CLUSTAL format seed alignment for MF_01551

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RLMM_ACTPJ      ----------------------------MNKLALYCRAGFEKETAGEITDKAAQLGVFGF
RLMM_ACTP7      ----------------------------MNKLALYCRAGFEKETAGEITDKAAQLGVFGF
RLMM_ACTP2      ----------------------------MNKLALYCRAGFEKETAGEITDKAAQLGVFGF
RLMM_HAEDU      ----------------------------MNKLALYCRAGFEKELAGEITDKAAQLGVFGF
RLMM_HAEIN      ----------------------------MNKLALYCRPGFEKEVAAEITDQASHLGVFGF
RLMM_HAEI8      ----------------------------MNKLALYCRPGFEKEVAAEITDQASHLGVFGF
RLMM_HAEIG      ----------------------------MNKLALYCRPGFEKEVAAEITDQASHLGVFGF
RLMM_HAEIE      ----------------------------MNKLALYCRPGFEKEVAAEIADQASHLGVFGF
RLMM_ACTSZ      ----------------------------MNKLALYCRIGFEKEVAAEITDTAAERGVFGF
RLMM_MANSM      ----------------------------MNKLALYCRIGFEKETAAEITEKAAEKGVFGF
RLMM_PASMU      ----------------------------MNKLALYCRPGFEKELAAEISEKAAELGIFGF
RLMM_AGGAN      ----------------------------MNKLALYCRMGFEREMAAEITDKAAEKGVFGF
RLMM_HAES1      ----------------------------MNKLALYCRSGFEKELAAEITEKATALGVFGF
RLMM_HISS2      ----------------------------MNKLALYCRSGFEKELAAEITEKATALGVFGF
RLMM_ECOBR      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGQREIFGF
RLMM_ECO5T      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGQREIFGF
RLMM_ECO55      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGQREIFGF
RLMM_ECOLC      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGQREIFGF
RLMM_ECOBW      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGQREIFGF
RLMM_ECODH      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGQREIFGF
RLMM_ECOLI      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGQREIFGF
RLMM_ECOSE      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGQREIFGF
RLMM_ECOSM      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGQREIFGF
RLMM_ECOHS      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGQREIFGF
RLMM_ECO24      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGQREIFGF
RLMM_ECO57      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGQREIFGF
RLMM_ECO5E      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGQREIFGF
RLMM_ECOLU      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGQREIFGF
RLMM_ECO7I      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGQREIFGF
RLMM_ECO8A      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGQREIFGF
RLMM_SHIB3      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGQREIFGF
RLMM_SHIFL      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGQREIFGF
RLMM_SHIF8      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGQREIFGF
RLMM_SHISS      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGQREIFGF
RLMM_SHIBS      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGQREIFGF
RLMM_SHIDS      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGQREIFGF
RLMM_ECOUT      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGQREIFGF
RLMM_ECOK1      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGQREIFGF
RLMM_ECO45      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGQREIFGF
RLMM_ECO27      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGQREIFGF
RLMM_ECO81      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGQREIFGF
RLMM_ECOL6      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGQREIFGF
RLMM_ECOL5      ----------------------------MNKVILLCRPGFEKECAAEITDKAGQREIFGF
RLMM_ESCF3      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGRQEIFGF
RLMM_SALA4      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGKREIFGF
RLMM_SALAR      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGKRELFGF
RLMM_SALCH      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGKREIFGF
RLMM_SALPC      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGKREIFGF
RLMM_SALSV      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGKREIFGF
RLMM_SALTI      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGKREIFGF
RLMM_SALTY      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGKREIFGF
RLMM_SALPB      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGKREIFGF
RLMM_SALEP      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGKREIFGF
RLMM_SALNS      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGKREIFGF
RLMM_SALDC      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGKREIFGF
RLMM_SALG2      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGKREIFGF
RLMM_SALHS      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGKREIFGF
RLMM_SALPA      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGKREIFGF
RLMM_SALPK      ----------------------------MNKVVLLCRPGFEKECAAEITDKAGKREIFGF
RLMM_CITK8      ----------------------------MNKVVLLCRPGFEKECAAEITDKAARREIFGF
RLMM_KLEP3      ----------------------------MNKVVLYCRPGFEKECAAEITDKAARLEVFGF
RLMM_KLEP7      ----------------------------MNKVVLYCRPGFEKECAAEITDKAARLEVFGF
RLMM_CROS8      ----------------------------MNKVILYCRQGFEKECAAEITDKAAQQGVFGF
RLMM_ENT38      ----------------------------MNKVVLYCRPGFEKECAAEITDKAARREVFGF
RLMM_ERWT9      ----------------------------MNKILLYCRQGFEKECAAEITAKAAEREIFGF
RLMM_PECAS      ----------------------------MNKVILYCRPGFEKECAAEITEKATQHNAFGF
RLMM_PECCP      ----------------------------MNRVILYCRPGFEKECAAEITEKATQHDAYGF
RLMM_SODGM      ----------------------------MNNVILYCRPGFEKECSAEVTEKAAAREIFGF
RLMM_DICP7      ----------------------------MNKVILYCRPGFEKECAAEITDKAGRRDIYGF
RLMM_DICC1      ----------------------------MNKVILYCRPGFEKECAAEITDKAARYNVYGF
RLMM_EDWI9      ----------------------------MNRLALYCRPGFEKECAAEITDKAAALEVYGF
RLMM_YERPA      ---------------------------MNNKIALYCRSGFEKECAAEITEKAAQLEIFGF
RLMM_YERPN      ---------------------------MNNKIALYCRSGFEKECAAEITEKAAQLEIFGF
RLMM_YERPS      ---------------------------MNNKIALYCRSGFEKECAAEITEKAAQLEIFGF
RLMM_YERPB      ---------------------------MNNKIALYCRSGFEKECAAEITEKAAQLEIFGF
RLMM_YERP3      ---------------------------MNNKIALYCRSGFEKECAAEITEKAAQLEIFGF
RLMM_YERPY      ---------------------------MNNKIALYCRSGFEKECAAEITEKAAQLEIFGF
RLMM_YERPE      ---------------------------MNNKIALYCRSGFEKECAAEITEKAAQLEIFGF
RLMM_YERPP      ---------------------------MNNKIALYCRSGFEKECAAEITEKAAQLEIFGF
RLMM_YERPG      ---------------------------MNNKIALYCRSGFEKECAAEITEKAAQLEIFGF
RLMM_YERE8      ---------------------------MNNKIALYCRSGFEKECAAEITTKAAQLEIFGF
RLMM_SERP5      ----------------------------MNRLALYCRQGFEKECAAEITAKAAELEVFGF
RLMM_PHOLL      ----------------------------MNKIALYCRPGFEKECAAEITDKAGQKEIYGF
RLMM_PHOAZ      ----------------------------MNKIALYCRPGFEKECAAEITDKAGQKEIYGF
RLMM_PHOAA      ----------------------------MNKIALYCRPGFEKECAAEITDKAGQKEIYGF
RLMM_PROMH      ----------------------------MNKVALYCRPGFEKECAAEITDKAGQIGVYGF
RLMM_ALIF1      --------------------------------MFYCRSGFEKECAGEIQDKATQLEVFGF
RLMM_ALIFM      --------------------------------MFYCRSGFEKECAGEIQDKATQLEVFGF
RLMM_ALISL      ----------------------------MKQVMFYCRSGFEKECAGEIQDKATQLEVFGF
RLMM_VIBCB      --------------------------------MLYCRSGFEKECAGEIQDKATQLEVYGF
RLMM_VIBPA      --------------------------------MLYCRSGFEKECAGEIQDKATQLEVYGF
RLMM_VIBA3      ----------------------------MKHVLLYCRSGFEKECAGEIQDKATQLEVFGF
RLMM_VIBVU      ----------------------------MKQLMLYCRQGFEKECAGEIQDKATQLEVYGF
RLMM_VIBVY      --------------------------------MLYCRQGFEKECAGEIQDKATQLEVYGF
RLMM_PHOPR      ----------------------------MNHVILYCRPGFEKECAGEVQDKANKLELFGF
RLMM_AERHH      ----------------------------MNNLLLYCRPGFEKEAAAEITERASNMQCYGF
RLMM_AERS4      ----------------------------MNNLLLYCRPGFEKEAAAEITERASNMQCYGF
RLMM_TOLAT      ----------------------------MNHLMFYCRPGFEKDMAAEIQDKAVALECFGF
RLMM_SHEB5      ----------------------------MKNLFLFCRAGFEKECAAEIQQRAGELNVGGF
RLMM_SHEB2      ----------------------------MKNLFLFCRAGFEKECAAEIQQRAGELNVGGF
RLMM_SHEB8      ----------------------------MKNLFLFCRAGFEKECAAEIQQRAGELNVGGF
