSDSNKSDLGLNESDDENIKNIKKKNNTE
C4M6R5_ENTHI          EQRKKEEEENEKRAEQERLEQMTYDQRLDEQFEREYKEFLERRGKVKVLAKVGEMKRSVM
A5K2F1_PLAVS          QMDRIEYLVNLDYERQKMKEKKMNEEKNNEKLTRRKRAMDYKNEELMKIQKIMELKNEEL
Q8IDF8_PLAF7          DLDKLEYLVDLDYEKQKMKEKKLNEEKSNEKLSRRKRAMDFKNEELMKIQKMMELKNEQL
Q4U8L6_THEAN          TEIESEDTVVESDELEDYEMKRLMNMEIDLEVRHSIDKINEQNTKHVKLSRKQKAKLEQS
Q4N1B5_THEPA          DVQSDIGSDAQSDTEPSDEPSDELDDLEDEMSRLMKMEVDLEVRHSLDKLNAQENPKHVK
G4LWM3_SCHMA          ------------------------------------------------------------
A0EER5_PARTE          NKKQALESEQEEVDADELACKPIKRVKKQEDHLKVSDLKSKFFDKEGFQKLKEQLKTQKE
Q23MN4_TETTS          TKEKIPNKISFKNSKELEQNLEAMYEQKQLRQQISKKKKANKDEAQMDDSKIQVQSLNEN
MRM2_YEAST            ------------------------------------------------------------
MRM2_DROME            ------------------------------------------------------------
A4I305_LEIIN          NPVMSVNLASQDDWDLGDKKDGDESEAEGDDDGVPHSAQLVEGEEHFMDVDNYGNYVPAQ
K2MLU3_TRYCR          NDPLNPVMNANLNAEKDWDLGQESDGNSDASEGGNGPLQLVEGEEDGVDVDNYGNYIPAK
MRM2_CAEEL            ------------------------------------------------------------
B9QL21_TOXGV          DDVDRMEVELTLAHRLKKQREAEALAAGPKKKETRREKVTGEWVNELQAFRSAMQRRAGE
MRM2_SCHPO            ------------------------------------------------------------
RLME_DESPS            ------------------------------------------------------------
RLME_PICTO            ------------------------------------------------------------
RLME_THEAC            ------------------------------------------------------------
RLME_THEVO            ------------------------------------------------------------
B9T000_RICCO          ------------------------------------------------------------
C1N352_MICPC          ------------------------------------------------------------
A5K6F5_PLAVS          NFAHKNVDIFNFYCSDSDEEIKYFNSDDEEVVNEYIASEVFMNEKLFSFVATQNYYDSDK
Q8I365_PLAF7          DNDKNNLDIFNFYCSDSDEEIKYFNSEDEEVVNNYISSESFMSNKLFSFIATDNYYDSDK
RLME_PELUB            ------------------------------------------------------------
A8B3D0_GIAIC          ------------------------------------------------------------
TRM72_DROME           ------------------------------------------------------------
A2F7C6_TRIVA          ------------------------------------------------------------
Q586L7_TRYB2          ------------------------------------------------------------
A4HRN5_LEIIN          ------------------------------------------------------------
A0A0D1CBR1_USTMA      ------------------------------------------------------------
I7MGM4_TETTS          ------------------------------------------------------------
TRM71_DROME           ------------------------------------------------------------
D0NU18_PHYIT          ------------------------------------------------------------
TRM7_CAEEL            ------------------------------------------------------------
D0N6L4_PHYIT          ------------------------------------------------------------
G4VP71_SCHMA          ------------------------------------------------------------
TRM7_DICDI            ------------------------------------------------------------
A8J2Y5_CHLRE          ------------------------------------------------------------
TRM7_HUMAN            ------------------------------------------------------------
TRM7_SCHPO            ------------------------------------------------------------
I1RY63_GIBZE          ------------------------------------------------------------
RLME_TREPA            ------------------------------------------------------------
RLME_TREDE            ------------------------------------------------------------
RLME_BDEBA            ------------------------------------------------------------
RLME_DESVH            ------------------------------------------------------------
RLME_BORRA            ------------------------------------------------------------
RLME_BORAP            ------------------------------------------------------------
RLME_BORBP            ------------------------------------------------------------
RLME_BORBU            ------------------------------------------------------------
MRM2_MOUSE            ------------------------------------------------------------
RLME_WOLTR            ------------------------------------------------------------
RLME_ANAMM            ------------------------------------------------------------
RLME_RICFE            ------------------------------------------------------------
RLME_CAUVC            ------------------------------------------------------------
RLME_RHIME            ------------------------------------------------------------
RLME_BARQU            ------------------------------------------------------------
RLME_NITWN            ------------------------------------------------------------
RLME_ZYMMO            ------------------------------------------------------------
RLME_RUEPO            ------------------------------------------------------------
RLME_WIGBR            ------------------------------------------------------------
RLME_BUCAP            ------------------------------------------------------------
RLME_BUCBP            ------------------------------------------------------------
RLME_FRATT            ------------------------------------------------------------
RLME_ECOLI            ------------------------------------------------------------
RLME_BLOFL            ------------------------------------------------------------
RLME_BLOPB            ------------------------------------------------------------
RLME_COXBU            ------------------------------------------------------------
RLME_RALSO            ------------------------------------------------------------
RLME_NITEU            ------------------------------------------------------------
RLME_LEGPL            ------------------------------------------------------------
RLME_XANOR            ------------------------------------------------------------
RLME_PSYA2            ------------------------------------------------------------
RLME_NEIG1            ------------------------------------------------------------
RLME_AROAE            ------------------------------------------------------------
RLME_METMP            ------------------------------------------------------------
RLME_HALSA            ------------------------------------------------------------
RLME_NATPD            ------------------------------------------------------------
RLME_METTH            ------------------------------------------------------------
RLME_ARCFU            ------------------------------------------------------------
RLME_METMA            ------------------------------------------------------------
                                                                                  

RLME_TREPR            ------------------------------------------------------------
A9RQI9_PHYPA          SDGDDVIENADEDEAN------------------------------PLVVPLAEAPKLST
D0MRD5_PHYIT          LKVPEKSSAAVNRWFSDNKLFDGIDDKEELS---------------LPEMPKTDKEIRHT
SPB1_DICDI            NELFGGVEYRNPGDSESEPEQD--------------------------------------
E3KB01_PUCGT          KLQKGRQENDDDSDSEGEDVTLQAARIVA-----------------SRKTQRSTIKPLPA
SPB1_USTMA            EETFDTDDEEDEEDERLEREATQHSKKRKRDLAAPTADSFEMDAKPPKRSLVHSLVSDAD
SPB1_CRYNJ            EGGWDVIAQKKAKYGEGDSSDSDSDAEPETEV--------------PKKIKKVSFEKPAR
A8N1R5_COPC7          QQRKLEDGTSSSDDSDSDEDEDVVPKSK------------------KMKRPQKGDESSAP
SPB1_YARLI            RTLNNGN-----------------------------------------------------
SPB1_CANAL            NGIEEDNDDVESGKDYEMESESDDD------------------------DDEHIRLIAEK
SPB1_SCHPO            NGIDNGTESDDSQIAETNFATPDKDRL-------------------TTSLLDKGSTKDGL
SPB1_ASPFU            MFFDQDIFQGLGD-----------------------------------------------
G4VQU5_SCHMA          LSNLASLKSHSNDRRVKSKRQMILPPGLVLS------TSEQDKRNPLLVDLDDSEEIVKK
Q9N5N9_CAEEL          FEKEEISGLVSDEDDDDEMN------------------------------------AIEK
A0A1X7UGH0_AMPQE      EDKKKG-----------------------------------------------------K
E9G6A2_DAPPU          AVDERKHP--------------------------------------LLTDLEDDDSALKK
H2XWZ3_CIOIN          FGKEEFE-----------------------------------------------------
SPB1_CHICK            EEEENPL------------------------------------------LVPLEEKSVLQ
B7P3V3_IXOSC          ENLDDEDEENP-----------------------------------LLVDAAYGSTKKKR
Q7QD87_ANOGA          EDEDMKDPSDDEDRNP------------------------------LITDLDYRSKVDKR
Q9VXK5_DROME          KGKNKRKKRSENP---------------------------------LIKSNDFRDKNTKR
E0VIT4_PEDHC          ----------------------------------------------LLTDLDYRKSKEKK
A0A088A7G6_APIME      EDLENP----------------------------------------LLTDLDHRDKKTKR
C4M6R5_ENTHI          VQSSLNDGDIIRQADQKPREEVIEEID-------------------DVVHQKGILSSEGK
A5K2F1_PLAVS          MMKRKLHEYLSDDEETEE---------------------------------DATDDEDST
Q8IDF8_PLAF7          LMEKKLREYLSDEDDDEDDDDD------------------------DDDDDDDDDKEQEP
Q4U8L6_THEAN          NELKNFINKLQY----------------------------------EAQIHHMNQSDHSD
Q4N1B5_THEPA          LSKKQKHKLEQSNELKQ-----------------------------FINKLQYEAEVTHT
G4LWM3_SCHMA          ------------------------------------------------------------
A0EER5_PARTE          DVFDNPLKNQNITQLDKKKKEKTDKEQAADK---------------FKNDSDSDELEEKV
Q23MN4_TETTS          KFKNPHLKENEEMLESGIKRRKWFDKGVFND-------DFSDDSSMQSEDAGELDVPDDS
MRM2_YEAST            ------------------------------------------------------------
MRM2_DROME            ------------------------------------------------------------
A4I305_LEIIN          RSTRVTLYEAGLEGYEDSNDAEAADETPASKKKRAKAEKDAAQLEEAGKSSKWERHQLNI
K2MLU3_TRYCR          RSARVALYDAGLGEEEDDEEDTHNEEDAA-----------------LQKRKARDQQDLED
MRM2_CAEEL            ------------------------------------------------------------
B9QL21_TOXGV          ALAERRRAEEEEDDEEENEEDAEDAS--------------------KEVFEDEAPAGLRK
MRM2_SCHPO            ------------------------------------------------------------
RLME_DESPS            ------------------------------------------------------------
RLME_PICTO            ------------------------------------------------------------
RLME_THEAC            ------------------------------------------------------------
RLME_THEVO            ------------------------------------------------------------
B9T000_RICCO          ------------------------------------------------------------
C1N352_MICPC          ------------------------------------------------------------
A5K6F5_PLAVS          SYLLPQN-----------------------------------------------------
Q8I365_PLAF7          SYLLPEN-----------------------------------------------------
RLME_PELUB            ------------------------------------------------------------
A8B3D0_GIAIC          ------------------------------------------------------------
TRM72_DROME           ------------------------------------------------------------
A2F7C6_TRIVA          ------------------------------------------------------------
Q586L7_TRYB2          ------------------------------------------------------------
A4HRN5_LEIIN          ------------------------------------------------------------
A0A0D1CBR1_USTMA      ------------------------------------------------------------
I7MGM4_TETTS          ------------------------------------------------------------
TRM71_DROME           ------------------------------------------------------------
D0NU18_PHYIT          ------------------------------------------------------------
TRM7_CAEEL            ------------------------------------------------------------
D0N6L4_PHYIT          ------------------------------------------------------------
G4VP71_SCHMA          ------------------------------------------------------------
TRM7_DICDI            ------------------------------------------------------------
A8J2Y5_CHLRE          ------------------------------------------------------------
TRM7_HUMAN            ------------------------------------------------------------
TRM7_SCHPO            ------------------------------------------------------------
I1RY63_GIBZE          ------------------------------------------------------------
RLME_TREPA            ------------------------------------------------------------
RLME_TREDE            ------------------------------------------------------------
RLME_BDEBA            ------------------------------------------------------------
RLME_DESVH            ------------------------------------------------------------
RLME_BORRA            ------------------------------------------------------------
RLME_BORAP            ------------------------------------------------------------
RLME_BORBP            ------------------------------------------------------------
RLME_BORBU            ------------------------------------------------------------
MRM2_MOUSE            ------------------------------------------------------------
RLME_WOLTR            ------------------------------------------------------------
RLME_ANAMM            ------------------------------------------------------------
RLME_RICFE            ------------------------------------------------------------
RLME_CAUVC            ------------------------------------------------------------
RLME_RHIME            ------------------------------------------------------------
RLME_BARQU            ------------------------------------------------------------
RLME_NITWN            ------------------------------------------------------------
RLME_ZYMMO            ------------------------------------------------------------
RLME_RUEPO            ------------------------------------------------------------
RLME_WIGBR            ------------------------------------------------------------
RLME_BUCAP            ------------------------------------------------------------
RLME_BUCBP            ------------------------------------------------------------
RLME_FRATT            ------------------------------------------------------------
RLME_ECOLI            ------------------------------------------------------------
RLME_BLOFL            ------------------------------------------------------------
RLME_BLOPB            ------------------------------------------------------------
RLME_COXBU            ------------------------------------------------------------
RLME_RALSO            ------------------------------------------------------------
RLME_NITEU            ------------------------------------------------------------
RLME_LEGPL            ------------------------------------------------------------
RLME_XANOR            ------------------------------------------------------------
RLME_PSYA2            ------------------------------------------------------------
RLME_NEIG1            ------------------------------------------------------------
RLME_AROAE            ------------------------------------------------------------
RLME_METMP            ------------------------------------------------------------
RLME_HALSA            ------------------------------------------------------------
RLME_NATPD            ------------------------------------------------------------
RLME_METTH            ------------------------------------------------------------
RLME_ARCFU            ------------------------------------------------------------
RLME_METMA            ------------------------------------------------------------
                                                                                  

RLME_TREPR            ------------------------------------------------------------
A9RQI9_PHYPA          DHLSKQWFSQDVFDGVGEGEELSDDEEAIAKMRKKRKAETDAEVDADGDEDMGVGASELP
D0MRD5_PHYIT          KRKAAIERKERREKKKLKKEEKEYELEFGTEFDVAAPANSDDEAAMAAEAQEESDDEATA
SPB1_DICDI            -----------------GDDDQDDENNKPIDISKLKKQKPQAAQPITKKQKTTNSAEFGK
E3KB01_PUCGT          KKPKLLVDFEEETDNTVEAQASAADLWFDQPVFKAVGGVDGLIPDDSEGSDDGQDESRAN
SPB1_USTMA            VSAQQSREASIWFDNPLFKDLELDEQDAQEALEDDQDDEDAWEEEQDDEDDAEESDSEVE
SPB1_CRYNJ            SEKSSGLMTSLREPELRAQRSKQAQLWFDQPVFKEVGDLAALDGDDEEEEEEDESEEEES
A8N1R5_COPC7          KSKKRKLSPGPGTSTAIPAPSAASSLWFKQDVFAGVDGLDVSDEEDSAMEDGSEDGDSGS
SPB1_YARLI            -----MFFSNPIFDNLVNAAVAKTEAKPKALDLLEPGAKDLIELEKAKKRKYAKKNGLEY
SPB1_CANAL            KSNGSLSRTARNFFASDSIFNELSDDVILEEIENKTKGSNGKMVESIQEQVANDNNENDD
SPB1_SCHPO            SRKARMFFDQDIFDGIEDADADVEIMSMNRAAIKKREAELASQNNDDGSKGDQSEDSNDH
SPB1_ASPFU            -------------------------------VDDVEDEDSAIEMQEDDKSAKKGSALEKK
G4VQU5_SCHMA          KRKIDSWFGSDEIQEILAPLKEDENISMVMSSKKSKSNHSSNTVVKEKKREKKIVNDEVI
Q9N5N9_CAEEL          HIGKNRSKKTENYENTVSFDDSKGKKKGKKGGKGGEDDGFNTNDADEQASESESSDAEMD
A0A1X7UGH0_AMPQE      SQKTVRWFSNPLFEGVLSGEKDEEEEVAAAMERYKQKGGKIISKEEEQGSNDEDENDENN
E9G6A2_DAPPU          KKKADKWFMKSAFQDIDDEEDEDIELDSMVREHPLQRRGAVTTEDFTDDEADEDSDEEVH
H2XWZ3_CIOIN          -------------------------------NIADDLDELEEIESARKIYENRVEKKKKE
SPB1_CHICK            ERQTSLWFGKDAFAGIEDDADEDLELGQSQMLAERQRESQTGKTKKKGQKKKVPQESTAA
B7P3V3_IXOSC          LEMSKLWFEKDVFADIDDEKELLELEILADESRKNKKEKLSKKADKKPQREAAKKVTKKV
Q7QD87_ANOGA          LHRAQLWYEQEAFKKHNLQPNDEEVVDYDLDKMIEAYKKAGVTVLGTEGADKGKESEPLG
Q9VXK5_DROME          EQRVQLWYEKDVLQNIQSDDDEETYDLNNLAKEFKAKGVAVLGESTLTPDANEEVVQGKK
E0VIT4_PEDHC          LTKAALWFEKESLKNVETEADEDYDLDLLTQSLKKKGKKVIGEDKENEIPNVKKKGNGLK
A0A088A7G6_APIME      IHKAELWFEKDIFKNLEDEKDEDFELDKMVEEYRKKGGHIIGEDISADSDKENKIKNHKN
C4M6R5_ENTHI          NNKEDLWWSRNGMDDISVQMGILEEVLKKDQAKEEKLKGEVKNEIDDKYEEEVQGEDQVI
A5K2F1_PLAVS          DEGSDAAKGRPPHGKRGKDEMMNDEKNAYAEAIQQNQHIHKMVDKIIRLRKDVKREEEKS
Q8IDF8_PLAF7          KQQSDKHGDHQYDNKKSNSDNDVDSLETTQDIFKENKHIKSMVDKIIRLRRSVKNEEEKS
Q4U8L6_THEAN          TEPDVNYEQGDSNSDQGDSDIETPHRDIKQDDLNGNLDEDLISKRWFDNDIFKLNLHTNH
Q4N1B5_THEPA          NEQFTDSTQSDEESDADFDNSEPLDGDFDNSEALDDLVTKRWFDNDIFTLQTNNQGKYGK
G4LWM3_SCHMA          ------------------------------------------------------------
A0EER5_PARTE          MDPKQLKNLQKQIQDDLNQLDDNKDVDLLRRVDKKEMEYQKKLNAKITQDPLPGEDEKVK
Q23MN4_TETTS          EIDNDSLYDEEDKSKNKGFINPLKKSHLSSRQNGDDDDDEEFNFGSEDEQDDDQNNGYID
MRM2_YEAST            ------------------------------------------------------------
MRM2_DROME            ------------------------------------------------------------
A4I305_LEIIN          EKVLNDTFPKPKDHDRAKNKKRQRTLEEERIIMSVPTEMADPDKRKHVRTRFEDKDDDDS
K2MLU3_TRYCR          AGKQSKWLRHHVNIEKVLNQTFPKPRDNNRRKKRLLEEDRVELTATSPLHDGDLNGRADA
MRM2_CAEEL            ------------------------------------------------------------
B9QL21_TOXGV          ATAADRWFGQPIFAGLESPGVQDESDAECSPIGRSAGDVASDEQRLSDSEASSGDDEVET
MRM2_SCHPO            ------------------------------------------------------------
RLME_DESPS            ------------------------------------------------------------
RLME_PICTO            ------------------------------------------------------------
RLME_THEAC            ------------------------------------------------------------
RLME_THEVO            ------------------------------------------------------------
B9T000_RICCO          ------------------------------------------------------------
C1N352_MICPC          ------------------------------------------------------------
A5K6F5_PLAVS          ------------------------------------------------------------
Q8I365_PLAF7          ------------------------------------------------------------
RLME_PELUB            ------------------------------------------------------------
A8B3D0_GIAIC          ------------------------------------------------------------
TRM72_DROME           ------------------------------------------------------------
A2F7C6_TRIVA          ------------------------------------------------------------
Q586L7_TRYB2          ------------------------------------------------------------
A4HRN5_LEIIN          ------------------------------------------------------------
A0A0D1CBR1_USTMA      ------------------------------------------------------------
I7MGM4_TETTS          ------------------------------------------------------------
TRM71_DROME           ------------------------------------------------------------
D0NU18_PHYIT          ------------------------------------------------------------
TRM7_CAEEL            ------------------------------------------------------------
D0N6L4_PHYIT          ------------------------------------------------------------
G4VP71_SCHMA          ------------------------------------------------------------