RLMM_SHEB9      ----------------------------MKNLFLFCRAGFEKECAAEIQQRAGELNVGGF
RLMM_SHESW      ----------------------------MKNLFLFCRAGFEKECAAEIQQRAGELNVGGF
RLMM_SHEPC      ----------------------------MKNLFLFCRAGFEKECAAEIQQRAGELNVGGF
RLMM_SHESM      ----------------------------MKNLFLFCRAGYEKECAAEIQQRAAELNVGGF
RLMM_SHESR      ----------------------------MKNLFLFCRAGYEKECAAEIQQRAAELNVGGF
RLMM_SHESA      ----------------------------MKNLFLFCRAGYEKECAAEIQQRAAELNVGGF
RLMM_SHEON      ----------------------------MKNLFLFCRAGYEKECAAEIQQRAAELNVGGF
RLMM_SHEDO      ----------------------------MKNLFLFCRAGYEKECAAEIQQRAAEMNVGGF
RLMM_SHEFN      ----------------------------MKNLFLFCRSGYEKDCAAEIQQRATELNVGGF
RLMM_SHEHH      ----------------------------MINLFLFCRAGYEKDCAAEIQVRAAELDIGGF
RLMM_SHEPA      ----------------------------MINLFLFCRAGYEKDCAAEIQVRAAELDIGGF
RLMM_SHESH      ----------------------------MINLFLFCRAGYEKECAAEIQHRAAELDIGGF
RLMM_SHEWM      ----------------------------MINLFLYCRSGYEKECAAEIQHRAAELEIGGF
RLMM_SHELP      ----------------------------MINLFLYCRAGYEKDCAAEIQQRAAELNVGGF
RLMM_SHEAM      ----------------------------MKNLFLYCRAGYEKDCAAEIQQRAAELGIGGF
RLMM_PSYIN      ----------------------------MLGILLYCRPGFENDCANELQDKATALEVFGF
RLMM_ALTMD      --------------------------MSDTSILAYCRPGYENDTANELTSRYGEAGFYGY
RLMM_COLP3      ----------------------------MTSIVLFCRPGFEKECGAEIQEKAAWNEMYGY
RLMM_PSEA6      ----------------------------MAGLALYCRTGFEKDLANEVVEKCAELNVYGY
RLMM_IDILO      --------------------MSEIVNGRGSGIVLLCRAGFEGDCAAEIQDKTAELGVYGY
RLMM_PSET1      ----------------------------MSSVVIYCRSGFENDAAAEITFHAAEQGFAGY
RLMM_CHRSD      ------------------------MAVCPHEWLLYCRPGFEKDLSAELADKTAHAGQGGY
RLMM_MARMS      ----------------------------MKNVLVYCRQGFEKDCAAELSEVASSKGFYGY
RLMM_PSEP1      ----------------------------MNTLFMHCRPGFEGEVCAEISEHAARLGVAGY
RLMM_PSEPK      ----------------------------MNTLFMHCRPGFEGEVCAEISEHAARLGVAGY
RLMM_PSEPG      ----------------------------MNTLFMHCRPGFEGEVCAEISEHAARLGVSGY
RLMM_PSEPW      ----------------------------MNTLFMHCRPGFEGEVCAEISEHAARLGVAGY
RLMM_PSEE4      ----------------------------MNTLFMHCRPGFEGEVCAEISEHAALLGVAGY
RLMM_PSEPF      ----------------------------MNTLFMHCRPGFEGEVCSEISDLAARLNVAGY
RLMM_PSEFS      ----------------------------MNTLFMHCRPGFEGEVCSEIAEHAARLNVSGY
RLMM_PSEF5      ----------------------------MNTLFIHCRPGFEGEVCSEIADHAARLNVAGY
RLMM_PSE14      ----------------------------MNTLFMHCRPGFEGEVCSEISDHAACLDVAGY
RLMM_PSEU2      ----------------------------MNTLFMHCRPGFEGEVCSEIADHAARLDVAGY
RLMM_PSESM      ----------------------------MNTLFMHCRPGFEGEVCSEIADLAARLDVSGY
RLMM_PSEMY      ----------------------------MNTLFLHCRPGFEGEVCAEITDLAARLDVPGY
RLMM_PSEU5      ----------------------------MNTLLLHCRPGFEGEVCAEISEHAAILEVAGY
RLMM_AZOVD      ----------------------------MNSLLLHCRPGFEGEVCAEIGEHAGRLNVAGY
RLMM_PSEAE      ----------------------------MNTLLMHCRPGFEGEVCAEIAEHAATLEIPGY
RLMM_PSEA8      ----------------------------MNTLLMHCRPGFEGEVCAEIAEHAATLEIPGY
RLMM_PSEAB      ----------------------------MNTLLMHCRPGFEGEVCAEIAEHAATLEIPGY
RLMM_PSEA7      ----------------------------MNTLLMHCRPGFEGEVCAEIAEHAATLEIPGY
RLMM_SACD2      -----------------------------MILICLCRQGFEKEVAAEITDCAAYAGIAGY
RLMM_TERTT      -----------------------------MELVALCRTGFEKELAAELVDVTATHGVHGY
RLMM_CELJU      ----------------------------MNQLFLHCRPGFEKECAAEITELAAAQGIYGY
RLMM_MARHV      ----------------------------MQQIMLMCRPGFETEAGQELMDSAAACGLFGY
RLMM_METCA      -------------------------MTSPSSILLYCRRGFEKECAAEILVQTQAAGISGH
RLMM_XANAC      ----------------------------MSGLLCYCRPGFEPELAAELSVRAAFVGIAGY
RLMM_XANC5      ----------------------------MSGLVCYCRQGFEPELAAELSARAAFVGIAGY
RLMM_XANOR      ----------------------------MSGLLCYCRQGFEPELAAELSARAAFVGIAGY
RLMM_XANOM      ----------------------------MSGLLCYCRQGFEPELAAELSARAAFVGIAGY
RLMM_XANOP      ----------------------------MSGLLCYCRQGFEPELAAELSARAAFVGIAGY
RLMM_XANCP      ----------------------------MSGLLCYCRQGFEPELAAELSARAAFVGIAGY
RLMM_XANC8      ----------------------------MSGLLCYCRQGFEPELAAELSARAAFVGIAGY
RLMM_XANCB      ----------------------------MSGLLCYCRQGFEPELAAELSARAAFVGIAGY
RLMM_STRMK      ---------------------MAPVTDTGIGLLCLCRQGFEPELAGELQFRAGEAGFAGY
RLMM_STRM5      ---------------------MAPVTETGIGLLCLCRQGFEPELAGELQFRASEAGFAGY
RLMM_XYLFT      ----------------------------MSGLIAYCRQGFEPELAAELRDRAVLLGIASD
RLMM_XYLF2      ----------------------------MSGLIAYCRQGFEPELAAELRDRAVLLGIASD
RLMM_XYLFM      ----------------------------MSGLIAYCRQGFEPELAAELRDRAVLLGIAGD
RLMM_XYLFA      ----------------------------MSGLIAYCRQGFEPELAAELRDRAVLLGIAGD
RLMM_HAHCH      MIGNARMSQKYPTSSSRKRSPLSSGKYSAIGLLAYCRPGFEAECAQELQNIASLQFVYGY
RLMM_AZOSB      ----------------MSSHAPA-SSFSVSGLLAYCRAGFEKELAAEIDDLAADAGLIGY
RLMM_THASP      ----------------MNQHTPA-AALACAGLLGYCRAGFEKELAAELDDIAAEAGLIGY
RLMM_AROAE      ----------------MPATPPNRLGLTASGLLALCRAGFEKEVAAELDDFAAGIGLTGF
RLMM_ALKEH      -----------------MTERDPIPTRHATRWLLQCRPGFGADLAAELAAWSSDAGVAGW
RLMM_HALHL      --------------------------MELQGWILHCRAGYEQTLASEATMAAHERDVHGY
RLMM_LARHH      ---------------------------MSVVFLLQTRPGFERDAQQEARTVALERRGLEL
                                                    * *:      *             

RLMM_ACTPJ      VNLKENSGYIIFECYQAGDADRLARELKFEQLIFARQMIVVGDMLQDLPVEDRISPIVAQ
RLMM_ACTP7      VNLKENSGYIIFECYQAGDADRLARELKFEQLIFARQMIVVGDMLQDLPVEDRISPIVAQ
RLMM_ACTP2      VNLKENSGYIIFECYQAGDADRLARELKFEQLIFARQMIVVGDMLQDLPAEDRISPIVAQ
RLMM_HAEDU      VNLTEQSGYVIFECYQANEADHLAREIKFEQLIFARQMIVVGELLEDLPTADRISPIIAQ
RLMM_HAEIN      ARVQDNSGYVIFECYQPDEADRLARDIPFNRLIFARQMMVISDLLEDLDPADRISPIVVA
RLMM_HAEI8      ARVQDNSGYVIFECYQPDEADRLARDIPFNRLIFARQMMVISDLLEDLDPADRISPIVAA
RLMM_HAEIG      ARVQDNSGYVIFECYQPDEADRLARDIPFNRLIFARQMIVISDLLEDLDPADRISPIVAA
RLMM_HAEIE      ARVQDNSGYVIFECYQPDEADRLARDIPFNRLIFARQMMVISGLLEDLDPADRISPIVTA
RLMM_ACTSZ      ARIQENAGYVIFECYQPGEADRLAREIPFTQLIFARQLVVVSDLLQNLPTTDRITPILQK
RLMM_MANSM      ARVNNDSGYVIFECYQEGEADRLAREIPFNQLIFARQMIVISDLLENLPPTDRITPIIEE
RLMM_PASMU      ARVEENQGYVIFECYQTDDADRLAREIPFNQLIFARQMIVVSDLLTDLPVQDRISPIIQQ
RLMM_AGGAN      VRVIENSGYVIFECYQADEADYLARELDFQQLIFARQMLVVSDLLTDLPQQDRITPIVQQ
RLMM_HAES1      ARVVENSGYVIFECYQIGEADLLARKITFSQLIFARQLIVVSDLISNLSVQDRISPIIEY
RLMM_HISS2      ARVVENSGYVIFECYQIGEADLLARKITFSQLIFARQLIVVSDLISNLSVQDRISPIIEY
RLMM_ECOBR      ARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_ECO5T      ARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_ECO55      ARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_ECOLC      ARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_ECOBW      ARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_ECODH      ARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_ECOLI      ARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_ECOSE      ARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_ECOSM      ARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_ECOHS      ARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_ECO24      ARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_ECO57      ARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_ECO5E      ARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_ECOLU      ARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_ECO7I      ARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_ECO8A      ARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_SHIB3      ARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_SHIFL      ARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_SHIF8      ARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_SHISS      ARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVDM
RLMM_SHIBS      ARVKENSGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_SHIDS      ARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_ECOUT      ARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_ECOK1      ARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_ECO45      ARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_ECO27      ARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_ECO81      ARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_ECOL6      ARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_ECOL5      ARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_ESCF3      ARVKENAGYVIYECYQAEDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_SALA4      ARVKENAGYVIYECYQPEDGEKLISELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_SALAR      ARVKENTGYVIYECYQPEDGEKLISELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_SALCH      ARVKENAGYVIYECYQPEDGEKLISELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_SALPC      ARVKENAGYVIYECYQPEDGEKLISELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_SALSV      ARVKENAGYVIYECYQPEDGEKLISELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_SALTI      ARVKENAGYVIYECYQPEDGEKLISELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_SALTY      ARVKENAGYVIYECYQPEDGEKLISELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_SALPB      ARVKENAGYVIYECYQPEDGEKLISELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_SALEP      ARVKENAGYVIYECYQPEDGEKLISELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_SALNS      ARVKENAGYVIYECYQPEDGEKLISELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_SALDC      ARVKENAGYVIYECYQPEDGEKLISELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_SALG2      ARVKENAGYVIYECYQPEDGEKLISELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGM
RLMM_SALHS      ARVKENAGYVIYECYQPEDGEKLISELPFSSLIFARQWFVVGELLQHLPPEDRITPVVGM
RLMM_SALPA      ARVKENAGYVIYECYQPEDGEKLISELPFSSLIFARQWFVVGELLQHLPPEDRITPVVGM
RLMM_SALPK      ARVKENAGYVIYECYQPEDGEKLISELPFSSLIFARQWFVVGELLQHLPPEDRITPVVGM
RLMM_CITK8      ARVKDNAGYVVFECYQPDDAEKIVKELPFSSLIFARQMFVVGELLRDLPPDDRITPIVGM
RLMM_KLEP3      ARVKEDSGYVIFEGYQQDDGEKLVRDLPFSSLIFARQMFVVGELLRDLPPEDRITPIVGM
RLMM_KLEP7      ARVKEDSGYVIFEGYQQDDGEKLVRDLPFSSLIFARQMFVVGELLRDLPPEDRITPIVGM
RLMM_CROS8      ARVKENSAYVIFECYQPDDADKLARELPFSSLIFARQMFVAGELLQDLPPEDRVTPVVGM
RLMM_ENT38      ARVKENAGYVVFECYQPDDADKLVRELPFSSLIFARQMFVAGELLRDLPPEDRISPISGM
RLMM_ERWT9      ARVKDDSAYVLFECYQQGEAEKLLAELPFSELIFSRQMIVVGELLRDLPPTNRITPVVGM
RLMM_PECAS      ARVKENSGYVVFECYQHEDAERLVKTLPFHELIFVRQMFVSGDLLRDLPPEDRITPIVGM
RLMM_PECCP      ARVKENSGYVVFECYQHEDAERLVKTLPFHELIFARQMFVSGELLRDLPPEDRITPIVGM
RLMM_SODGM      ARVKDNSGYVVFVCYQHEEADRLVRVLPLRSLIFARQMILVGELLRDLPAEDRITQIAGM
RLMM_DICP7      VRVKDNSGYVIFECYQHEDADRLVRELPFRDLIFARQMMVCGELLRDLPPEDRITPIVGM
RLMM_DICC1      VRVKDNSGYVVFECYQHEDADRLIKELPFQELVFARQMMVCGELLRDLPPEDRITPIVGM
RLMM_EDWI9      ARVKENSGYVLFECYQPDDADTLARKLPFRELIFARQMLVVGELLKDLPPEDRIAPICGM
RLMM_YERPA      ARVKENSGYVLFECYQLEDADRLIREIPFREFIFARQMMVVGELLKDLPPEDRVSPIVGM
RLMM_YERPN      ARVKENSGYVLFECYQLEDADRLIREIPFREFIFARQMMVVGELLKDLPPEDRVSPIVGM
RLMM_YERPS      ARVKENSGYVLFECYQLEDADRLIREIPFREFIFARQMMVVGELLKDLPPEDRVSPIVGM
RLMM_YERPB      ARVKENSGYVLFECYQLEDADRLIREIPFREFIFARQMMVVGELLKDLPPEDRVSPIVGM
RLMM_YERP3      ARVKENSGYVLFECYQLEDADRLIREIPFREFIFARQMMVVGELLKDLPPEDRVSPIVGM
RLMM_YERPY      ARVKENSGYVLFECYQLEDADRLIREIPFREFIFARQMMVVGELLKDLPPEDRVSPIVGM
RLMM_YERPE      ARVKENSGYVLFECYQLEDADRLIREIPFREFIFARQMMVVGELLKDLPPEDRVSPIVGM
RLMM_YERPP      ARVKENSGYVLFECYQLEDADRLIREIPFREFIFARQMMVVGELLKDLPPEDRVSPIVGM
RLMM_YERPG      ARVKENSGYVLFECYQLEDADRLIREIPFREFIFARQMMVVGELLKDLPPEDRVSPIVGM
RLMM_YERE8      ARVKENSGYVLFECYQLEDADRLIREVPFRELIFARQMMVVGELLKDLPPEDRVSPIVGM
RLMM_SERP5      ARVKDNSGYVLFECYQPDDADRLAKEIPFRELIFARQILVVGELLRDLPPEDRVSPIVGM
RLMM_PHOLL      ARVKDNSGYVLFECYQYEDADRLIREIPFRELIFARQMLVVGELLRDLPPEDRISPIVGM
RLMM_PHOAZ      ARVKDNSGYVLFECYQHEDADRLIREIPFRELIFARQMLVVGELLRDLSPEDRISPIIGM
RLMM_PHOAA      ARVKDNSGYVLFECYQHEDADRLIREIPFRELIFARQMLVVGELLRDLPPEDRVSPIVGM
RLMM_PROMH      SRVKEGSGYVIFECYQEGDADKIARDVDFRGLIFARQLFVCGELLKNLPPEDRITPIIDQ
RLMM_ALIF1      PRLKNNTGYVLFECYQEGDADRLIREIKFNELIFARQMFAVAAEVSDLPKDDRISPILDA
RLMM_ALIFM      PRLKNNTGYVLFECYQEGDADRLIREIKFNELIFARQMFAVAVEVSDLPKDDRISPILDA
RLMM_ALISL      PRLKSNTGYVLFECYQEGDADKLIQQIKFNELIFARQMFAVATELSDLPTEDRISPILNA
RLMM_VIBCB      PRVKKNSGYVVFECYQDGDADKLAKGIDFSALIFARQMFAVAAEFEALPSDDRISPILAE
RLMM_VIBPA      PRVKKNSGYVVFECYQDGDAEKLVKGLDFSSLIFARQMFAVAAEFEALPSEDRISPILAE
RLMM_VIBA3      PRLKNNTGFVLFECYQAGEADKLIKEIDFQSLIFARQMLAVAVEIKDLPTDDRISPILEA
RLMM_VIBVU      PRVFKNAGYVLFECYQDGDADKLARELDFNALIFARQMFAVAAEFTELPSEDRISPILAE
RLMM_VIBVY      PRVFKNAGYVLFECYQDGDADKLARELDFNALIFARQMFAVAAEFTELPSEDRISPILAE
RLMM_PHOPR      PRTKNNTGYVVFEFHQQGDADKFIKLQPFSSLIFARQMFAATKLLTDLPQEDRISPILEA
RLMM_AERHH      ARVKDDSGYVIFELYDEEQADLLARKLPFRELIFIRQMLVVTHELKDLDLSDRITPILEA
RLMM_AERS4      ARVKDDSGYVIFELYDEEQADLLARKLPFRELIFIRQMLVVTHELKDLDVADRISPIIEA
RLMM_TOLAT      SRVADNCGFVLFECYGEQDAERLARRLPFRELIFARQMLVVIEQLNGLDLKDRITPIVEA
RLMM_SHEB5      VKANNNDAYVVYQCFEDDAADTLVKQLPLDSLIFARQMFAASDLLVDLPENDRISPIVAA
RLMM_SHEB2      VKANNNDAYVVYQCFEDDAADTLVKQLPLDSLIFARQMFAASDLLVDLPENDRISPIVAA
RLMM_SHEB8      VKANNNDAYVVYQCFEDDAADTLVKQLPLDSLIFARQMFAASDLLVDLPENDRISPIVAA
RLMM_SHEB9      VKANNNDAYVVYQCFEDDAADTLVKQLPLDSLIFARQMFAASDLLVDLPENDRISPIVAA
RLMM_SHESW      VKANNNDAYVVYQCFEDDAADTLVKQLPLDSLIFARQMFAASDLLVDLPENDRISPIVAA
RLMM_SHEPC      VKANNNDAYVVYQCFEEDAADTLVKQLPLDSLIFARQMFAASDLLVDLPESDRISPIVAA
RLMM_SHESM      VKANNNDAYVVYQCFEEDGGDTLVKQLPLDSLIFARQMFAASELLADLPESDRVSPIVAA
RLMM_SHESR      VKANNNDAYVVYQCFEEDGGDILVKQLPLDSLIFARQMFAASELLADLPESDRVSPIVAA
RLMM_SHESA      VKANNNDAYVVYQCFEEDGGDTLVKQLPLDSLIFARQMFAASELLADLPESDRVSPIVAA
RLMM_SHEON      VKTNNNDAYVVYQCFEDDGADTLVKQLPLDSLIFARQMFAASELLADLPESDRVSPIVAA
RLMM_SHEDO      VKTTNNDAYVIYQCFEDDGADTLAKMLPLNSLIFARQMFAASELHSDLPEQDRVGPLVAS
RLMM_SHEFN      VKTNINDAYVIYQCFDDNGADTLVKELALSSLVFARQMFAAGELLSDLPEQDRVGPIVAS
RLMM_SHEHH      VKTNTNDAYVIFQCFQAGDAEVLAKNISLDSLIFARQMFAAKELLKGLPEQDRISPIVEA
RLMM_SHEPA      VKTNTNDAYVIFQCFQAGDAEVLAKNISLDSLIFARQMFAAKELLKGLPEQDRISPIVEA
RLMM_SHESH      VKTNKNDAYVIFQCFQAGDAAVLAQKIKLDSLIFARQMFAAKALLKNLPENDRITPIMEA
RLMM_SHEWM      VKTNKKDGYVIFQCFQAGDANILAQKIKLDSLIFARQMFAAKELLKNLPEHDRITPIMEA
RLMM_SHELP      VKTNRNDGYVIFQCFQVGDADLLAEQIELDSLIFTRQMFAANELLKDLPEGDRVTPIVDA
RLMM_SHEAM      VKANRDDAYVVFQGFSPDDGDRLAKELPLDSLIFARQMFACGDLLDDFSPEDRVTPIAES
RLMM_PSYIN      VKTKRNSGYVFYQCYDPQQVEYLLEKLDYKQLIFARQLIAVKAFINDLPLDDRISPIL--
RLMM_ALTMD      PVSKKNSGFAHYHLYDAAQLEQTVTQFAVHDSIFPRQLVAVFAAINDVEKEDRVGQVLDA
RLMM_COLP3      LELKINQGLVFFHLHESAHGEALMNKLPLKRLIFARQWFVTVTDKIDLPDYNRVEAIT--
RLMM_PSEA6      PELKTNSGLVLFQCYQAEDADKLAKTLPLTTLIFARQLFAFSERCEQLDTSDRIGPIL--
RLMM_IDILO      CQTQPEQAYVTYHC-QHEEAEHIARKLTLKDLVFAREMFALLGPVKVAGIEDRASEVIKV
RLMM_PSET1      VKAKPNTGYVIYECFDAQHGDEIIKKVDFKNMVFARQWFAGT-LIENMPVEDRVGAVVEA
RLMM_CHRSD      PIAARDSGHVRFVLDPETPANEVHRALPLEALVFARQSLVAFPPLEALPRDDRLSAIVDL
RLMM_MARMS      AKVVPDAGYIVYNFDQADAGETLIQQLNFNRLIFARQ-IIAVNDVIELEQGGRVESLLEA
RLMM_PSEP1      AKGKPQSASAEFVCSEEGGAERLMGELRFNQLIFPRQWARG--GYVELPESDRISVLLAQ
RLMM_PSEPK      AKGKPQSASAEFVCSEEGGAERLMGELRFNQLIFPRQWARG--GYVELPERDRISVLLAQ
RLMM_PSEPG      AKSKPQSASAEFVCSEEGGAERLMGELRFNQLIFPRQWARG--GFVELPETDRISVLLSQ
RLMM_PSEPW      AKGKPQSACAEFVCAEAEGAERLMAQLRFAQLIFPRQWARG--SYIELPETDRISVLLEH
RLMM_PSEE4      AKGKPQSACAEFVCTEPDGAQRLMHELRFAQLIFPRQWARG--AFVELPETDRISVLLEH
RLMM_PSEPF      AKAKPATACAEFVCTEEDGAERLMRGQRFAELIFPRQWARG--FFIDLPENDRISVILAH
RLMM_PSEFS      AKAKTGSACAEFVCTEEDGAQRLMHGQRFAELIFPRQWARG--VFIDLPETDRISVILAH
RLMM_PSEF5      AKAKPSTACAEFICTEDDGAQRLMQGLRFPELIFPRQWARG--GFIDLPETDRISVILAY
RLMM_PSE14      AKARPDTACAEFICTEADGAERLMNGQRFDALIFPRQWARG--MFLELPETDRISVILAQ
RLMM_PSEU2      AKARPDTACAEFICTEADGAERLMNGQRFDKLIFPRQWARG--LFLELPETDRISVILAQ
RLMM_PSESM      AKARPDTACAEFICTEADGAERLMNGQRFDTLIFPRQWARG--LFLDLPETDRISVILAQ
RLMM_PSEMY      SKAKPGSACAEFVCSEAADGERMMRSVRFNSLIFPRQWARG--GFVMLPESDRISVLLDA
RLMM_PSEU5      AKARPDSACAEFICSEPGGAERLMRRLRFADLIFPRQWARG--DYLQLPETDRISVLLAH