TRM7_DICDI            ------------------------------------------------------------
A8J2Y5_CHLRE          ------------------------------------------------------------
TRM7_HUMAN            ------------------------------------------------------------
TRM7_SCHPO            ------------------------------------------------------------
I1RY63_GIBZE          ------------------------------------------------------------
RLME_TREPA            ------------------------------------------------------------
RLME_TREDE            ------------------------------------------------------------
RLME_BDEBA            ------------------------------------------------------------
RLME_DESVH            ------------------------------------------------------------
RLME_BORRA            ------------------------------------------------------------
RLME_BORAP            ------------------------------------------------------------
RLME_BORBP            ------------------------------------------------------------
RLME_BORBU            ------------------------------------------------------------
MRM2_MOUSE            ------------------------------------------------------------
RLME_WOLTR            ------------------------------------------------------------
RLME_ANAMM            ------------------------------------------------------------
RLME_RICFE            ------------------------------------------------------------
RLME_CAUVC            ------------------------------------------------------------
RLME_RHIME            ------------------------------------------------------------
RLME_BARQU            ------------------------------------------------------------
RLME_NITWN            ------------------------------------------------------------
RLME_ZYMMO            ------------------------------------------------------------
RLME_RUEPO            ------------------------------------------------------------
RLME_WIGBR            ------------------------------------------------------------
RLME_BUCAP            ------------------------------------------------------------
RLME_BUCBP            ------------------------------------------------------------
RLME_FRATT            ------------------------------------------------------------
RLME_ECOLI            ------------------------------------------------------------
RLME_BLOFL            ------------------------------------------------------------
RLME_BLOPB            ------------------------------------------------------------
RLME_COXBU            ------------------------------------------------------------
RLME_RALSO            ------------------------------------------------------------
RLME_NITEU            ------------------------------------------------------------
RLME_LEGPL            ------------------------------------------------------------
RLME_XANOR            ------------------------------------------------------------
RLME_PSYA2            ------------------------------------------------------------
RLME_NEIG1            ------------------------------------------------------------
RLME_AROAE            ------------------------------------------------------------
RLME_METMP            ------------------------------------------------------------
RLME_HALSA            ------------------------------------------------------------
RLME_NATPD            ------------------------------------------------------------
RLME_METTH            ------------------------------------------------------------
RLME_ARCFU            ------------------------------------------------------------
RLME_METMA            ------------------------------------------------------------
                                                                                  

RLME_TREPR            ------------------------------------------------------------
A9RQI9_PHYPA          AANHSANGAASLAPAVGKGDFEIAPQEGNSSSDSDSDSEDDNG-----------------
D0MRD5_PHYIT          EKKALIRSGMGAALKTDKDSDKFEVVAAGEEPDENALPIMDDRKYDSDHEEYDAED----
SPB1_DICDI            QKSKYQKNPTLDDKDDQDDDDDKGNSIKGFEEVPVQEEVEYESDSDEDIDD---------
E3KB01_PUCGT          DESICFDDDEDRNYLEAPGTEDSDSEMEADDPTGGVWDDELPDPDEKNAEIIREKGLLT-
SPB1_USTMA            GEQEVEDDDFEVVPQDQEEHAIPDEEWDLNGEDEEAGKQKRIKDHGLAT-----------
SPB1_CRYNJ            DDEDVDMEDASESSSTLEGDDDFEIVPQAPEDDGPEWDVDDEDQDEVKKKVIQDKGLLT-
A8N1R5_COPC7          DGDAMSVDEESWDSESGSDDDDFEIVPQDHSDDDTMWDVEDDDEDEAKREKIKKHGLAT-
SPB1_YARLI            SDSEDEEDDIVMETQKQDDSDIEYVHGESDSDDEPNIDLVT-------------------
SPB1_CANAL            GDNDEEESDFEIVPNQKSDDDDDDESMNSDDDEVSTTTKSTTHQQKVDLAT---------
SPB1_SCHPO            IEVVPVASAHDEDDDWNSDSDNDENNVEIVT-----------------------------
SPB1_ASPFU            APKEAKKKAQAPEDFSDSDPEEPDDPRKKNGQLDIDIIT---------------------
G4VQU5_SCHMA          NLQDNCVSSSSEIPIPKVSSEKLEKSLHRIRRLNRPLT----------------------
Q9N5N9_CAEEL          EVAKEKLSRFDAQIDLDDDDEEERYEDEGRRAAKRKCDKKIIGEDLKPVAKKRKLT----
A0A1X7UGH0_AMPQE      VEDLAISPTAVQHSGFDDDSDTSEDEEDVAPKKVRKLD----------------------
E9G6A2_DAPPU          VSDKVGKKPPPNKFDSDQDSDNDSSDDDDSDDSDESNLANGEDLDEGLPAAGGQVRGKKR
H2XWZ3_CIOIN          VEEKTEVQKKIEAYNSDSSDSDSDYDVEETLNEAKPVTTTKGKKQKTQKLD---------
SPB1_CHICK            EPQDAADTGADTAEAEAEQSSDDDSSSDEEGPPTPVGRKRGLVEPCGFEVVPIEDPVKKA
B7P3V3_IXOSC          TFADGLDNKERPLEEAVDTKAGAGKRNKFKQSDSESSSEDEELNKKSRPAPKKAKRVKLD
Q7QD87_ANOGA          KKARRRSKHDVNKLDGDESSDSSSSSEDEDEPQNAQAVGTMVHKTIEKVGGDSEGGFEIV
Q9VXK5_DROME          AKRRARHETATKDSSSESSESEDDANEDSDGEQPAAGTNAKKVRLS--------------
E0VIT4_PEDHC          SESVDEYDSDSDDEEEDENDDDDDTSDEETEGKRSKKKKKEGKSGEGGSTKQDKKRKLD-
A0A088A7G6_APIME      IKDDDENNNDLNNDDSDSDYDVNKMMKKSKKNEISDKNNSQTINSKLKKRKHLS------
C4M6R5_ENTHI          KEESDKEENEVVVSEDGESDEYEEAEDSNKDNESSEEDDELNWGPHMGKEKL--------
A5K2F1_PLAVS          NVNRFFDQKIFSTILNEMDGELDDSAAVQEGPKGRRARKGGDEDEDDDMGGDEDDDVGDD
Q8IDF8_PLAF7          NVNHFFDQNIFSNIFSQLDEEDIDAEFDSHIKNKKNVQKKDDSDKDGSISND--------
Q4U8L6_THEAN          STKQPKPPKQVEHPKLSKLSEQPELPNKSKENMDIKIVPAISNSEKEEIMGDVNK-----
Q4N1B5_THEPA          PPKQDRVENSDKPKLSNPSEERLKLSNPSEENVEMRVVPAISNSEREELLGDPEK-----
G4LWM3_SCHMA          ------------------------------------------------------------
A0EER5_PARTE          QFELNLPISDMEKRRRQLKKIAAREEKKAKQASDKDPNHKELEIVPEKRIEDYDIDQ---
Q23MN4_TETTS          MYDDTIYIGKRPKSAHDDIDPNEKVPGELSDDDAYIIQVPKSDMEKRRRAMKRAEKKKLK
MRM2_YEAST            ------------------------------------------------------------
MRM2_DROME            ------------------------------------------------------------
A4I305_LEIIN          SDDSVSELSAELSDGDLDDYEINRGREDSRRKRKLIPDIGKVTTQELIRQQRKQTLHDNK
K2MLU3_TRYCR          TRKRMRFDDRAEDDDDDEDDDDQSLSSLSEGRFSDDNRDLDVSEGRMDSRRKRATVPDMG
MRM2_CAEEL            ------------------------------------------------------------
B9QL21_TOXGV          EATSDVMRELADEELPAVPLSEKQKQKKRRATQAEKERNRQQRRQATDGIVGPDFDDDDD
MRM2_SCHPO            ------------------------------------------------------------
RLME_DESPS            ------------------------------------------------------------
RLME_PICTO            ------------------------------------------------------------
RLME_THEAC            ------------------------------------------------------------
RLME_THEVO            ------------------------------------------------------------
B9T000_RICCO          ------------------------------------------------------------
C1N352_MICPC          ------------------------------------------------------------
A5K6F5_PLAVS          ------------------------------------------------------------
Q8I365_PLAF7          ------------------------------------------------------------
RLME_PELUB            ------------------------------------------------------------
A8B3D0_GIAIC          ------------------------------------------------------------
TRM72_DROME           ------------------------------------------------------------
A2F7C6_TRIVA          ------------------------------------------------------------
Q586L7_TRYB2          ------------------------------------------------------------
A4HRN5_LEIIN          ------------------------------------------------------------
A0A0D1CBR1_USTMA      ------------------------------------------------------------
I7MGM4_TETTS          ------------------------------------------------------------
TRM71_DROME           ------------------------------------------------------------
D0NU18_PHYIT          ------------------------------------------------------------
TRM7_CAEEL            ------------------------------------------------------------
D0N6L4_PHYIT          ------------------------------------------------------------
G4VP71_SCHMA          ------------------------------------------------------------
TRM7_DICDI            ------------------------------------------------------------
A8J2Y5_CHLRE          ------------------------------------------------------------
TRM7_HUMAN            ------------------------------------------------------------
TRM7_SCHPO            ------------------------------------------------------------
I1RY63_GIBZE          ------------------------------------------------------------
RLME_TREPA            ------------------------------------------------------------
RLME_TREDE            ------------------------------------------------------------
RLME_BDEBA            ------------------------------------------------------------
RLME_DESVH            ------------------------------------------------------------
RLME_BORRA            ------------------------------------------------------------
RLME_BORAP            ------------------------------------------------------------
RLME_BORBP            ------------------------------------------------------------
RLME_BORBU            ------------------------------------------------------------
MRM2_MOUSE            ------------------------------------------------------------
RLME_WOLTR            ------------------------------------------------------------
RLME_ANAMM            ------------------------------------------------------------
RLME_RICFE            ------------------------------------------------------------
RLME_CAUVC            ------------------------------------------------------------
RLME_RHIME            ------------------------------------------------------------
RLME_BARQU            ------------------------------------------------------------
RLME_NITWN            ------------------------------------------------------------
RLME_ZYMMO            ------------------------------------------------------------
RLME_RUEPO            ------------------------------------------------------------
RLME_WIGBR            ------------------------------------------------------------
RLME_BUCAP            ------------------------------------------------------------
RLME_BUCBP            ------------------------------------------------------------
RLME_FRATT            ------------------------------------------------------------
RLME_ECOLI            ------------------------------------------------------------
RLME_BLOFL            ------------------------------------------------------------
RLME_BLOPB            ------------------------------------------------------------
RLME_COXBU            ------------------------------------------------------------
RLME_RALSO            ------------------------------------------------------------
RLME_NITEU            ------------------------------------------------------------
RLME_LEGPL            ------------------------------------------------------------
RLME_XANOR            ------------------------------------------------------------
RLME_PSYA2            ------------------------------------------------------------
RLME_NEIG1            ------------------------------------------------------------
RLME_AROAE            ------------------------------------------------------------
RLME_METMP            ------------------------------------------------------------
RLME_HALSA            ------------------------------------------------------------
RLME_NATPD            ------------------------------------------------------------
RLME_METTH            ------------------------------------------------------------
RLME_ARCFU            ------------------------------------------------------------
RLME_METMA            ------------------------------------------------------------
                                                                                  

RLME_TREPR            ------------------------------------------------------------
A9RQI9_PHYPA          ------------------------------------------------------------
D0MRD5_PHYIT          ------------------------------------------------------------
SPB1_DICDI            ------------------------------------------------------------
E3KB01_PUCGT          ------------------------------------------------------------
SPB1_USTMA            ------------------------------------------------------------
SPB1_CRYNJ            ------------------------------------------------------------
A8N1R5_COPC7          ------------------------------------------------------------
SPB1_YARLI            ------------------------------------------------------------
SPB1_CANAL            ------------------------------------------------------------
SPB1_SCHPO            ------------------------------------------------------------
SPB1_ASPFU            ------------------------------------------------------------
G4VQU5_SCHMA          ------------------------------------------------------------
Q9N5N9_CAEEL          ------------------------------------------------------------
A0A1X7UGH0_AMPQE      ------------------------------------------------------------
E9G6A2_DAPPU          SLT---------------------------------------------------------
H2XWZ3_CIOIN          ------------------------------------------------------------
SPB1_CHICK            RVLD--------------------------------------------------------
B7P3V3_IXOSC          ------------------------------------------------------------
Q7QD87_ANOGA          SSEKVRKPKKIKLS----------------------------------------------
Q9VXK5_DROME          ------------------------------------------------------------
E0VIT4_PEDHC          ------------------------------------------------------------
A0A088A7G6_APIME      ------------------------------------------------------------
C4M6R5_ENTHI          ------------------------------------------------------------
A5K2F1_PLAVS          ASDDEKFNEVDERQLPNIPLPNKLARKERKKKLRVKYGNNEVKMKNTTFSIVKTDESGQG
Q8IDF8_PLAF7          --DNESIKEIDEHNLPKIPLPDKLAKKEKKKKLKEKYGNNEVKMKNSSFSIVKTDENAQ-
Q4U8L6_THEAN          ------------------------------------------------------------
Q4N1B5_THEPA          ------------------------------------------------------------
G4LWM3_SCHMA          ------------------------------------------------------------
A0EER5_PARTE          ------------------------------------------------------------
Q23MN4_TETTS          KEENPQVKDDGFEIVPKQEDYDIDN-----------------------------------
MRM2_YEAST            ------------------------------------------------------------
MRM2_DROME            ------------------------------------------------------------
A4I305_LEIIN          EVRKQNKRNKNNTNSGKNSSGKQDTEFEEIPIAMTDPDI---------------------
K2MLU3_TRYCR          KLTTQELVRQQRKQTLKENAATRKQNVRNKSSARKDETGFEEIPVALTDPQI--------
MRM2_CAEEL            ------------------------------------------------------------
B9QL21_TOXGV          KTGLRGKTRIEEVPPPPAFQRPTDPEE---------------------------------
MRM2_SCHPO            ------------------------------------------------------------
RLME_DESPS            ------------------------------------------------------------
RLME_PICTO            ------------------------------------------------------------
RLME_THEAC            ------------------------------------------------------------
RLME_THEVO            ------------------------------------------------------------
B9T000_RICCO          ------------------------------------------------------------
C1N352_MICPC          ------------------------------------------------------------
A5K6F5_PLAVS          ------------------------------------------------------------
Q8I365_PLAF7          ------------------------------------------------------------
RLME_PELUB            ------------------------------------------------------------
A8B3D0_GIAIC          ------------------------------------------------------------
TRM72_DROME           ------------------------------------------------------------
A2F7C6_TRIVA          ------------------------------------------------------------
Q586L7_TRYB2          ------------------------------------------------------------
A4HRN5_LEIIN          ------------------------------------------------------------
A0A0D1CBR1_USTMA      ------------------------------------------------------------
I7MGM4_TETTS          ------------------------------------------------------------
TRM71_DROME           ------------------------------------------------------------
D0NU18_PHYIT          ------------------------------------------------------------
TRM7_CAEEL            ------------------------------------------------------------
D0N6L4_PHYIT          ------------------------------------------------------------
G4VP71_SCHMA          ------------------------------------------------------------
TRM7_DICDI            ------------------------------------------------------------
A8J2Y5_CHLRE          ------------------------------------------------------------
TRM7_HUMAN            ------------------------------------------------------------
TRM7_SCHPO            ------------------------------------------------------------
I1RY63_GIBZE          ------------------------------------------------------------
RLME_TREPA            ------------------------------------------------------------
RLME_TREDE            ------------------------------------------------------------
RLME_BDEBA            ------------------------------------------------------------
RLME_DESVH            ------------------------------------------------------------
RLME_BORRA            ------------------------------------------------------------
RLME_BORAP            ------------------------------------------------------------
RLME_BORBP            ------------------------------------------------------------
RLME_BORBU            ------------------------------------------------------------
MRM2_MOUSE            ------------------------------------------------------------
RLME_WOLTR            ------------------------------------------------------------
RLME_ANAMM            ------------------------------------------------------------
RLME_RICFE            ------------------------------------------------------------
RLME_CAUVC            ------------------------------------------------------------
RLME_RHIME            ------------------------------------------------------------
RLME_BARQU            ------------------------------------------------------------
RLME_NITWN            ------------------------------------------------------------
RLME_ZYMMO            ------------------------------------------------------------
RLME_RUEPO            ------------------------------------------------------------
RLME_WIGBR            ------------------------------------------------------------
RLME_BUCAP            ------------------------------------------------------------
RLME_BUCBP            ------------------------------------------------------------
RLME_FRATT            ------------------------------------------------------------
RLME_ECOLI            ------------------------------------------------------------
RLME_BLOFL            ------------------------------------------------------------
RLME_BLOPB            ------------------------------------------------------------
RLME_COXBU            ------------------------------------------------------------
RLME_RALSO            ------------------------------------------------------------
RLME_NITEU            ------------------------------------------------------------
RLME_LEGPL            ------------------------------------------------------------
RLME_XANOR            ------------------------------------------------------------
RLME_PSYA2            ------------------------------------------------------------
RLME_NEIG1            ------------------------------------------------------------