RLMM_AZOVD      ARAKPNSAHAEFVCSEPGGAERLMRELRFAGLVFPRQWARG--AFVELPESERIGVLLEH
RLMM_PSEAE      AKSKPASAHVEFVCQDADGAERLMRRLRFADLIFPRQWARGP-GFIELPESQRIEVLLAE
RLMM_PSEA8      AKSKPASAHVEFVCQDADGAERLMRRLRFADLIFPRQWARGP-GFIELPESQRIEVLLAE
RLMM_PSEAB      AKSKPASAHVEFVCQDADGAERLMRRLRFADLIFPRQWARGP-GFIELPESQRIEVLLAE
RLMM_PSEA7      ARSKPASAHVEFVCQDVDGAERLMRRLRFAELIFPRQWARGP-GFIELPESQRIEVLLEE
RLMM_SACD2      VKTNADTGYVEFVLPDLDSATALFEAIRFDDLVFVRHWFVTPAIASDLPKEDRASPLMAS
RLMM_TERTT      PKARDGQGYVQFVVDDGAELLRCINAVVFDELVFVRDWFVSAGAISGLPADDRVSPLQNQ
RLMM_CELJU      SKTKDNAAFVVFITQDERGAETLIRQLPFQSLIFVRQWFAGFGNLSDLPVTDRVSPLLEA
RLMM_MARHV      FQPIRNAGLVRFTLGGPESAFELMQRIPLDELVFVRDWFLVI-GDCPLPARDRVGAVIEF
RLMM_METCA      VRAKENSAYVVFVAHEPEILANRAARLRFDALIFARQRIFASGPLADLPVDDRITPLLDT
RLMM_XANAC      ARTQRNDGYVLFVCD---EAAQLAAKLQWRELIFARQKLVVIAELKGIDPKDRITPILAA
RLMM_XANC5      ARTQRNDGYVLFVCD---EAAQLAAKLQWRELIFARQKLVVIAELKGIDPKDRITPILAA
RLMM_XANOR      ARTQRNDGYVLFVCD---EAAQLAAKLQWRELIFARQKLVVIAELKGIDPKDRITPILAA
RLMM_XANOM      ARTQRNDGYVLFVCD---EAAQLAAKLQWRELIFARQKLVVIAELKGIDPKDRITPILAA
RLMM_XANOP      ARTQRNDGYVLFVCD---EAAQLAAKLQWRELIFARQKLVVIAELKGIDPKDRITPILAA
RLMM_XANCP      ARTQRNDGYVLFVCD---EAAQLAARLQWRELIFARQKLVVLAELKGLDPKDRITPILAA
RLMM_XANC8      ARTQRNDGYVLFVCD---EAAQLAARLQWRELIFARQKLVVLAELKGLDPKDRITPILAA
RLMM_XANCB      ARTQRNDGYVLFVCD---EAAQLAARLQWRELIFARQKLVVLAELKGLDPKDRITPILAA
RLMM_STRMK      ARTQRNDGYVLFMCD---EAAALAPRLRWRELIFARQKLVVLAELPQLDPADRITPMLDV
RLMM_STRM5      ARTQRNDGYVLFMCD---EAAALAPRLRWRELIFARQKLVVLAELPQLDPADRITPMLEV
RLMM_XYLFT      IHAQRNHGFVLLRCDPL-HVDTLLQQLHWRRLIFARQTLRLHAELKTLNSRDRIAPILAA
RLMM_XYLF2      IHAQRNHGFVLLRCDPL-HVDTLLQQLHWRRLIFARQTLRLHAELKTLNSRDRIAPILAA
RLMM_XYLFM      IYAQRNHGFVLLRCDPL-HVDTLLQQLHWRRLIFARQTLRLHAELKTLNSRDRIAPILAA
RLMM_XYLFA      IHAQRNHGFVLLRCDPL-HVDTLLQQLHWRRLIFARQTLRLHAELKTLNSRDRIAPILAA
RLMM_HAHCH      SKIDKGTGVVFWRCSQG-NPLDVYKEIEVSRCIFARQVFCALHDIEIEDTTDRVSPVVEA
RLMM_AZOSB      VRTEPGSGYAAFETFEPVPVIKLGEFADWRKPVFARQLLPWFDRIDDLPERDRARPLVDM
RLMM_THASP      VRAEPDSGYVIYETFEPTPLGSFGESTDWRRPVFARQLLPWFARVDDLPERDRATPIVEA
RLMM_AROAE      VRTRPGSAFVTFETHEPVAFADLAERCDWRTLIFARQLLPWFARVDDLPERDRATPIATA
RLMM_ALKEH      PRVENDQGRVDFHSADGRPLPTPP------ALTFARQAWPVVADCPQLPERDRVGALLEA
RLMM_HALHL      CRARAQSAYVVFHAPAG-DAPLPP------QLVFARAGAGLIGELQGLPEGGRAEAIAAA
RLMM_LARHH      KPVETGEGFVLLQSDAPLTPFGWR------DLAFSRTLSRVIADIQ-LGDRDRLTPILDV
                       .                         * *                *   :   

RLMM_ACTPJ      YQA----LNPRHSSDIFVETPDTNEAKELLTFCRKFTVPLRNSLKKQGWLTKSERAKGSI
RLMM_ACTP7      YQA----LNPRHSSDIFVETPDTNEAKELLTFCRKFTVPLRNSLKKQGWLTKSERAKGSI
RLMM_ACTP2      YQA----LNPRHSSDIFVETPDTNEAKELLTFCRKFTVPLRSSLKKQGWLTKSERAKGSM
RLMM_HAEDU      YKT----LQPKHSSALFVETPDTNEAKALLTFCRKFTVPLRNSLKQEGWLTSSDNVKDSI
RLMM_HAEIN      FEELSQQVNFAQSSELFVETADTNEAKELSTFCRKFTVPLRQALKKQGWLSAKASQKCGQ
RLMM_HAEI8      FEELSQQVNFAQSSELFVETADTNEAKELSTFCRKFTVPLRQALKKQGWLSAKASQKCGQ
RLMM_HAEIG      FEELSQQVNFAQSSELFVETADTNEAKELSTFCRKFTVPLRQALKKQGWLSAKASQKCGQ
RLMM_HAEIE      FEELSQQVNFAQSSELFVETADTNEAKELSTFCRKFTVPLRQALKKQGWLSAKATQKSGQ
RLMM_ACTSZ      YQEVSPHLKLQQSSELWVETADTNEAKELSAFCRKFTVPLRQALKKQGWLNFKQIKDSGM
RLMM_MANSM      YNRIGSLVNLHRTTELFVETADTNEAKELSVFCRKFTVPLRQALKKQGYLAFKEVKKSGL
RLMM_PASMU      YQAIAHQINLTYSTELLVETADTNEAKSLSAFCRKFTVPLRQALKKQGWLQGTRHHKQGL
RLMM_AGGAN      YQQIADKIDLKQSTELLVETADTNEAKELLGFCRKFTVPLRQTLKKQGWLRASNHAKCGL
RLMM_HAES1      YRQQEKILNLKQSSDIWVETADTNEAKTLAAFCRKFTVPLRQALRKQGWLQAKNK-KSGI
RLMM_HISS2      YRQQEKILNLKQSSDIWVETADTNEAKTRAAFCRKFTVPLRQAFRKQGWLQAKNK-KSGI
RLMM_ECOBR      LQ-----GVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRP-
RLMM_ECO5T      LQ-----GVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRP-
RLMM_ECO55      LQ-----GVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRP-
RLMM_ECOLC      LQ-----GVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRP-
RLMM_ECOBW      LQ-----GVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRP-
RLMM_ECODH      LQ-----GVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRP-
RLMM_ECOLI      LQ-----GVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRP-
RLMM_ECOSE      LQ-----GVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRP-
RLMM_ECOSM      LQ-----GVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRP-
RLMM_ECOHS      LQ-----GVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRP-
RLMM_ECO24      LQ-----GVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRP-
RLMM_ECO57      LQ-----GVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRP-
RLMM_ECO5E      LQ-----GVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRP-
RLMM_ECOLU      LQ-----GVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRP-
RLMM_ECO7I      LQ-----GVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRP-
RLMM_ECO8A      LQ-----GVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRP-
RLMM_SHIB3      LQ-----GVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRP-
RLMM_SHIFL      LQ-----GVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRP-
RLMM_SHIF8      LQ-----GVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRP-
RLMM_SHISS      LQ-----GVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRP-
RLMM_SHIBS      LQ-----GVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRP-
RLMM_SHIDS      LQ-----GVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAVLRDAGGLANYETPKRP-
RLMM_ECOUT      LQ-----GVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRP-
RLMM_ECOK1      LQ-----GVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRP-
RLMM_ECO45      LQ-----GVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRP-
RLMM_ECO27      LQ-----GVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRP-
RLMM_ECO81      LQ-----GVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRP-
RLMM_ECOL6      LQ-----GVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRP-
RLMM_ECOL5      LQ-----GVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRP-
RLMM_ESCF3      LQ-----GVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRP-
RLMM_SALA4      LQ-----GVVEKGGELRVEVADTNESKELMKFCRKFTVPLRAALRDAGVLTNYETPKRP-
RLMM_SALAR      LQ-----GVVEKGGELRVEVADTNESKELMKFCRKFTVPLRAALRDAGVLTHYETPKRP-
RLMM_SALCH      LQ-----GVVEKGGELRVEVADTNESKELMKFCRKFTVPLRAALRDVGVLTNYETPKRP-
RLMM_SALPC      LQ-----GVVEKGGELRVEVADTNESKELMKFCRKFTVPLRAALRDVGVLTNYETPKRP-
RLMM_SALSV      LQ-----GVVEKGGELRVEVADTNESKELMKFCRKFTVPLRAALRDAGVLTNYETPKRP-
RLMM_SALTI      LQ-----GVVEKGGELRVEVADTNESKELMKFCRKFTVPLRAALRDAGVLTNYETPKRP-
RLMM_SALTY      LQ-----GVVEKGGELRVEVADTNESKELMKFCRKFTVPLRAALRDAGVLTNYETPKRP-
RLMM_SALPB      LQ-----GVVEKGGELRVEVADTNESKELMKFCRKFTVPLRAALRDAGVLTNYETPKRP-
RLMM_SALEP      LQ-----GVVEKGGELRVEVADTNESKELMKFCRKFTVPLRAALRDAGVLTNYETPKRP-
RLMM_SALNS      LQ-----GVVEKGGELRVEVADTNESKELMKFCRKFTVPLRAALRDAGVLTNYETPKRP-
RLMM_SALDC      LQ-----GVVEKGGELRVEIADTNESKELMKFCRKFTVPLRAALRDAGVLTNYETPKRP-
RLMM_SALG2      LQ-----GVVEKGGELRVEVADTNESKELMKFCRKFTVPLRAALRDAGVLTNYETPKRP-
RLMM_SALHS      LQ-----GVVEKGGELRVEVADTNESKELMKFCRKFTVPLRAALRDAGVLTNYETPKRP-
RLMM_SALPA      LQ-----GVVEKGGELRVEVADTNESKELMKFCRKFTVPLRAALRDAGVLTNYETPKRP-
RLMM_SALPK      LQ-----GVVEKGGELRVEVADTNESKELMKFCRKFTVPLRAALRDAGVLTNYETPKRP-
RLMM_CITK8      LQ-----GVVEKGGELRVEVADTNESKELMKFCRKFTVPLRAALRDAGILTNYETPKRP-
RLMM_KLEP3      LQ-----GVVEKGGELRVEVADTNESKELMKFCRKFTVPLRAALREAGVLTNYETPKRP-
RLMM_KLEP7      LQ-----GMVEKGGELRVEVADTNESKELMKFCRKFTVPLRAALREAGVLTNYETPKRP-
RLMM_CROS8      LQ-----GVVEKGGELRVEVADTNESKELMKFCRKFTVPLRTALRDAKILANFETPKRP-
RLMM_ENT38      LQ-----GVVEKGGDLRVEVADTNESKELMKFCRKLTVPLRAALREVGVLTNYETPKRP-
RLMM_ERWT9      LT-----GVVEKGGDLRVEVPDTNASKELLKFCRKFTVPLRASLRKDGILLNFESAKRP-
RLMM_PECAS      LT-----GAIERAGDLRVEVPDTNESKELMKFCRKFTVPLRAALREHKILLGHEKADRP-
RLMM_PECCP      LS-----GAIERAGELRVEVPDTNESKELMKFCRKFTVPLRAALREHKILLGYEKADRP-
RLMM_SODGM      LT-----GAVAGAGEVRVEVPDTNESKELMKFCRKLTVPLRAALRAQRILKGEEHRSPQ-
RLMM_DICP7      LT-----GVVERAGELRVEVPDTNECKELMKFCRKFTVPLRTALRNDKILQAQEKPNRP-