RLME_AROAE            ------------------------------------------------------------
RLME_METMP            ------------------------------------------------------------
RLME_HALSA            ------------------------------------------------------------
RLME_NATPD            ------------------------------------------------------------
RLME_METTH            ------------------------------------------------------------
RLME_ARCFU            ------------------------------------------------------------
RLME_METMA            ------------------------------------------------------------
                                                                                  

RLME_TREPR            ------------------------------------------------------------
A9RQI9_PHYPA          ---------------KAEILAYAKKMLKKKNRESILDDAYNRYT--FNDEDMPRWFADDE
D0MRD5_PHYIT          ---------------RAKTLALASMMIHKSKAKDMIDASYNRYA-WNDSEALPDWFADDE
SPB1_DICDI            ---------------KIKTKALGEFLIRKKSRQDLIDDSFNKYA--FNDTGLPNWFTDDE
E3KB01_PUCGT          ---------------PQAIQLALDLVNRKKTKDQLVDSGFKRDAFFDDKNELPTWFLDDE
SPB1_USTMA            ---------------AEAVALAQALVNRQITKEDLMDQGFSKHN-FVDKDGLPTWFLDDE
SPB1_CRYNJ            ---------------AEAVSLATALVNRKTTADKLIDQGFNRLS-AHNKDGLPTWFLDDE
A8N1R5_COPC7          ---------------AEAVTLAQQLVNRQKTKTELINDGFNRYS-LNAKDGLPSWFVEEE
SPB1_YARLI            ---------------DQAMTMAHQLATGQTNKHKLQDDGYNRYS-FRDLDGLPQWFQDDE
SPB1_CANAL            ---------------VEAMTLAHQVALGQKNKYDLIDEGINRYS-FRDKDNLPDWFIDDE
SPB1_SCHPO            ---------------AEAMTLAQDIASRRKSKADLIDEGYNRWS-FQSKEGLPDWFLDEE
SPB1_ASPFU            ---------------AEAMALAQQMATGEKKSQDIIDDGFNRYT-FRDVDGLPEWFLDDE
G4VQU5_SCHMA          ---------------AEERAIATRLIHSAKSRRELLESGYNRYQFFEKSSDLPDWFIEDE
Q9N5N9_CAEEL          ---------------PEQLAIGEQMIYSAKAARNLEDEAWNRYA--NNDEDLPDWFADDE
A0A1X7UGH0_AMPQE      ---------------PAGLAIGALLVQSRKKRQDLIESGYNRWT--SDDPNLPDWFREDE
E9G6A2_DAPPU          ---------------AEALALGSMIIQSRKARRDISDDGWNRYA--FNDENLPDWFEADE
H2XWZ3_CIOIN          ---------------AEALALGTVIATSNKRKRDVIDDSFNRYTFNDEECALPDWFLEDE
SPB1_CHICK            ---------------AEGLALGSVIATSKKAKRDLIDDSFNRYSFNEEEGELPEWFTEEE
B7P3V3_IXOSC          ---------------PEALALGSMMIHSQKARRDIIDSGYNRYT--FNDENLPKWFTEEE
Q7QD87_ANOGA          ---------------EEELALGQMIISGKKTRRDIIDAAFNRYM--FNDTNLPDWFVADE
Q9VXK5_DROME          ---------------ENEMALGALLTRSKKTRRDLIDAAWNRYA--FNDENVPVWFKLDE
E0VIT4_PEDHC          ---------------EEGLALGSMMIQSKKKKRDLIDGAWNRYA--FNDDNLPEWFVTDE
A0A088A7G6_APIME      ---------------EEDLALGSLLIQSKKTRRDLIDSAWNRYA--FNDEKLPDWFMQDE
C4M6R5_ENTHI          ---------------SQALIVAGRIVKDPKQKKRLLEQHISRWT-LPEDEDTPAWFRHEE
A5K2F1_PLAVS          NVGAYFSNLIKDEDELAFIKCIGEKLIHKKSRMDLIDDSFNRHSYLEDEDMLPEWFVEEE
Q8IDF8_PLAF7          NLNNYFSNLVKDEDELAFIKCIGEKLIHKKSRMDLIDDSFNRYSYMEDESNLPDWFLEEE
Q4U8L6_THEAN          ---------------LAEIQALGSLMINKKTRMALIDGAYNKRT--FTDEDLPSWFVEDE
Q4N1B5_THEPA          ---------------LAEFQALGSLMINKKTRMALIDGAYNKRT--FTDEDLPSWFVEDE
G4LWM3_SCHMA          ------------------------------------------------------------
A0EER5_PARTE          ---------------LASNLALAKKMMRKKTREQIIENSFGRDK--WEDQDLPQWFVDDE
Q23MN4_TETTS          ---------------LAETLALAKKMQRKRAREDIIDSTYSRYA-FEDQDNLPTWFIEDE
MRM2_YEAST            ------------------------------------------------------------
MRM2_DROME            ------------------------------------------------------------
A4I305_LEIIN          ---------------RARTLAIAQKMLDPKARREILDASVNRYV-FNDDDDLPDWFVKDE
K2MLU3_TRYCR          ---------------RARTLAIATKMLDPKSRRDILDASINRYT-FNDDDDLPDWFIKDE
MRM2_CAEEL            ------------------------------------------------------------
B9QL21_TOXGV          ---------------IAHIQALGSLMVQKSTRMDLLDGAYNRYA--FKDDALPEWFAEDE
MRM2_SCHPO            ------------------------------------------------------------
RLME_DESPS            ------------------------------------------------------------
RLME_PICTO            ------------------------------------------------------------
RLME_THEAC            ------------------------------------------------------------
RLME_THEVO            ------------------------------------------------------------
B9T000_RICCO          ------------------------------------------------------------
C1N352_MICPC          ------------------------------------------------------------
A5K6F5_PLAVS          ------------------------------------------------------------
Q8I365_PLAF7          ------------------------------------------------------------
RLME_PELUB            ------------------------------------------------------------
A8B3D0_GIAIC          ------------------------------------------------------------
TRM72_DROME           ------------------------------------------------------------
A2F7C6_TRIVA          ------------------------------------------------------------
Q586L7_TRYB2          ------------------------------------------------------------
A4HRN5_LEIIN          ------------------------------------------------------------
A0A0D1CBR1_USTMA      ------------------------------------------------------------
I7MGM4_TETTS          ------------------------------------------------------------
TRM71_DROME           ------------------------------------------------------------
D0NU18_PHYIT          ------------------------------------------------------------
TRM7_CAEEL            ------------------------------------------------------------
D0N6L4_PHYIT          ------------------------------------------------------------
G4VP71_SCHMA          ------------------------------------------------------------
TRM7_DICDI            ------------------------------------------------------------
A8J2Y5_CHLRE          ------------------------------------------------------------
TRM7_HUMAN            ------------------------------------------------------------
TRM7_SCHPO            ------------------------------------------------------------
I1RY63_GIBZE          ------------------------------------------------------------
RLME_TREPA            ------------------------------------------------------------
RLME_TREDE            ------------------------------------------------------------
RLME_BDEBA            ------------------------------------------------------------
RLME_DESVH            ------------------------------------------------------------
RLME_BORRA            ------------------------------------------------------------
RLME_BORAP            ------------------------------------------------------------
RLME_BORBP            ------------------------------------------------------------
RLME_BORBU            ------------------------------------------------------------
MRM2_MOUSE            ------------------------------------------------------------
RLME_WOLTR            ------------------------------------------------------------
RLME_ANAMM            ------------------------------------------------------------
RLME_RICFE            ------------------------------------------------------------
RLME_CAUVC            ------------------------------------------------------------
RLME_RHIME            ------------------------------------------------------------
RLME_BARQU            ------------------------------------------------------------
RLME_NITWN            ------------------------------------------------------------
RLME_ZYMMO            ------------------------------------------------------------
RLME_RUEPO            ------------------------------------------------------------
RLME_WIGBR            ------------------------------------------------------------
RLME_BUCAP            ------------------------------------------------------------
RLME_BUCBP            ------------------------------------------------------------
RLME_FRATT            ------------------------------------------------------------
RLME_ECOLI            ------------------------------------------------------------
RLME_BLOFL            ------------------------------------------------------------
RLME_BLOPB            ------------------------------------------------------------
RLME_COXBU            ------------------------------------------------------------
RLME_RALSO            ------------------------------------------------------------
RLME_NITEU            ------------------------------------------------------------
RLME_LEGPL            ------------------------------------------------------------
RLME_XANOR            ------------------------------------------------------------
RLME_PSYA2            ------------------------------------------------------------
RLME_NEIG1            ------------------------------------------------------------
RLME_AROAE            ------------------------------------------------------------
RLME_METMP            ------------------------------------------------------------
RLME_HALSA            ------------------------------------------------------------
RLME_NATPD            ------------------------------------------------------------
RLME_METTH            ------------------------------------------------------------
RLME_ARCFU            ------------------------------------------------------------
RLME_METMA            ------------------------------------------------------------
                                                                                  

RLME_TREPR            ------------------------------------------------------------
A9RQI9_PHYPA          KKH---NRPEKPITKEEVEAMKAQFREINARPVKKVAEAKARKKRRVLKKLEQARQKATA
D0MRD5_PHYIT          DKH---YRPQIPIPKNVLAQMKERFMEMATKPVKKVAEARGRKQRMQLKKLKAAKKKATD
SPB1_DICDI            NRH---NKAQTPLTKEMVDEIRRKIKEIDDRPIKKIAEAKARKKYRLGKKMEKTRDKASS
E3KB01_PUCGT          MRH---FREHVPVTKEAVKILRDKMRALNARPIKKIAEAKGRKKLRTLRRLEKAQSKANT
SPB1_USTMA            QKH---YKANIPITKEAIQALRERQRALDARPIKKVAEAKARKKMRTLRRLEKAQKKAET
SPB1_CRYNJ            SQF---YKPNIPITKEAVDALRARQRALDARPIKKVAEAKGRKKMKAVARMEKAKKKADG
A8N1R5_COPC7          AKH---YKPNIPITKEAVAALREKQRALDARPIKKIAEAKARKKLKAQQRLERAMKKAEG
SPB1_YARLI            NKH---NKLNKPITKEAVEALKQKMKTLNARPIKKVLEAKGRKKMRALRRLEQMKKKSEL
SPB1_CANAL            KKH---SKLIKPITKEAAIAIKEKQKQLNARPIKKVLEAQSRKKLRALKRLEKIKKKSDL