RLMM_DICC1      LT-----GVLERAGELRVEVPDTNESKELMKFCRKFTVPLRAALRENRILLAQEKASRP-
RLMM_EDWI9      LL-----GVVEGGGELRVEVPDTNESKELLKFCRKFTVPLRAALREQRTLLRQENPYRP-
RLMM_YERPA      LV-----GVIEKAGELRVEVADTNESKELLKFCRKLTVPLRSALREQKILSARENAHRP-
RLMM_YERPN      LV-----GVIEKAGELRVEVADTNESKELLKFCRKLTVPLRSALREQKILSARENAHRP-
RLMM_YERPS      LV-----GVIEKAGELRVEVADTNESKELLKFCRKLTVPLRSALREQKILSARENAHRP-
RLMM_YERPB      LV-----GVIEKAGELRVEVADTNESKELLKFCRKLTVPLRSALREQKILSARENAHRP-
RLMM_YERP3      LV-----GVIEKAGELRVEVADTNESKELLKFCRKLTVPLRSALREQKILSARENAHRP-
RLMM_YERPY      LV-----GVIEKAGELRVEVADTNESKELLKFCRKLTVPLRSALREQKILSARENAHRP-
RLMM_YERPE      LV-----GVIEKAGELRVEVADTNESKELLKFCRKLTVPLRSALREQKILSARENAHRP-
RLMM_YERPP      LV-----GVIEKAGELRVEVADTNESKELLKFCRKLTVPLRSALREQKILSARENAHRP-
RLMM_YERPG      LV-----GVIEKAGELRVEVADTNESKELLKFCRKLTVPLRSALREQKILSARENAHRP-
RLMM_YERE8      LT-----GVVEKAGELRVEVADTNESKELLKFCRKLTVPLRNAMREQKILSARENPHRP-
RLMM_SERP5      LI-----GVVDRGGELRVEVPDTNESKELLKFCRKLTVPLRTAMREQKVLMARENKTRP-
RLMM_PHOLL      LH-----GVIERAGELRVEVPDTNESKELLKFCRKFTVPLRNAMRQEKILLIRENVNRP-
RLMM_PHOAZ      LQ-----GVMERAGELRVEVPDTNESKELLKFCRKFTVPLRNAMRQEKILLIRENANRP-
RLMM_PHOAA      LH-----GVIERAGDLRVEVPDTNESKELLKFCRKFTVPLRNAMRQEKILQIRENTKRP-
RLMM_PROMH      LK-----GSTEKAGELRVEVADTNESKELLKFCRKFTVPLRNQLRKEKILLKVENYSRP-
RLMM_ALIF1      LSDV---DGVPCCGDIRIETPDTNEAKELLKFCRKFTVPMRQALRGKKMLTERDSNRIP-
RLMM_ALIFM      LSEV---EDVPCCGDIRIETPDTNEAKELLKFCRKFTVPMRQALRGKKMLTERDSNRIP-
RLMM_ALISL      LSSV---EGVPHCGDIRIETPDTNEAKELLKFCRKFTVPLRQALRGKQMLTARDTDRIP-
RLMM_VIBCB      LSEI---EAFPRCGDLRIETPDTNEAKELLKFCRKFTVPMRQAMRGKGLMWNKDNAKKP-
RLMM_VIBPA      LSEF---ESFPRCGDLRIETPDTNEAKELLKFCRKFTVPMRQALRGKGLMWNKDNAKKP-
RLMM_VIBA3      LSEK---EGFPRCGDIRIETPDTNEAKELLKFCRKFTVPMRQAMRGKGLMTAKDNAKKP-
RLMM_VIBVU      LGEI---DAFPVCGDLRIETPDTNEAKELLKFCRKFTVPMRQALRGKGLLLAKENAKKP-
RLMM_VIBVY      LGEI---DAFPVCGDLRIETPDTNEAKELLKFCRKFTVPMRQALRGKGLLLAKENAKKP-
RLMM_PHOPR      V------KGFPRCGELRIETPDTNEAKELLKFCRKFTVPLRQAMRKKDVLYAQDSTWKP-
RLMM_AERHH      TQ------GYAICGDLRVETADTNEAKELSAFCRKFTVPLRQALRGNELLTKKETPHRP-
RLMM_AERS4      TS------EYTICGDLRVETADTNEAKELSAFCRKFTVPLRQALRSKELLTKKETPHRP-
RLMM_TOLAT      VQ------KMPQFGELRVETADTNEAKELSTFCRKFSVPLRQALRAAGKLTPDVDPRRP-
RLMM_SHEB5      L------SDVSKAGEVRVETPDTNEAKELSAFCRKFTVPLRQHLKKSGSLLAQENPKRP-
RLMM_SHEB2      L------SDVSKAGEVRVETPDTNEAKELSAFCRKFTVPLRQHLKKSGSLLAQENPKRP-
RLMM_SHEB8      L------SDVSKAGEVRVETPDTNEAKELSAFCRKFTVPLRQHLKKSGSLLAQENPKRP-
RLMM_SHEB9      L------SDVSKAGEVRVETPDTNEAKELSAFCRKFTVPLRQHLKKSGSLLAQENPKRP-
RLMM_SHESW      L------SDVSKAGEVRVETPDTNEAKELSAFCRKFTVPLRQHLKKSGSLLAQENPKRP-
RLMM_SHEPC      L------SDVSKAGEVRVETPDTNEAKELSAFCRKFTVPLRQHLKKSGSLLAQENPKRP-
RLMM_SHESM      L------SDVSKAGELRVETPDTNEAKELSAFCRKFTVPLRQHLKKSGSLLAQENPKRP-
RLMM_SHESR      L------SDVSKAGELRVETPDTNEAKELSAFCRKFTVPLRQHLKKSGSLLAQENPKRP-
RLMM_SHESA      L------SEVSKAGELRVETPDTNEAKELSAFCRKFTVPLRQHLKKSGSLLAQENPKRP-
RLMM_SHEON      L------SEVSKAGELRVETPDTNEAKELSAFCRKFTVPLRQHLKKSGSLLAQENPKRP-
RLMM_SHEDO      LLE----ADVTKCGELRVETPDTNEAKELSAFCRKFTVPLRQGLKKVGVLLDKENGRRP-
RLMM_SHEFN      L------AALSKCGELRVETPDTNEAKELSAFCRKLTVPLRQGLKKSGALLNAESDRRP-
RLMM_SHEHH      L------AQVHKAGELRVETPDTNEAKELSNFCRKFTVPLRQALKKSGALLEKENPKRP-
RLMM_SHEPA      L------TQVNKAGELRVETPDTNEAKERSNFCRKFTVPLRQALKKSGALLEKENPKRP-
RLMM_SHESH      L------SDVRNAGELRVETPDTDAAKERTTFCRKFTVPLRQKLKNSGNLLKKESSSRP-
RLMM_SHEWM      L------SDVRNAGELRVETPDTNEAKERTAFCRKFTVPLRQKLKNAGNLLKKENSSRP-
RLMM_SHELP      L------AKVHRAGELRVETPDTNEAKELSTFCRKLTVPLRQALKRSGALLEKENPKRP-
RLMM_SHEAM      L------TEVERAGELRVETPDTNEAKELSAFCRKFTVPLRQALKKRGVLLDKESSRRP-
RLMM_PSYIN      ----EITRNLPLGGDLYVETPEGDDTKPLLTFCRKFTVPLRQALRKHNSLTAKENRNK--
RLMM_ALTMD      LK--EVEKPFSIFGAVDVEYPDTEEGKTLAKFCRKFTVPLRQALRKAGWLTAKENLGK--
RLMM_COLP3      ----EALGNDWQYSDLRMEMADDNDGKSLSKFCRKLSVPLRQALRKNKVLTQKGNNSADD
RLMM_PSEA6      ----NGCIEFPECGELRVEHADSTQGREISKFCRKISVPLRQALRGKRILTPLERSNL--
RLMM_IDILO      LK--PHQETFGLAGELRVGTPDTNEANQLSKFCRKFSVPLRQALRKEELLSNKPLAKR--
RLMM_PSET1      AK------DFTLCSELRVETPDTNEGKELLTFCKKISTPLKKALEKRNIVLREPKANR--
RLMM_CHRSD      VV-----ASGWSFESIWQETPDTNEEKALAGLMKALRKPLESTLKKRGALRRKAGGRR--
RLMM_MARMS      AR-----ELPLA-EEIWIETADTNDAKALSGLIKKLEKPLREGWKRSGVLRNKAVGVR--
RLMM_PSEP1      LVD------FPVFGSLWLEVLDSNEGKELSTFCRKFEVPLRKALEKAGRLVDDPGRPRL-
RLMM_PSEPK      LAD------FPVFGSLWLEVLDSNEGKELSTFCRKFEVPLRKALEKAGRLVDDPGRPRL-
RLMM_PSEPG      LAD------FPVFGSLWLEVLDSNEGKELSTFCRKFEVPLRKALEKAGRLVDDASRPRL-
RLMM_PSEPW      LAA------LPVFGSLWLEVLDSNDGKELSTFCRKFEVPLRKALEKAGRLVDNASLPRL-
RLMM_PSEE4      LAD------LPVCGSLWLEVLDSNEGKELSTFCRKFEVPLRKALEKAGRLVDDARRPRL-
RLMM_PSEPF      MSE------FPVCGSLWLEVVDTNDGKELSNFCKKFEGPLRKALTGAGKLVEDTSKPRL-
RLMM_PSEFS      LRE------FPVCGSLWLEMVDTNDGKELSNFCKKFEVHLRKALLNAGKLVDDPSKPRL-
RLMM_PSEF5      LAN------FPQCGSLWLEVVDTNDGKELSNFCKKFEAPLRKALTAAGKLVDDATKPRL-
RLMM_PSE14      LSA------FPACGSLWLEVVDTNDGKELSNFCKKFEAPLRKALMQAGKLVDDPRKPRL-
RLMM_PSEU2      LAA------FPICGSLWLEVVDTNDGKELSNFCKKFEAPLRKALTQAGKLVDDPRKPRL-
RLMM_PSESM      LST------FPTCGSLWLEVVDTNDGKELSNFCKKFEAPLRKALTQAGKLVDDPRKPRL-
RLMM_PSEMY      LAD------YPVCGSLWLEVVDTNDGKELSTFCKKFEAPLRKALLKAGKLVDDARKPRL-
RLMM_PSEU5      LAD------YPVCSSLWLEVLDTNDGKELSNFCRKFEAPLRKALVKAGRLDEQGKGPRL-
RLMM_AZOVD      LAA------YPVCGSLWLEVLDSNEGKELSTFCRKFEVPLRKALGKTGRLLDDPRRPRL-
RLMM_PSEAE      LAS------YPVCGSLWLEVLDTNAGKEVSTFCRKFEKPLRAALVKAGRLQEDPALPRL-
RLMM_PSEA8      LAS------YPVCGSLWLEVLDTNAGKEVSTFCRKFEKPLRAALVKAGRLQEDPALPRL-
RLMM_PSEAB      LAS------YPVCGSLWLEVLDTNAGKEVSTFCRKFEKPLRAALVKAGRLQEDPALPRL-
RLMM_PSEA7      LAS------YPVCGSLWLEVLDTNAGKEVSTFCRKFEKPLRAALVKAGRLQEDLALPRL-
RLMM_SACD2      AQA------LPPLAKLEPITLDTNDGKALVALTRGVTNHMRTVFKKAGAF-NAKSDWVG-
RLMM_TERTT      FKAA-FSGHIQEVADLLFLNVDSNEGKALSKLTRGVGSHLKRQLPLAKG-----SDWLG-
RLMM_CELJU      ARA------LPKTSDLTGETVDTNEGKALSALVKKFLLPFGKALDAHKCL-DRKSPWRL-
RLMM_MARHV      LRGA--DWQGSLASRLETRLTETNEDRDLGNFARKWVAPLSRGLREADMLAQDSASAKGD
RLMM_METCA      AA-----GLQRRYSTLWLETADTNEAKELAAFTRKFERPFAAAA--AGLLGGGPQAPRL-
RLMM_XANAC      LD------GQQRFGDLWVEHPDSDAGKPLAGLARSFGNALRPALRKAGLLTDKPQPRQP-
RLMM_XANC5      LD------GHQRFGDLWVEHPDSDAGKPLAGLARSFGNALRPALRKAGLLTDKPQLRQP-
RLMM_XANOR      LE------GQQRFGDLWVEHPDSDAGKPLAGLARSFGNALRPALRKAGLLTDKPQPRQP-
RLMM_XANOM      LE------GQQRFGDLWVEHPDSDAGKPLASLARSFGNALRPALRKAGLLTDKPQPRQP-
RLMM_XANOP      LE------GQQRFGDLWVEHPDSDAGKPLASLARSFGNALRPALRKAGLLTDKPQPRQP-
RLMM_XANCP      LD------GQPRFGDLWVEHPDSDAGKPLAGLARSFGNALRPALRKAGLLTDKPQARLP-
RLMM_XANC8      LD------GQPRFGDLWVEHPDSDAGKPLAGLARSFGNALRPALRKAGLLTDKPQARLP-
RLMM_XANCB      LD------GQPRFGDLWVEHPDSDAGKPLAGLARSFGNALRPALRKAGLLTDKPQARLP-
RLMM_STRMK      LA------DAPRFGDLWVEHPDSDAGKPLSGLARAFGNALRPALRKAGKLTDKPNNRLP-
RLMM_STRM5      LA------DAPRFGDLWVEHPDSDAGKPLSGLARAFGNALRPALRKAGKLTDKPNNRLP-
RLMM_XYLFT      LP------KTPCFGDLWIEYPDSDMGKPLAGLARSFGNALRPVLRSAGRLSAQLHPQWP-
RLMM_XYLF2      LP------KTPCFGDLWIEYPDSDMGKPLAGLARSFGNALRPVLRSAGRLSAQLHPQWP-
RLMM_XYLFM      LP------KTPCFGDLWIEYPDSDMGKPLAGLARSFGNALRPVLRSAGRLSAQLHPQWP-
RLMM_XYLFA      LP------KTPCFGDLWIEYPDSDMGKPLAGLARSFGNALRPVLRSAGRLSAQLHPQWP-
RLMM_HAHCH      LR------PGGAFGFLHIETPLEDEAGSLQKLAKKLTAPMSAALRNAGVLSKAKTDELP-
RLMM_AZOSB      VK-----GSGQRFSGVVLETPDTDEAKQRSGFCRRFTEPLTRELEKVGALRLGKPGFPV-
RLMM_THASP      VK-----ASGQRFSGVMLETPDTDEAKQRSGFCKRFTEPLAKALEKAGCLRSSRAGLPV-
RLMM_AROAE      TR-----NAGQRFAQLMLETPDTDEAKQQSGFCRRFTVPLQHELERIGAFREGAKGLPE-
RLMM_ALKEH      LAP----HLPEALAGVWLEHPDTNDGKALGRFCRKFRPHLERALRERGVALERAGAPRLH
RLMM_HALHL      LPP----AVGSATP--WVEHPDSDAGRPLARFCRRFTGPLRHALTQTGVTSGDP-QRRLR
RLMM_LARHH      VGQ----KAMTFAS-IWLEWPDTNDGKAMSGFARKFQPLLEEKLATAGRLGQDA-STRLQ
                                               : :     :                    

RLMM_ACTPJ      ----GLHILFVRPGCCYVGYAYNDNKSPFFMGIPRLKFPAEAPSRSTLKLEEAILTFIPE
RLMM_ACTP7      ----GLHILFVRPGCCYVGYAYNDNKSPFFMGIPRLKFPAEAPSRSTLKLEEAILTFIPE