SPB1_SCHPO            TTV---NKPNKPITKEAVLALREKMKALNARPIKKVLEAQGRKKMRTIKRLQRVAKKAEG
SPB1_ASPFU            NKH---SKPQRPITKAAAAAIKEKLRAINARPIKKVMEAKGRKKMKAAQRLEKLRKKSAL
G4VQU5_SCHMA          KKH---MRKPIIVKKEEIPVDVPTM----GRSLSKAEQAKARKKARLAKRLKRIRQKAEG
Q9N5N9_CAEEL          KKH---YFKQTPVTKEQVALYRERMREFNARPSKKVAEAKARKQKKMQRKLESAKKKAEG
A0A1X7UGH0_AMPQE      SSH---CQKQLPITKDMVDEYRKRLKEINARPIKKIAEAKARKKQRAARKLTKAREKARV
E9G6A2_DAPPU          RRH---SHKELPITKEVVQQYKDKMKEINVRPIKKVVEAKARKKRRTMRRMEKARKKADT
H2XWZ3_CIOIN          KKRVVKNHLRHHVSKDMMDFYGSKDKGINVRTIKKVVEAKARKKRKATKKMEKARKQAEG
SPB1_CHICK            KQH---RRKQIPLDKQTVEEYRQRWRQINARPIKKVAEAKARKKRRMLKKMEQMKKKAEA
B7P3V3_IXOSC          KKH---TRKHMPVTAEMVAEYKAQLKAVNARPIKKVAEAKARKKQRAARRLEKARKRAEA
Q7QD87_ANOGA          LKT---MQRHLPVPEDVVEKYRKSKDEFNVRTIKKVMEAKARKKRHATKRLEKIKKKAET
Q9VXK5_DROME          DEH---MTKPTPVPKELTAEYQRKLQEVNVRPIKKVMEAKARKHRRATKRLAKAKKMAEK
E0VIT4_PEDHC          KVH---MHQNIPVPTEMVQEYRNKLKEINVRPIKKIVEAKARKKRRMMKSLQRANKKMEK
A0A088A7G6_APIME      EKH---MKNVIPVPNELVNEYKKRVEDLNIRPIKKVIEAKARKKRRALRKLEKAKKKVES
C4M6R5_ENTHI          EEH---NKLTLPETKEEVAAMRRRLREIDSAPIKKAWEAEARKKKKLQTRMRALEQQASK
A5K2F1_PLAVS          KKF---RRPVIPIDKSILNQYKSSINKITKMPIKKVIEAKMRNKKREIAKMKKLEAKIGK
Q8IDF8_PLAF7          KKY---RRPVIPIDKKILDEYKGKINKITKMPIKKVIEAKMRNRKREITKMKKLEAKIGK
Q4U8L6_THEAN          NKH---NKPQYPVTKELMKKYKAKLLELKNRPIKKVLEAKHRKALRAKKKLKSILPKIEA
Q4N1B5_THEPA          NKH---NKPQYPVTKELVKKYKQKLLELKNRPIKKVLEAKHRKAQRAKKRLRSILPKIEA
G4LWM3_SCHMA          ------------------------------------------------------------
A0EER5_PARTE          ERH---VFKMEPITKEEFQQEKQRLYEINSRVPKKIMEAKIRKWKKAQKKLKTAAKKAQT
Q23MN4_TETTS          KQH---NFKHLPITKEEIQAEKERLMAINRRAPKKIIEAKIRNYKRMEKKMKKAKNKANQ
MRM2_YEAST            ------------------------------------------------------------
MRM2_DROME            ------------------------------------------------------------
A4I305_LEIIN          QRN---CRVVLPVTAEEIEEQRRRFQELNARPSRKVMEAMGRKRRKAQRMLRSLIDKGKA
K2MLU3_TRYCR          QRN---CKVVLPVTAEEIEVQRQRFREMNARPGKKVMEAVQRKRRRAQRMLRSMIEKGKT
MRM2_CAEEL            ------------------------------------------------------------
B9QL21_TOXGV          EAH---TRPELPVTKELMREYRQKLLDISRRPIRKVREARARKKMREQRRLQKVKSQVAA
MRM2_SCHPO            ------------------------------------------------------------
RLME_DESPS            ------------------------------------------------------------
RLME_PICTO            ------------------------------------------------------------
RLME_THEAC            ------------------------------------------------------------
RLME_THEVO            ------------------------------------------------------------
B9T000_RICCO          ------------------------------------------------------------
C1N352_MICPC          ------------------------------------------------------------
A5K6F5_PLAVS          ------YVRHEPQLMPLQPPYLLSLQKKRQEGKKP-------------------------
Q8I365_PLAF7          ------YVRHEPQLMPLKPPYMLSLQKKRQEVKK--------------------------
RLME_PELUB            ------------------------------------------------------------
A8B3D0_GIAIC          --------------NFSLCTDSTLIGSSVGTVSERPSTCRNSFTLDFLLRESIDK-----
TRM72_DROME           ------YVYKEPVQQPLTAAYQDILQKTSQVNIKYEGIRVIHDEEMLKKWLENDENKSEK
A2F7C6_TRIVA          ------------------------------------------------------------
Q586L7_TRYB2          ------DVVLPPVQPPLQAPYIAISEAVKERTKRQRVG----------------------
A4HRN5_LEIIN          ------ADVLEPVQPPLQAPYLAAAAASPSQLAEVADGRDTEADASQKKKIRVESPTATA
A0A0D1CBR1_USTMA      ------------------------------------------------------------
I7MGM4_TETTS          ------------------------------------------------------------
TRM71_DROME           ------YVYDAVMDDASYPLEFKEILKQVYDEQRHII-----------------------
D0NU18_PHYIT          ------YVHQEPLQKPINPPYANALKKQQHK-----------------------------
TRM7_CAEEL            ------YEFKDVVQPPTDPAYKAALDKKKSGVFAKMSADLNRQLKAELSRGKDQKKTPAE
D0N6L4_PHYIT          ------------------------------------------------------------
G4VP71_SCHMA          ------HIVKPPVQVPVDPAYSEVCRFSRLNQSNTSKFQSLEKNNEIDDNDDISRFTKLM
TRM7_DICDI            ------------------------------------------------------------
A8J2Y5_CHLRE          ------YVRLEPVQPPTAPNYKTAIALAKGAGGGGL------------------------
TRM7_HUMAN            ------YKYTPPTQPPISPPYQEACTLKRKGQLAKEIRPQDCPISRVDTFPQPLAAPQCH
TRM7_SCHPO            ------KATLDVIQPPTAPPYKRAIELKHSKMMS--------------------------
I1RY63_GIBZE          ------YVSLDPVQPPIAPPYKRAIEMRAAMSGSQR------------------------
RLME_TREPA            ------------------------------------------------------------
RLME_TREDE            ------------------------------------------------------------
RLME_BDEBA            ------------------------------------------------------------
RLME_DESVH            ------------------------------------------------------------
RLME_BORRA            ------------------------------------------------------------
RLME_BORAP            ------------------------------------------------------------
RLME_BORBP            ------------------------------------------------------------
RLME_BORBU            ------------------------------------------------------------
MRM2_MOUSE            ------------------------------------------------------------
RLME_WOLTR            ------------------------------------------------------------
RLME_ANAMM            ------------------------------------------------------------
RLME_RICFE            ------------------------------------------------------------
RLME_CAUVC            ------------------------------------------------------------
RLME_RHIME            ------------------------------------------------------------
RLME_BARQU            ------------------------------------------------------------
RLME_NITWN            ------------------------------------------------------------
RLME_ZYMMO            ------------------------------------------------------------
RLME_RUEPO            ------------------------------------------------------------
RLME_WIGBR            ------------------------------------------------------------
RLME_BUCAP            ------------------------------------------------------------
RLME_BUCBP            ------------------------------------------------------------
RLME_FRATT            ------------------------------------------------------------
RLME_ECOLI            ------------------------------------------------------------
RLME_BLOFL            ------------------------------------------------------------
RLME_BLOPB            ------------------------------------------------------------
RLME_COXBU            ------------------------------------------------------------
RLME_RALSO            ------------------------------------------------------------
RLME_NITEU            ------------------------------------------------------------
RLME_LEGPL            ------------------------------------------------------------
RLME_XANOR            ------------------------------------------------------------
RLME_PSYA2            ------------------------------------------------------------
RLME_NEIG1            ------------------------------------------------------------
RLME_AROAE            ------------------------------------------------------------
RLME_METMP            ------------------------------------------------------------
RLME_HALSA            ------------------------------------------------------------
RLME_NATPD            ------------------------------------------------------------
RLME_METTH            ------------------------------------------------------------
RLME_ARCFU            ------------------------------------------------------------
RLME_METMA            ------------------------------------------------------------
                                                                                  

RLME_TREPR            ------------------------------------------------------------
A9RQI9_PHYPA          IADQEDISNKSKQKSMERVYKKALAAPKRGKTEVVVAKKGVGARGGKGRIVVDRRLRKDS
D0MRD5_PHYIT          IANLPDMSTREKLKAIDRAMKGARLKKESK------VYVVSNRGGSRTADGKKIGKGKKV
SPB1_DICDI            IVDNPEMSNREKSKAIEKLYSGTDKKNMKP----------KKIIMIAKKSKTAGGGTGKY
E3KB01_PUCGT          VNETNDLTEKEKSLEIEKLMSRMHKSPKTK----SDIKIVVAKGANRGQKGRPRGVKGRY
SPB1_USTMA            INENEDISEKEKSNTINKLLAKSVKGAQKK----KEVQLVVAKGVNRGLKGRPKGTKGRY
SPB1_CRYNJ            VMESEEMGDGEKARQVRRMLARAAKGKEKA----KEKKIVVAKGVNKGVKGRPTGVKGKY
A8N1R5_COPC7          VISTTDMTEREKAQQIEKLMRKGTSKKKEK----KEVKVVVARGATKGVKGRPKGVKGRY
SPB1_YARLI            INEDGARSEKEKADDISKLMRKLAKPQKSK---KKTVTVVYAGGKNKGIAGRPRGVTGKY
SPB1_CANAL            INEDSGKSERDKADEISKLMKKLNKKQKQK----PKTTVVVARGSNRGLSGRPKGVKGKY
SPB1_SCHPO            ISESGDMTESEKAKEISRLVSRATKSKPKA-----KPTLVVAKGPNKGLKSRPKGVKGKY
SPB1_ASPFU            LADDEALSERDKSQAIAKLMSKAVKKKPKQ-----QVKLVVARGANRGISGRPRGVKGKY
G4VQU5_SCHMA          ISD--EIPETEKWQQIKQLYKKAGLLKRKR-RPLHVVVNTK---AGSRSGGTKPQKGAKI
Q9N5N9_CAEEL          ILENDQMEHSEKVREMKKVYANATRKEKKK-VELVR--------MTKGKKGKTGRPNGQY
A0A1X7UGH0_AMPQE      ICDTPDVTDQEKVRQIKGIYKKAGLTSNKK----RDVQYVVAKRGLGKRVKRPAGVSGRF
E9G6A2_DAPPU          ISETMGMSDYDKAQQIRHIHKKAKQEKKKE-----VTYVVAKKHQAGKKAHRPAGVKGQF
H2XWZ3_CIOIN          ISDTADMSTKEKAAHIKNIYKKAGLLKKKK----ENTTYVFAKRGTGKRVRRPPGVSGKF
SPB1_CHICK            VVSTVDISEREKVAQLRRIYKKAGLGKEKR-----QVTYLVAKKGVGPRVRRPPGVKGQF
B7P3V3_IXOSC          ITEKLDMTDAEKAQQVRAIYKKVLGDKGKN-----KVTYLVAKKATGRKVRRPPGVKGRF
Q7QD87_ANOGA          IMENVDNTNQEKIRLLKKLYKKADAKKKDV-----TYVVAKKTGVSGKKVRRPKGVEGRF
Q9VXK5_DROME          IMENSDATNHEKSKQLKKVYKKAQEKKKEV------TYVVAKKQTAARRARRPAGVKGRY
E0VIT4_PEDHC          IMDDVDISDREKVRNIQKIYKKAKEKGKDK---KKVTYIVAKRVNAGKRYKKPRGVKGPY
A0A088A7G6_APIME      IMDNTDISNKEKAKQIQTLYKKAYKEPKKD-----VTYVVMKKHMTQKKTKRPPGVKGRY
C4M6R5_ENTHI          IEGDGEMNSKEQLRILTKKAKKLNKKFSTH---------EGVRFVSSKTGKTVGGSSGRM
A5K2F1_PLAVS          IEKDEEDPFLKHKAITNILKKNKSEKKREK-----SYVVCTGKGSRVSNKKNKKGGRTMV
Q8IDF8_PLAF7          IEKNEDDPFLKQKAITNLLKKNKSDKKRDK-----SYIVCTGKGSKMAKKKKNKKGKTMV
Q4U8L6_THEAN          ISNDRESTENPN-KLLRGLKKIQSTKRQKVYVISRRSNFNKLTKGGKQKSNKSKGSRKVL
Q4N1B5_THEPA          ISNDRESTENPK-KLLRGLKKIQSTRRQKVYVISRRANVGKLSKQSKSGKSSGKGARKVL