RLMM_ACTP2      ----GLHILFVRPGCCYVGYAYNDNKSPFFMGIPRLKFPAEAPSRSTLKLEEAILTFIPE
RLMM_HAEDU      ----SLHILFIRPGCCYVGYAYNHNKSPFFMGIPRLKFPSDAPSRSTLKLEEAILTFIPI
RLMM_HAEIN      ----FLHCFFVKPNCCYVGYSYVDNHSSHFMGIPRLKFPADAPSRSTLKLEEAILTFIPR
RLMM_HAEI8      ----FLHCFFVKPNCCYVGYSYVDNHSSHFMGIPRLKFPADAPSRSTLKLEEAILTFIPR
RLMM_HAEIG      ----FLHCFFVKPNCCYVGYSYVDNHSSHFMGIPRLKFPADAPSRSTLKLEEAILTFIPR
RLMM_HAEIE      ----FLHCFFVKPNCCYVGYSYVDNHSPHFMGIPRLKFPADAPSRSTLKLEEAILTFIPR
RLMM_ACTSZ      ----TLHCLFVRSDACYAGYSYNRNHSPYFMGIPRLKFPTEAPSRSTLKLEEAILTFIPR
RLMM_MANSM      ----TLHIFFVKPNCCYVGYSYNNNHSPNFMGILRLKFPPQAPSRSTLKLHEAILTFLSP
RLMM_PASMU      ----TLHILMLDSTQCYVGYSYNYNHSEHFMGIPRLKFPLDAPSRSTLKLEEAILTFLSR
RLMM_AGGAN      ----FLHLFFLRNNACYVGYSYNHNHSAHLMGIQRLKFPADAPSRSTLKLEEAILTFIPR
RLMM_HAES1      ----TLHIFFTQSNSCYIGYSYNNNHAEHIMGIPRLKFPAEAPSRSTLKLEEAILYFIPP
RLMM_HISS2      ----TLHIFFTQSNSCYIGYSYNNNHAEHIMGIPRLKFPAEAPSRSTLKLEEAILYFIPP
RLMM_ECOBR      ----VVHVFFIAPGCCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPA
RLMM_ECO5T      ----VVHVFFIAPGCCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPA
RLMM_ECO55      ----VVHVFFIAPGCCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPA
RLMM_ECOLC      ----VVHVFFIAPGCCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPA
RLMM_ECOBW      ----VVHVFFIAPGCCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPA
RLMM_ECODH      ----VVHVFFIAPGCCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPA
RLMM_ECOLI      ----VVHVFFIAPGCCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPA
RLMM_ECOSE      ----VVHVFFIAPGCCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPA
RLMM_ECOSM      ----VVHVFFIAPGCCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPA
RLMM_ECOHS      ----VVHVFFIAPGCCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPA
RLMM_ECO24      ----VVHVFFIAPGCCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPA
RLMM_ECO57      ----VVHVFFIAPGCCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPA
RLMM_ECO5E      ----VVHVFFIAPGCCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPA
RLMM_ECOLU      ----VVHVFFIAPGCCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPA
RLMM_ECO7I      ----VVHVFFIAPGCCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPA
RLMM_ECO8A      ----VVHVFFIAPGCCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPA
RLMM_SHIB3      ----VVHVFFIAPGCCYTGYSYSNNNSPFYMGIPRLKFPAEAPSRSTLKLEEAFHVFIPA
RLMM_SHIFL      ----VVHVFFIAPGCCYTGYSYSNNNSPFYMGIPRLKFPAEAPSRSTLKLEEAFHVFIPA
RLMM_SHIF8      ----VVHVFFIAPGCCYTGYSYSNNNSPFYMGIPRLKFPAEAPSRSTLKLEEAFHVFIPA
RLMM_SHISS      ----VVHVFFIAPGCCYTGYSYSNNNSPFYMGIPRLKFPAEAPSRSTLKLEEAFHVFIPA
RLMM_SHIBS      ----VVHVFFIAPGCCYTGYSYSNNNSPFYMGIPRLKFPAEAPSRSTLKLEEAFHVFIPA
RLMM_SHIDS      ----VVHVFFIAPGCCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPA
RLMM_ECOUT      ----VVHVFFIAPGCCYTGYSYSSNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPA
RLMM_ECOK1      ----VVHVFFIAPGCCYTGYSYSSNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPA
RLMM_ECO45      ----VVHVFFIAPGCCYTGYSYSSNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPA
RLMM_ECO27      ----VVHVFFIAPGCCYTGYSYSSNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPA
RLMM_ECO81      ----VVHVFFIAPGCCYTGYSYSSNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPA
RLMM_ECOL6      ----VVHVFFIAPGCCYTGYSYSSNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPA
RLMM_ECOL5      ----VVHVFFIAPGCCYTGYSYSSNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPA
RLMM_ESCF3      ----VVHVFFIAPGCCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPA
RLMM_SALA4      ----VVHVFFIAPGCCYTGYSLAHNNSPFYMGIPRLKFPSDAPSRSTLKLEEALHVFIPE
RLMM_SALAR      ----VVHVFFIAPGCCYTGYSLAHNHSPFYMGIPRLKFPSDAPSRSTLKLEEALHVFIPE
RLMM_SALCH      ----VVHVFFIAPGCCYTGYSFAHNNSPFYMGIPRLKFPSDAPSRSTLKLEEALHVFIPE
RLMM_SALPC      ----VVHVFFIAPGCCYTGYSFAHNNSPFYMGIPRLKFPSDAPSRSTLKLEEALHVFIPE
RLMM_SALSV      ----VVHVFFIAPGCCYTGYSFAHNNSPFYMGIPRLKFPSDAPSRSTLKLEEALHVFIPE
RLMM_SALTI      ----VVHVFFIAPGCCYTGYSFAHNNSPFYMGIPRLKFPSDAPSRSTLKLEEALHVFIPE
RLMM_SALTY      ----VVHVFFIAPGCCYTGYSFAHNNSPFYMGIPRLKFPSDAPSRSTLKLEEALHVFIPE
RLMM_SALPB      ----VVHVFFIAPGCCYTGYSFAHNNSPFYMGIPRLKFPSDAPSRSTLKLEEALHVFIPE
RLMM_SALEP      ----VVHVFFIAPGCCYTGYSFAHNNSPFYMGIPRLKFPSDAPSRSTLKLEEALHVFIPE
RLMM_SALNS      ----VVHVFFIAPGCCYTGYSFAHNNSPFYMGIPRLKFPSDAPSRSTLKLEEALHVFIPE
RLMM_SALDC      ----VVHVFFIAPGCCYTGYSFAHNNSPFYMGIPRLKFPSDAPSRSTLKLEEALHVFIPE
RLMM_SALG2      ----VVHVFFIAPGCCYTGYSFAHNNSPFYMGIPRLKFPSDAPSRSTLKLEEALHVFIPE
RLMM_SALHS      ----VVHVFFIAPGCCYTGYSFAHNNSPFYMGIPRLKFPSDAPSRSTLKLEEALHVFIPE
RLMM_SALPA      ----VVHVFFIAPGCCYTGYSFAHNNSPFYMGIPRLKFPSDAPSRSTLKLEEALHVFIPE
RLMM_SALPK      ----VVHVFFIAPGCCYTGYSFAHNNSPFYMGIPRLKFPSDAPSRSTLKLEEALHVFIPE
RLMM_CITK8      ----VVHVFFIAPGCCYTGYSYPDNNSPFYMGIPRLKFPADAPSRSTLKLEEALHVFIPA
RLMM_KLEP3      ----VVHVFFIAPGCCYTGYSYSNNNSPFYMGIPRLKFPSDAPSRSTLKLEEAFHVFIPA
RLMM_KLEP7      ----VVHVFFIAPGCCYTGYSYSNNNSPFYMGIPRLKFPSDAPSRSTLKLEEAFHVFIPA
RLMM_CROS8      ----VVHVFFIAPGCCYTGYSYTNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPA
RLMM_ENT38      ----VVHVFFIAPGCCYTGYSYTTNNSPFYMGIPRLRFPSDAPSRSTLKLEEAFHVFIPA
RLMM_ERWT9      ----VVHVFFIASGCCYVGYSLPANNSPLFMGIPRLKFPSDAPSRSTLKLEEAFHVFIPA
RLMM_PECAS      ----VLHVLFIAPGCCYVGYSYSNNNSPFYMGIPRLKFPSDAPSRSTLKLEEAFHVFVPA
RLMM_PECCP      ----VLHVLFIAPGCCYVGYSYSNNNSPFYMGIPRLKFPSDAPSRSTLKLEEAFHVFIPA
RLMM_SODGM      ----VIHVLFIAPGCCYAGYSYRDNHSPFYMGIPRLRFPPDAPSRSMLKLEEAFHVFIPA
RLMM_DICP7      ----VVHVLFIAPGCCYVGYSYSNNHSPFYMGIPRLKFPSDAPSRSTLKLEEAFHVFIPA
RLMM_DICC1      ----VIHVLFIAPGCCYVGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFVPA
RLMM_EDWI9      ----VVHVLFIAPGCCYVGYSYSDNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPA
RLMM_YERPA      ----VVHVFFIAPGCCYVGYSYSNNNSPFYMGIPRLKFPSDAPSRSTLKLEEAFHVFIPA
RLMM_YERPN      ----VVHVFFIAPGCCYVGYSYSNNNSPFYMGIPRLKFPSDAPSRSTLKLEEAFHVFIPA
RLMM_YERPS      ----VVHVFFIAPGCCYVGYSYSNNNSPFYMGIPRLKFPSDAPSRSTLKLEEAFHVFIPA
RLMM_YERPB      ----VVHVFFIAPGCCYVGYSYSNNNSPFYMGIPRLKFPSDAPSRSTLKLEEAFHVFIPA
RLMM_YERP3      ----VVHVFFIAPGCCYVGYSYSNNNSPFYMGIPRLKFPSDAPSRSTLKLEEAFHVFIPA
RLMM_YERPY      ----VVHVFFIAPGCCYVGYSYSNNNSPFYMGIPRLKFPSDAPSRSTLKLEEAFHVFIPA
RLMM_YERPE      ----VVHVFFIAPGCCYVGYSYSNNNSPFYMGIPRLKFPSDAPSRSTLKLEEAFHVFIPA
RLMM_YERPP      ----VVHVFFIAPGCCYVGYSYSNNNSPFYMGIPRLKFPSDAPSRSTLKLEEAFHVFIPA
RLMM_YERPG      ----VVHVFFIAPGCCYVGYSYSNNNSPFYMGIPRLKFPSDAPSRSTLKLEEAFHVFIPA
RLMM_YERE8      ----VVHVFFIASGCCYVGYSYSNNNSPFYMGIPRLKFPSDAPSRSTLKLEEAFHVFIPA
RLMM_SERP5      ----VVHVFFIAPGCCYVGYSFSNNNSPFYMGIPRLKFPSDAPSRSTLKLEEAFHVFIPA
RLMM_PHOLL      ----VIHVFFIAPGCCYVGYSYSNNNSPFYMGIPRLKFPSDAPSRSTLKLEEAFHVFIPH
RLMM_PHOAZ      ----VIHVFFIAPGCCYVGYSYSNNNSPFYMGIPRLKFPSDAPSRSTLKLEEAFHVFIPY
RLMM_PHOAA      ----VIHVFFIAPGCCYVGYSYSHNNSPFYMGIPRLKFPSDAPSRSTLKLEEAFHVFIPY
RLMM_PROMH      ----VIHVFFIAPGCCYVGYSYSFNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPY
RLMM_ALIF1      ----VLHICFIAPGHCYVGYSYTNNNSQFFMGIPRLKFPADAPSRSTLKLEEAFHVFIPK
RLMM_ALIFM      ----VLHICFIAPGHCYVGYSYTNNNSQFFMGIPRLKFPADAPSRSTLKLEEAFHVFIPK
RLMM_ALISL      ----VMHVCFIEPGHCYVGYSYTNNNSKFFMGIPRLKFPSDSPSRSTLKLEEAFHVFIPR
RLMM_VIBCB      ----VLHICFVAPGHCYVGYSYPGNNSQFFMGIPRLKFPADAPSRSTLKLEEAFHVFIPR
RLMM_VIBPA      ----VLHICFVAPGHCYVGYSLPGNNSQFFMGIPRLKFPADAPSRSTLKLEEAFHVFIPR
RLMM_VIBA3      ----VLHLCFIAPGHCFVGYSYPTNNSQFFMGIPRLKFPSDAPSRSTLKLEEAFHVFIPR
RLMM_VIBVU      ----VFHLCFVASGHCFAGYSYSHNNSRFFMGIPRLKFPADAPSRSTLKLEEAFHVFIPR
RLMM_VIBVY      ----VFHLCFVASGHCFAGYSYSHNNSRFFMGIPRLKFPADAPSRSTLKLEEAFHVFIPR
RLMM_PHOPR      ----VLHVCFIAPGCCFVGYSYTNNNSQFFMGIPRLKFPSDAPSRSTLKLEEAFHVFIPR
RLMM_AERHH      ----VFHAFFLANDHVLLGYSYSFNNSEFHMGIPRLRCPADAPSRSSLKLEEAFYVFVPR
RLMM_AERS4      ----VFHAFFMANDHLLLGYSYSFNNSEFHMGIPRLRCPPDAPSRSSLKLEEAFYVFVPR
RLMM_TOLAT      ----VLHLFFLKNDSVWIGYSYPNNNSPFHMGIPRLRFPSDAPSRSTLKLEEAFYMFIPP
RLMM_SHEB5      ----IIHVCFIGPGRAYVGYSYSNNSSPHFMGIPRLKMAADAPSRSSLKLDEAFGQFVPK