G4LWM3_SCHMA          ------------------------------------------------------------
A0EER5_PARTE          VFDTDGINQKTKMQQVRRIYNKEKANIQKE-QERKVIVARKGQASGKFKSSRKVLTVDKR
Q23MN4_TETTS          IMETEGISEQMKIKQVKSLYAKEKRGLKQEKKYI-----------VGKKGTAPGKNSRFV
MRM2_YEAST            ------------------------------------------------------------
MRM2_DROME            ------------------------------------------------------------
A4I305_LEIIN          DPRAREKAENLSVRKLMRSQVVKGQGKKRHKYLDRQLMGRMRREKQKLKRRK--------
K2MLU3_TRYCR          DPRAREKANNASVRKLMRSQAVKGDAKRKKKGPLDRKKWAKCGVRNKDLNAAVNYY----
MRM2_CAEEL            ------------------------------------------------------------
B9QL21_TOXGV          VAESTEFTEASKARAIDKIARKARHAEEKRGKDYVVTRRVGGGKLAQKKAGKKGGGNNRV
MRM2_SCHPO            ------------------------------------------------------------
RLME_DESPS            ------------------------------------------------------------
RLME_PICTO            ------------------------------------------------------------
RLME_THEAC            ------------------------------------------------------------
RLME_THEVO            ------------------------------------------------------------
B9T000_RICCO          ------------------------------------------------------------
C1N352_MICPC          ------------------------------------------------------------
A5K6F5_PLAVS          ------------------------------------------------------------
Q8I365_PLAF7          ------------------------------------------------------------
RLME_PELUB            ------------------------------------------------------------
A8B3D0_GIAIC          ------------------------------------------------------------
TRM72_DROME           LGACVT------------------------------------------------------
A2F7C6_TRIVA          ------------------------------------------------------------
Q586L7_TRYB2          ------------------------------------------------------------
A4HRN5_LEIIN          GRDSSTGGEEQQ------------------------------------------------
A0A0D1CBR1_USTMA      ------------------------------------------------------------
I7MGM4_TETTS          ------------------------------------------------------------
TRM71_DROME           ------------------------------------------------------------
D0NU18_PHYIT          ------------------------------------------------------------
TRM7_CAEEL            NVPSVEELEKAAEKFQL-------------------------------------------
D0N6L4_PHYIT          ------------------------------------------------------------
G4VP71_SCHMA          EKLSFDSREDNL------------------------------------------------
TRM7_DICDI            ------------------------------------------------------------
A8J2Y5_CHLRE          ------------------------------------------------------------
TRM7_HUMAN            TLLAPEMEDNEMSCSP--------------------------------------------
TRM7_SCHPO            ------------------------------------------------------------
I1RY63_GIBZE          ------------------------------------------------------------
RLME_TREPA            ------------------------------------------------------------
RLME_TREDE            ------------------------------------------------------------
RLME_BDEBA            ------------------------------------------------------------
RLME_DESVH            ------------------------------------------------------------
RLME_BORRA            ------------------------------------------------------------
RLME_BORAP            ------------------------------------------------------------
RLME_BORBP            ------------------------------------------------------------
RLME_BORBU            ------------------------------------------------------------
MRM2_MOUSE            ------------------------------------------------------------
RLME_WOLTR            ------------------------------------------------------------
RLME_ANAMM            ------------------------------------------------------------
RLME_RICFE            ------------------------------------------------------------
RLME_CAUVC            ------------------------------------------------------------
RLME_RHIME            ------------------------------------------------------------
RLME_BARQU            ------------------------------------------------------------
RLME_NITWN            ------------------------------------------------------------
RLME_ZYMMO            ------------------------------------------------------------
RLME_RUEPO            ------------------------------------------------------------
RLME_WIGBR            ------------------------------------------------------------
RLME_BUCAP            ------------------------------------------------------------
RLME_BUCBP            ------------------------------------------------------------
RLME_FRATT            ------------------------------------------------------------
RLME_ECOLI            ------------------------------------------------------------
RLME_BLOFL            ------------------------------------------------------------
RLME_BLOPB            ------------------------------------------------------------
RLME_COXBU            ------------------------------------------------------------
RLME_RALSO            ------------------------------------------------------------
RLME_NITEU            ------------------------------------------------------------
RLME_LEGPL            ------------------------------------------------------------
RLME_XANOR            ------------------------------------------------------------
RLME_PSYA2            ------------------------------------------------------------
RLME_NEIG1            ------------------------------------------------------------
RLME_AROAE            ------------------------------------------------------------
RLME_METMP            ------------------------------------------------------------
RLME_HALSA            ------------------------------------------------------------
RLME_NATPD            ------------------------------------------------------------
RLME_METTH            ------------------------------------------------------------
RLME_ARCFU            ------------------------------------------------------------
RLME_METMA            ------------------------------------------------------------
                                                                                  

RLME_TREPR            ------------------------------------------------------------
A9RQI9_PHYPA          RAKNTGKPGKGFKGRGGGANGAKAKANKGKGPSRGGKGRKPQKG----------------
D0MRD5_PHYIT          KIVDPRMKSDKRNAEIRAKRGKKRKR----------------------------------
SPB1_DICDI            KIVDKRMKKDLRAQKNKLKTVGRSKDSSKKSKPSGGKNKK--------------------
E3KB01_PUCGT          KMVDARGRKELRAQKRQERASSKRKRK---------------------------------
SPB1_USTMA            KMVDPRMKKELRAFKRKAKRDGKKLGSSNSKPRVPKGYGPRN------------------
SPB1_CRYNJ            KIVDARMRKEVRALKRIKKAGSKRR-----------------------------------
A8N1R5_COPC7          IMVDRRGKKELRAKKRREKAQKKRR-----------------------------------
SPB1_YARLI            KMVDGTMKKEQRAIRRIKKKMGKK------------------------------------
SPB1_CANAL            KMVDGVMKNEQRALKRIAKKYKK-------------------------------------
SPB1_SCHPO            KMVDSRMKKDLRAQKRLAKKGRR-------------------------------------
SPB1_ASPFU            KIVDSRMKKDIRAQKRLAKKKK--------------------------------------
G4VQU5_SCHMA          KIVDKRMKADLRGQQKAKDGKKHGKRKNKVGRPGRPKSRGIGKRR---------------
Q9N5N9_CAEEL          KLVDSRMKKDLRAAKAKEKTKGRGGKRGIPKKTGGGGGGRGRGGGGRGGGRR--------
A0A1X7UGH0_AMPQE      KVVDPRMKKDNRRQKAQYKKQRKH------------------------------------
E9G6A2_DAPPU          KVVDRRMKKDDKKRKATERRKGKKARTPKK------------------------------
H2XWZ3_CIOIN          KVVDKRMKKDLRPQGKNSKQSKGKSG----------------------------------
SPB1_CHICK            KVVDSRLKKDVRAQKRKEQKKRRK------------------------------------
B7P3V3_IXOSC          KVVDPRMKKDLRKKKAAMKKK---------------------------------------
Q7QD87_ANOGA          KVVDPRMKKDRRAEMAKDKRSKKHGKGRGKPAAGGRARAEAAMPRQRLGAVVRSKVIFWW
Q9VXK5_DROME          KVVDPREKKDKRSMDAKKRREKGSKGRKGKGRK---------------------------
E0VIT4_PEDHC          KVVDPRMKKDARRQKNNLKGKSGKKKNKR-------------------------------
A0A088A7G6_APIME      KLVDPRMKKDLRATKAKEKTKKRGKKNHGKPSQGKPKNHKGKKLK---------------
C4M6R5_ENTHI          KLVDPRMKKELRAKKRIEKGKAKKGGKGKKSFAKRR------------------------
A5K2F1_PLAVS          KYVDKRLKKDKKAKKRVEKKKKNISRRKYSKSRPFKFKQKV-------------------
Q8IDF8_PLAF7          KYVDKRLKKDKKAKKRIEKKKKNISRTKYSKSKPFKFRRKI-------------------
Q4U8L6_THEAN          KHVDRRMKQDNRRSKIKPKRKSRKIRPH--------------------------------
Q4N1B5_THEPA          KHVDRRMKQDNRRAKIKPKRKSRKIRPH--------------------------------
G4LWM3_SCHMA          ------------------------------------------------------------
A0EER5_PARTE          LKKDKRAMKAKAR-------------------VGKGKKRRQVSRRKGKKQKS--------
Q23MN4_TETTS          KHVDNRLKKDRKALSRLYTNKGSRKRQVKRHKGKKQKS----------------------
MRM2_YEAST            ------------------------------------------------------------
MRM2_DROME            ------------------------------------------------------------
A4I305_LEIIN          ------------------------------------------------------------
K2MLU3_TRYCR          ------------------------------------------------------------
MRM2_CAEEL            ------------------------------------------------------------
B9QL21_TOXGV          KLVDRRLKKDKRAMKAAMKKKGGQRRGLKKKSRKS-------------------------
MRM2_SCHPO            ------------------------------------------------------------
RLME_DESPS            ------------------------------------------------------------
RLME_PICTO            ------------------------------------------------------------
RLME_THEAC            ------------------------------------------------------------
RLME_THEVO            ------------------------------------------------------------
B9T000_RICCO          ------------------------------------------------------------
C1N352_MICPC          ------------------------------------------------------------
A5K6F5_PLAVS          ------------------------------------------------------------
Q8I365_PLAF7          ------------------------------------------------------------
RLME_PELUB            ------------------------------------------------------------
A8B3D0_GIAIC          ------------------------------------------------------------
TRM72_DROME           ------------------------------------------------------------
A2F7C6_TRIVA          ------------------------------------------------------------
Q586L7_TRYB2          ------------------------------------------------------------
A4HRN5_LEIIN          ------------------------------------------------------------
A0A0D1CBR1_USTMA      ------------------------------------------------------------
I7MGM4_TETTS          ------------------------------------------------------------
TRM71_DROME           ------------------------------------------------------------
D0NU18_PHYIT          ------------------------------------------------------------
TRM7_CAEEL            ------------------------------------------------------------
D0N6L4_PHYIT          ------------------------------------------------------------
G4VP71_SCHMA          ------------------------------------------------------------
TRM7_DICDI            ------------------------------------------------------------
A8J2Y5_CHLRE          ------------------------------------------------------------
TRM7_HUMAN            ------------------------------------------------------------
TRM7_SCHPO            ------------------------------------------------------------
I1RY63_GIBZE          ------------------------------------------------------------
RLME_TREPA            ------------------------------------------------------------
RLME_TREDE            ------------------------------------------------------------
RLME_BDEBA            ------------------------------------------------------------
RLME_DESVH            ------------------------------------------------------------
RLME_BORRA            ------------------------------------------------------------
RLME_BORAP            ------------------------------------------------------------
RLME_BORBP            ------------------------------------------------------------
RLME_BORBU            ------------------------------------------------------------
MRM2_MOUSE            ------------------------------------------------------------
RLME_WOLTR            ------------------------------------------------------------
RLME_ANAMM            ------------------------------------------------------------
RLME_RICFE            ------------------------------------------------------------
RLME_CAUVC            ------------------------------------------------------------
RLME_RHIME            ------------------------------------------------------------
RLME_BARQU            ------------------------------------------------------------
RLME_NITWN            ------------------------------------------------------------
RLME_ZYMMO            ------------------------------------------------------------
RLME_RUEPO            ------------------------------------------------------------
RLME_WIGBR            ------------------------------------------------------------
RLME_BUCAP            ------------------------------------------------------------
RLME_BUCBP            ------------------------------------------------------------
RLME_FRATT            ------------------------------------------------------------
RLME_ECOLI            ------------------------------------------------------------
RLME_BLOFL            ------------------------------------------------------------
RLME_BLOPB            ------------------------------------------------------------
RLME_COXBU            ------------------------------------------------------------
RLME_RALSO            ------------------------------------------------------------
RLME_NITEU            ------------------------------------------------------------
RLME_LEGPL            ------------------------------------------------------------
RLME_XANOR            ------------------------------------------------------------
RLME_PSYA2            ------------------------------------------------------------
RLME_NEIG1            ------------------------------------------------------------
RLME_AROAE            ------------------------------------------------------------
RLME_METMP            ------------------------------------------------------------
RLME_HALSA            ------------------------------------------------------------
RLME_NATPD            ------------------------------------------------------------
RLME_METTH            ------------------------------------------------------------
RLME_ARCFU            ------------------------------------------------------------
RLME_METMA            ------------------------------------------------------------
                                                                                  

RLME_TREPR            -----------------------------
A9RQI9_PHYPA          -----------------------------
D0MRD5_PHYIT          -----------------------------
SPB1_DICDI            -----------------------------
E3KB01_PUCGT          -----------------------------
SPB1_USTMA            -----------------------------
SPB1_CRYNJ            -----------------------------
A8N1R5_COPC7          -----------------------------
SPB1_YARLI            -----------------------------
SPB1_CANAL            -----------------------------
SPB1_SCHPO            -----------------------------
SPB1_ASPFU            -----------------------------
G4VQU5_SCHMA          -----------------------------
Q9N5N9_CAEEL          -----------------------------
A0A1X7UGH0_AMPQE      -----------------------------
E9G6A2_DAPPU          -----------------------------
H2XWZ3_CIOIN          -----------------------------
SPB1_CHICK            -----------------------------
B7P3V3_IXOSC          -----------------------------
Q7QD87_ANOGA          VNSIASAERVHTGIARAKIENKTHRYKHL
Q9VXK5_DROME          -----------------------------
E0VIT4_PEDHC          -----------------------------
A0A088A7G6_APIME      -----------------------------
C4M6R5_ENTHI          -----------------------------
A5K2F1_PLAVS          -----------------------------
Q8IDF8_PLAF7          -----------------------------
Q4U8L6_THEAN          -----------------------------
Q4N1B5_THEPA          -----------------------------
G4LWM3_SCHMA          -----------------------------
A0EER5_PARTE          -----------------------------
Q23MN4_TETTS          -----------------------------
MRM2_YEAST            -----------------------------
MRM2_DROME            -----------------------------
A4I305_LEIIN          -----------------------------
K2MLU3_TRYCR          -----------------------------
MRM2_CAEEL            -----------------------------
B9QL21_TOXGV          -----------------------------
MRM2_SCHPO            -----------------------------
RLME_DESPS            -----------------------------
RLME_PICTO            -----------------------------
RLME_THEAC            -----------------------------
RLME_THEVO            -----------------------------
B9T000_RICCO          -----------------------------
C1N352_MICPC          -----------------------------
A5K6F5_PLAVS          -----------------------------
Q8I365_PLAF7          -----------------------------
RLME_PELUB            -----------------------------
A8B3D0_GIAIC          -----------------------------
TRM72_DROME           -----------------------------
A2F7C6_TRIVA          -----------------------------
Q586L7_TRYB2          -----------------------------
A4HRN5_LEIIN          -----------------------------
A0A0D1CBR1_USTMA      -----------------------------
I7MGM4_TETTS          -----------------------------
TRM71_DROME           -----------------------------
D0NU18_PHYIT          -----------------------------
TRM7_CAEEL            -----------------------------
D0N6L4_PHYIT          -----------------------------
G4VP71_SCHMA          -----------------------------
TRM7_DICDI            -----------------------------
A8J2Y5_CHLRE          -----------------------------
TRM7_HUMAN            -----------------------------
TRM7_SCHPO            -----------------------------
I1RY63_GIBZE          -----------------------------
RLME_TREPA            -----------------------------
RLME_TREDE            -----------------------------
RLME_BDEBA            -----------------------------
RLME_DESVH            -----------------------------
RLME_BORRA            -----------------------------
RLME_BORAP            -----------------------------
RLME_BORBP            -----------------------------
RLME_BORBU            -----------------------------
MRM2_MOUSE            -----------------------------
RLME_WOLTR            -----------------------------
RLME_ANAMM            -----------------------------
RLME_RICFE            -----------------------------
RLME_CAUVC            -----------------------------
RLME_RHIME            -----------------------------
RLME_BARQU            -----------------------------
RLME_NITWN            -----------------------------
RLME_ZYMMO            -----------------------------
RLME_RUEPO            -----------------------------
RLME_WIGBR            -----------------------------
RLME_BUCAP            -----------------------------
RLME_BUCBP            -----------------------------
RLME_FRATT            -----------------------------
RLME_ECOLI            -----------------------------
RLME_BLOFL            -----------------------------
RLME_BLOPB            -----------------------------
RLME_COXBU            -----------------------------
RLME_RALSO            -----------------------------
RLME_NITEU            -----------------------------
RLME_LEGPL            -----------------------------
RLME_XANOR            -----------------------------
RLME_PSYA2            -----------------------------
RLME_NEIG1            -----------------------------
RLME_AROAE            -----------------------------
RLME_METMP            -----------------------------
RLME_HALSA            -----------------------------
RLME_NATPD            -----------------------------
RLME_METTH            -----------------------------
RLME_ARCFU            -----------------------------
RLME_METMA            -----------------------------