RLMM_SHEB2      ----IIHVCFIGPGRAYVGYSYSNNSSPHFMGIPRLKMAADAPSRSSLKLDEAFGQFVPK
RLMM_SHEB8      ----IIHVCFIGPGRAYVGYSYSNNSSPHFMGIPRLKMAADAPSRSSLKLDEAFGQFVPK
RLMM_SHEB9      ----IIHVCFIGPGRAYVGYSYSNNSSPHFMGIPRLKMAADAPSRSSLKLDEAFGQFVPK
RLMM_SHESW      ----IIHVCFIGPGRAYVGYSYSNNSSPHFMGIPRLKMAADAPSRSSLKLDEAFGQFVPK
RLMM_SHEPC      ----IIHVCFIGPGRAYVGYSYSNNSSPHFMGIPRLKMAADAPSRSSLKLDEAFGQFVPK
RLMM_SHESM      ----IIHVCFIGPGRAYAGYSFSNNSSPYFMGIPRLKMAADAPSRSSLKLDEAFAQFVPK
RLMM_SHESR      ----IIHVCFIGPGRAYVGYSFSNNSSPYFMGIPRLKMAADAPSRSSLKLDEAFAQFVPK
RLMM_SHESA      ----IIHVCFIGPGRAYVGYSFSNNSSPYFMGIPRLKMAADAPSRSSLKLDEAFAQFVPK
RLMM_SHEON      ----IIHVCFIGPGRAYAGYSLSNNSSPNFMGIPRLKMAADAPSRSSLKLDEAFAQFVPK
RLMM_SHEDO      ----IIHVCFVGPGKAYVGYSLSNNSSPHFMGIPRLRMAADAPSRSSLKLDEAFGAFLTK
RLMM_SHEFN      ----IIHVCFIGPGKAYAGYSLSHNSSPHFMGIPRLRMAADAPSRSSLKLDEAFGAFLTK
RLMM_SHEHH      ----IIHVCFVASGQAYVGFSLSNNSSPYFMGIPRLKIAADAPSRSTLKLDEAFIHFIPK
RLMM_SHEPA      ----IIHVCFVASGQAYVGYSLSNNSSPYFMGIPRLKIAADAPSRSTLKLDEAFIHFIPK
RLMM_SHESH      ----IIHVCFVASGTAYVGFSFSNNSSPYPMGIPRLKMASDAPSRSTLKLDEAFIHFIPE
RLMM_SHEWM      ----IIHVCFVASGTAYVGFSFSNNSSPYPMGIPRLKMASDAPSRSTLKLDEAFIHFIPE
RLMM_SHELP      ----IIHVCFVGPGTAYVGYSLSHNSSPYFMGIPRLKMASDAPSRSTLKLDEAFIHFIPK
RLMM_SHEAM      ----IVHVCFVAPNKAFTGYSLSNNSSPHFMGIPRLKFPADAPSRSTLKLDEAFIHFIPR
RLMM_PSYIN      ---IFYHLCFLDNKSAYIGFSVPHNRSEFYMGIPRLRSPSEAPSRSTLKLDEAIQVFLTA
RLMM_ALTMD      ---PKLHIFFASFEICYIGFTLPSHASRDHLGICRLKFPSDSPSRSTLKLEDALVNMLSN
RLMM_COLP3      PEGAILHALFLSGQEVILGFSLARNSSPHVMGIPRLKFPSASPSRSTLKLDEAFLHFIPR
RLMM_PSEA6      ---PVCHVYFEDSTTAIVGYSYPANNSSYPLGILRLKFPNEAPSRSTLKLDEAFQLFIPK
RLMM_IDILO      ---PMLHVLFVNPAHALVGYSYSYNQTLHNGGIVRLRMSKEAPSRSTLKLDEAFQVFVPE
RLMM_PSET1      ---PVMHVLFLTNNTAYVGYSYSFNNSPFFMGILRLRMPSDAPSRSTLKLDEAFNVFIPE
RLMM_CHRSD      -----LHLFWTAGDRVQLAMSFPGNRAEHLGGIPRLKFPREAPSRSTLKLEEAWHVFVPR
RLMM_MARMS      -----HHVFMLDGEAAYLGVSYAACRSEFPMGIRRLRFPAAGPSRSTLKLEEAFLQFVPE
RLMM_PSEP1      ------LLTFISGRRVFVGVASASNSALWPMGIPRLKFPREAPSRSTLKLEEAWHQFIPR
RLMM_PSEPK      ------LLTFISGRRVFVGVASASNSALWPMGIPRLKFPREAPSRSTLKLEEAWHQFIPR
RLMM_PSEPG      ------LLSFISGRRVFVGVAPANNSALWPMGIPRLKFPREAPSRSTLKLEEAWHQFIPR
RLMM_PSEPW      ------LLTFISGRRVFVGVAEANNSALWPMGIPRLKFPREAPSRSTLKLEEAWHQFIPR
RLMM_PSEE4      ------LLTFISGRRVFLGLAEADNSALWPMGIPRLKFPREAPSRSTLKLEEAWHQFIPR
RLMM_PSEPF      ------LLTFKSGREVFLGLADAGNSAMWPMGIPRLKFPREAPSRSTLKLEEAWHHFIPR
RLMM_PSEFS      ------LLTFKSGREVFMGLAESNNSAMWPMGIPRLKFPRDAPSRSTLKLEEAWHHFIPR
RLMM_PSEF5      ------LLTFKSGREVFVGLADAGNSAMWPMGIPRLKFPREAPSRSTLKLEEAWHHFIPR
RLMM_PSE14      ------LLTFKSGREVFLGLADADNSAMWPMGIPRLKFPREAPSRSTLKLEEAWHHFIPR
RLMM_PSEU2      ------LLTFKSGREVFLGLADADNSAMWPMGIPRLKFPREAPSRSTLKLEEAWHHFIPR
RLMM_PSESM      ------LLTFKSGREVFLGLAEADNSAMWPMGIPRLKFPREAPSRSTLKLEEAWHHFIPR
RLMM_PSEMY      ------LLTFKSGREVFAGIAEADNQAMWPMGIPRLKFPREAPSRSTLKLEEAWHHFIPR
RLMM_PSEU5      ------LLTFKSGREVFVGIAEANNSALWPMGIPRLKFPRQAPSRSTLKLEEAWHHFIPR
RLMM_AZOVD      ------LLTFRSGREVFLGLAEPDNSAAWPMGIPRLKFPREAPSRSTLKLEEAWHQFIPR
RLMM_PSEAE      ------LLTFRSGREVFVGLAEPRNSALWPMGIPRLKFPREAPSRSTLKLEEAWHQFIPR
RLMM_PSEA8      ------LLTFRSGREVFVGLAEPRNSALWPMGIPRLKFPREAPSRSTLKLEEAWHQFIPR
RLMM_PSEAB      ------LLTFRSGREVFVGLAEPRNSALWPMGIPRLKFPREAPSRSTLKLEEAWHQFIPR
RLMM_PSEA7      ------LLTFRSGREVFVGLAEPRNSALWPMGIPRLKFPREAPSRSTLKLEEAWHQFIPR
RLMM_SACD2      ------QVLFFSGEQACIGYFPQSNGSLWVGGIPRLRAPKDAPSRATLKLEEAWHQFIPR
RLMM_TERTT      ------VLLLLSGSEGFIGVCPRRQRPRWAGGVARLKFPREAPSRATLKLEEAWHHFIPA
RLMM_CELJU      ------HLVFLSGTEAYLGVAPVNNSSAWPMGIPRLRLPKSAPSRATLKLEEAWHHFIPA
RLMM_MARHV      ----RLELLLLDFETAVVGLSLADNRSPFPQGIPRLRLPASAPSRSALKLEEAWKVFIPE
RLMM_METCA      ------HVFFLTSTAAYLGYTLPDDSAPWPCGIPRLKLPRSAPSRSTLKLEEAFLVFVDR
RLMM_XANAC      ----RLHVCFLDGDHALLAVADSADSAPWPLGIPRLKLLPEAPSRSALKLDEALLTLLTP
RLMM_XANC5      ----RLHVCFLDGDHAVLAVADNADSAPWPLGIPRLKLLPEAPSRSALKLDEALLTLLTP
RLMM_XANOR      ----RLHICFLDGDHALLAVADSADSAPWPLGIPRLKLLPEAPSRSALKLDEALLTLLTP
RLMM_XANOM      ----RLHICFLDGDHALLAVADSADSAPWPLGIPRLKLLPEAPSRSALKLDEALLTLLTP
RLMM_XANOP      ----RLHICFLDGDHALLAVADSADSAPWPLGIPRLKLLPEAPSRSALKLDEALLTLLTP
RLMM_XANCP      ----RLHICFLDGDHALLAVADSSDSAPWPLGIPRLKLLPEAPSRSALKLDEALLTLLTP
RLMM_XANC8      ----RLHICFLDGDHALLAVADSSDSAPWPLGIPRLKLLPEAPSRSALKLDEALLTLLTP
RLMM_XANCB      ----RLHICFLDGDHALLAVADSSDSAPWPLGIPRLKLLPEAPSRSALKLDEALLTLLTP
RLMM_STRMK      ----RLHVVFVDGTHAFVCVADPADSAPWALGIPRLKLLPEAPSRSALKLDEALLTLLMP
RLMM_STRM5      ----RLHVVFVDGTHAFVCVADPADSAPWALGIPRLKLLPEAPSRSALKLDEALLTLLTP
RLMM_XYLFT      ----RLHVCFLSGDHVLLGSTRSVDSAPWQLGIPRLKLLPEAPSRSALKLEEALITLLTP
RLMM_XYLF2      ----RLHVCFLSGDHVLLGSTRSVDSAPWQLGIPRLKLLPEAPSRSALKLEEALITLLTP
RLMM_XYLFM      ----RLHVCFLSGDHVLLGSTRSVDSAPWQLGIPRLKLLPEAPSRSALKLEEALITLLTP
RLMM_XYLFA      ----RLHVCFLSGDHVLLGSTRSVDSAPWQLGIPRLKLLPEAPSRSALKLEEALITLLTS
RLMM_HAHCH      ----QLHLVCLSGQHIIAALAVHPNSSALPLGIPRLRFRNEAPSRSALKIEEAFLTMLTP
RLMM_AZOSB      -----LHVMFPTATSAWLAAGLKDRCAPWPMGIPRLRMPSNAPSRSTLKLAEAIMTLLSD
RLMM_THASP      -----LHVLFTSATTAWLAAGQPGQCSTWPMGIPRVRMPSNAPSRSTAKLSEAFMMLLEE
RLMM_AROAE      -----LHILFPDTSTAWLCAALPGQAALWPMGIPRLRMLREAASRSTLKLAEAIFTLLSE
RLMM_ALKEH      -------LWFADSRQVVAGLAPAGSGRPWPMGIPRLRLPRAAPSRSALKLEEAVGWLLTP
RLMM_HALHL      -------LLFPDSRHCFAGIGPREG---WPSGIPRLRMPRNAPSRSVLKLEEALHRLVPE
RLMM_LARHH      -------LFFPSKSRVLVSVSEPQWGAPWPLGILRLRMPTDAPSRSTLKLAEAFEVFLGE
                                               *: *::    ..**:  *: :*   ::  

RLMM_ACTPJ      AEEKKRFTDEMTGVDLGACPGGWTYQLVKRGVFVYAVDHGKMAASLHETGRIEHCPEDGF
RLMM_ACTP7      AEEKKRFTDEMTGVDLGACPGGWTYQLVKRGVFVYAVDHGKMAASLHETGRIEHCPEDGF
RLMM_ACTP2      AEEKKRFTDEMTGVDLGACPGGWTYQLVKRGVFVYAVDHGKMAASLHETGRIEHCPEDGF
RLMM_HAEDU      NQEKKRFNEQMKGVDLGACPGGWTYQLVKRGLFVYAVDHGKIAATLHETGRIEHCVEDGF
RLMM_HAEIN      KEENKRLNENMIGVDLGACPGGWTYQLVKRGLFVYAVDHGKMAASLHDTGRIEHCAEDGF
RLMM_HAEI8      KEENKRLNENMIGVDLGACPGGWTYQLVKRGLFVYAVDHGKMAASLHDTGCIEHCAEDGF
RLMM_HAEIG      KEENKRLNENMIGVDLGACPGGWTYQLVKRGLFVYAVDHGKMAANLHDTGRIEHCAEDGF
RLMM_HAEIE      KEENKRLNENMIGVDLGACPGGWTYQLVKRGLFVYAVDHGKMAASLHDTGRIEHCAEDGF
RLMM_ACTSZ      EEESKRLNENMIGVDLGACPGGWTYQLVKRGLFVYAVDHGKMAASLHETGRIEHCSEDGF
RLMM_MANSM      EEERKCMNESMYGVDLGACPGGWTYQLVKRGLFVYAVDHGKMAASLHDTGRIDHCPEDGF
RLMM_PASMU      EEEKKRLNEQMYAVDLGACPGGWTYQLVKRGLFVYAVDHGKMAASLHDTGRIEHCAEDGF
RLMM_AGGAN      QKETEWLNENQYAVDLGACPGGWTYQLVKRGLFVYAVDHGKMAASLHETGRIEHCAEDGF
RLMM_HAES1      NQEATRFNENKYAVDLGACPGGWTYQLVRRGVFVYAVDHGKMATSLHETGRIEHCAEDGF
RLMM_HISS2      NQEATRFNENKYAVDLGACPGGWTYQLVRRGVFVYAVDHGKMATSLHETGRIEHCAEDGF
RLMM_ECOBR      DEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_ECO5T      DEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_ECO55      DEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_ECOLC      DEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_ECOBW      DEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_ECODH      DEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_ECOLI      DEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_ECOSE      DEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_ECOSM      DEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_ECOHS      DEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_ECO24      DEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_ECO57      DEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_ECO5E      DEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_ECOLU      DEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_ECO7I      DEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_ECO8A      DEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_SHIB3      DEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_SHIFL      DEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_SHIF8      DEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_SHISS      DEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_SHIBS      DEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_SHIDS      DEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_ECOUT      DEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_ECOK1      DEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_ECO45      DEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_ECO27      DEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_ECO81      DEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_ECOL6      DEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_ECOL5      DEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_ESCF3      DEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_SALA4      DEWDERLANGMYAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_SALAR      DEWDERLANGMYAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_SALCH      DEWDERLANGMYAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_SALPC      DEWDERLANGMYAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_SALSV      DEWDERLANGMYAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_SALTI      DEWDERLANGMYAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_SALTY      DEWDERLANGMYAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_SALPB      DEWDERLANGMYAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_SALEP      DEWDERLANGMYAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_SALNS      DEWDERLANGMYAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_SALDC      DEWDERLANGMYAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_SALG2      DEWDERLANGMYAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_SALHS      DEWDERLANGMYAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_SALPA      DEWDERLANGMYAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_SALPK      DEWDERLANGMYAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_CITK8      DEWDERLANGMYAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_KLEP3      DEWDERLANGMYAVDLGACPGGWTYQLVKRNMWVSSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_KLEP7      DEWDERLANGMYAVDLGACPGGWTYQLVKRNMWVSSVDNGPMAQSLMDTGQVTWLREDGF
RLMM_CROS8      DEWDERLANGMYAVDLGACPGGWTYQLVKRNMWVASVDNGPMAQSLMDTGQVTWLREDGF
RLMM_ENT38      DEWDERLANGMHAVDLGACPGGWTYQLVKRNMWVASVDNGPMAQSLMDTGQVTWLREDGF
RLMM_ERWT9      DEWDERLASGMWAVDLGACPGGWTYQLVQRSMMVNAVDNGPMAPSLMDTGQVFHQREDGF
RLMM_PECAS      DEWDERLGSGMYAVDLGACPGGWTYQLVKRSMMVYAVDNGPMAPSLMDTGQVMHHQADGF
RLMM_PECCP      DEWDERLGSGMYAVDLGACPGGWTYQLVKRSMMVYAVDNGPMAPSLMETGQVMHHQADGF
RLMM_SODGM      DEWDERLGSGMYAVDLGACPGGWTYQLVKRSMMVHAVDNGTMDEALMATGQVIHHRADGF
RLMM_DICP7      DEWDERLGSGMYAVDLGACPGGWTYQLVKRSMMVHAVDNGMMAQSLMDTGQVIHHQADGF
RLMM_DICC1      DEWDERLGSGMFAVDLGACPGGWTYQLVKRSMMVHAVDNGMMAPSLMDTGQVIHHQADGF
RLMM_EDWI9      DEWDERLGSGMRAVDLGACPGGWTYQLVQRSMMVQAIDNGPMVPSLMETGQVTHHRADGF
RLMM_YERPA      DEWEERLASGMHAVDLGACPGGWTYQLVQRSMMIQAVDNGLMAQSLMDTGQVTHHRADGF
RLMM_YERPN      DEWEERLASGMHAVDLGACPGGWTYQLVQRSMMIQAVDNGLMAQSLMDTGQVTHHRADGF
RLMM_YERPS      DEWEERLASGMHAVDLGACPGGWTYQLVQRSMMIQAVDNGLMAQSLMDTGQVTHHRADGF
RLMM_YERPB      DEWEERLASGMHAVDLGACPGGWTYQLVQRSMMIQAVDNGLMAQSLMDTGQVTHHRADGF
RLMM_YERP3      DEWEERLASGMHAVDLGACPGGWTYQLVQRSMMIQAVDNGLMAQSLMDTGQVTHHRADGF
RLMM_YERPY      DEWEERLASGMHAVDLGACPGGWTYQLVQRSMMIQAVDNGLMAQSLMDTGQVTHHRADGF
RLMM_YERPE      DEWEERLASGMHAVDLGACPGGWTYQLVQRSMMIQAVDNGLMAQSLMDTGQVTHHRADGF
RLMM_YERPP      DEWEERLASGMHAVDLGACPGGWTYQLVQRSMMIQAVDNGLMAQSLMDTGQVTHHRADGF
RLMM_YERPG      DEWEERLASGMHAVDLGACPGGWTYQLVQRSMMIQAVDNGLMAQSLMDTGQVTHNRADGF
RLMM_YERE8      DEWEERLASGMHAVDLGACPGGWTYQLVQRSMMVQAIDNGLMAQSLMDTGQVTHHRVDGF
RLMM_SERP5      DEWDERLASGMHAVDLGACPGGWTYQLVQRSMMVHAVDNGPMAPSLMDTGQVTHHRADGF
RLMM_PHOLL      DEWEERLASGLYAVDLGACPGGWTYQLVKRSMMVHAVDNGTMSKSLMDTGQVKHHKVDGF
RLMM_PHOAZ      DEWEERLASGLYAVDLGACPGGWTYQLVKRSMMVHAVDNGPMSESLMDTGQVKHHKVDGF
RLMM_PHOAA      DEWEERLASGLYAVDLGACPGGWTYQLVKRSMMVHAVDNGPMSQSLMDTGQVRHHKVDGF
RLMM_PROMH      EEWEERLASGMSAVDLGACPGGWTYQLVKRSMMVHAVDNGPMAPSLMETGQVRHHQADGF
RLMM_ALIF1      EEWDDRLASGMWGVDLGACPGGWTYQLVKRSMFVHAIDNGMMAQSLMDTGQVKHHMVDGF
RLMM_ALIFM      EEWDDRLASGMWGVDLGACPGGWTYQLVKRSMFVHAIDNGMMAQSLMDTGQVKHHMVDGF
RLMM_ALISL      DEWDTRLASGMWAVDLGACPGGWTYQLVKRSMFVHAIDNGMMAQSLMDTGQVKHHMVDGF
RLMM_VIBCB      EEWDERLAPGMWGVDLGACPGGWTYQLVKRSMFVHCVDNGMMADSLMETGQIKHHMVDGF
RLMM_VIBPA      DEWDERLAPGMWGVDLGACPGGWTYQLVKRSMFVHCVDNGMMADSLMETGQIKHHMVDGF
RLMM_VIBA3      DEWDERLAPGMWGVDLGACPGGWTYQLVKRSMFVHCVDNGMMADSLMETGQIKHHMVDGF
RLMM_VIBVU      EEWDTRLSSGMWAVDLGACPGGWTYQLVQRSMFVHCVDNGMMADSLMETGQIKHHMVDGF
RLMM_VIBVY      EEWDTRLSSGMWAVDLGACPGGWTYQLVQRSMFVHCVDNGMMADSLMETGQIKHHMVDGF
RLMM_PHOPR      DEWDERLAPGMWGVDLGACPGGWTYQLVKRSMFVHAIDNGQMAQSLMDTGQVKYHAVDGF
RLMM_AERHH      EEWDMRLTSGMKAVDLGACPGGWTYQLVRRGMMVTAVDNGMMAQSLMDTGQVKHIRDDGF
RLMM_AERS4      EEWDLRLTSGMKAVDLGACPGGWTHQLVRRGMMVTAVDNGTMAQSLMDTGQVKHLRDDGF
RLMM_TOLAT      EDDEIRLCSGLTAVDLGASPGGWTYQLVRRGMMVSAIDNGPMAESLMESGQVKHIMADGF
RLMM_SHEB5      EEQEERIRSGMNSVDLGACPGGWTYQLVRRGMFVSAVDNGPMDEKLMETGQVKHYREDGF
RLMM_SHEB2      EEQEERIRSGMNSVDLGACPGGWTYQLVRRGMFVSAVDNGPMDEKLMETGQVKHYREDGF
RLMM_SHEB8      EEQEERIRSGMNSVDLGACPGGWTYQLVRRGMFVSAVDNGPMDEKLMETGQVKHYREDGF
RLMM_SHEB9      EEQEERIRSGMNSVDLGACPGGWTYQLVRRGMFVSAVDNGPMDEKLMETGQVKHYREDGF
RLMM_SHESW      EEQEERIRSGMNAVDLGACPGGWTYQLVRRGMFVSAVDNGPMDEKLMETGQVKHYREDGF
RLMM_SHEPC      EEQEERIRSGMNAVDLGACPGGWTYQLVRRGMFVSAVDNGPMDEKLMETGQVKHYREDGF
RLMM_SHESM      EEQEERVRSGMNAVDLGACPGGWTYQLVRRGMMVSAVDNGPMNEKLMETGQVKHFREDGF
RLMM_SHESR      EEQEERVRSGMNAVDLGACPGGWTYQLVRRGMMVSAVDNGPMNEKLMETGQVKHFREDGF
RLMM_SHESA      EEQEVRVRSGMNAVDLGACPGGWTYQLVRRGMMVSAVDNGPMNEKLMETGQVKHFREDGF
RLMM_SHEON      EEQEERVRSGMNAVDLGACPGGWTYQLVRRGMFVSAVDNGPMNEKLMETGQVKHFREDGF
RLMM_SHEDO      EEQEMRCRSGLKAVDLGACPGGWTYQLVRRGMMVAAVDNGPMDEKLMETGQVKHYRADGF
RLMM_SHEFN      EEQETRCRSGLNAVDLGACPGGWTYQLVRRGMMVAAVDNGPMDPKLMETGQVKHYRADGF
RLMM_SHEHH      EEQETRLSSGMKAVDLGACPGGWTYQLVRRGMFVAAVDNGPMDQGLMDTGQVKHYQADGF
RLMM_SHEPA      EEQETRLSSGMKAVDLGACPGGWTYQLVRRGMFVAAVDNGPMDQGLMDTGQVKHYQADGF
RLMM_SHESH      EEKELRLSSGMNAVDLGACPGGWTYQLVRRGMFVAAIDNGAMDEGLMETGQVKHYQADGF
RLMM_SHEWM      EEQEQRLSSGMNAVDLGACPGGWTYQLVRRGMFVAAVDNGPMDEGLMETGQVKHYQADGF
RLMM_SHELP      SEQEQRLRSGMNSVDLGACPGGWTYQLVRRGMFVAAVDNGPMAQNLMDTGQVRHYQADGF
RLMM_SHEAM      EEHETRLRSGLNAVDLGACPGGWTYQLVRRGMMVHAIDNGPMNHDLMETGQVTHHRADGF
RLMM_PSYIN      EEQQERLHSGMRAVDLGACPGGWTYQLVRRGLFVTAIDNGAMAQSLMDTGQVTHYTVDGF
RLMM_ALTMD      KQQSKVLRSGGRAVDLGACPGGWTYQLVKRGMYVEAIDNGLIADSLMSTGLVEHHAADGF
RLMM_COLP3      DEWDERLTSGMNAVDLGSAPGGWTYQLVRRGMMVTAIDNGLMAESLMETGQVKHKMMDGF
RLMM_PSEA6      KEQAKRLSGGLHAVDLGACPGGWTYQLVKRGMFVEAVDNGAMDEALMATGQVRYCPEDGF
RLMM_IDILO      NEHEKRVHSGMKAVDLGAAPGGWTYQLVRRGMMVQAVDNGPMAESLMETGQVKHIQEDGF
RLMM_PSET1      QQRESRVAAGMRSVDLGACPGGWTYQLVRRGMFVSAIDNGPMNDDLMQTGQVKHFRADGF
RLMM_CHRSD      EAWPTRLSDSMQAADLGAAPGGWTYQLVRKGMYVYAIDNGPMDDALMASGQVEHLCEDGF
RLMM_MARMS      QTLEADLTEGMTAVDLGAAPGGWTYQFVKKGINVIAIDNGPMQKELMSTGLVEHEKADGF
RLMM_PSEP1      EQWEQRLGDDMTGVDLGASPGGWTYQLVRRGMLVTAIDNGPMAESLMDTGLVQHLMADGF
RLMM_PSEPK      EQWEQRLGDDMTGVDLGASPGGWTYQLVRRGMLVTAIDNGPMAESLMDTGLVQHLMADGF
RLMM_PSEPG      EQWEQRLGDDMTGVDLGASPGGWTYQLVRRGMLVTAIDNGPMAESLMDTGLVQHLMADGF
RLMM_PSEPW      EQWEQRLGDDMTGVDLGASPGGWTYQLVRRGMLVTAIDNGPMAESLMDTGLVQHLMADGF
RLMM_PSEE4      EQWEQRLNDDMTGVDLGASPGGWTYQLVKRGMLVTAIDNGPMAESLMDTGLVTHLMADGF
RLMM_PSEPF      DQWEDRLHSDMTGVDLGAAPGGWTWQLVNRGMLVTAIDNGPMAESLMDTGLVQHLMADGF
RLMM_PSEFS      DQWDERLHGDMTGVDLGAAPGGWTWQLVNRGMLVTAIDNGPMAESLMDTGLVQHLMADGF
RLMM_PSEF5      DQWDERLHGDMTGVDLGAAPGGWTWQLVNRGMLVTAVDNGPMAESLMDTGLVQHLMADGF
RLMM_PSE14      DQWDERLSGDMTGVDLGAAPGGWTYQLVRRGMLVTAIDNGPMAESLMDTGLVQHLMADGF
RLMM_PSEU2      DQWDERLSGDMTSVDLGAAPGGWTYQLVRRGMLVTAIDNGPMAESLMDTGLVQHLMADGF
RLMM_PSESM      DQWDERLSGDMTGVDLGAAPGGWTYQLVRRGMLVTAIDNGPMAESLMDTGLVQHLMADGF
RLMM_PSEMY      EQWDQRLAPGMTAVDLGAAPGGWTWQLVNREIRVTAVDNGPMAESLMYSGFVVHQRADGF
RLMM_PSEU5      EQWDTRLAAGMTGVDLGAAPGGWTWQMVNRHIKVSAVDNGPMNADLMDSGLVEHFRADGF
RLMM_AZOVD      EAWDLRLAPGMSAVDLGAAPGGWTWQLVNRHMKVTAVDNGPMAQSLMDSGLVEHVRADGF
RLMM_PSEAE      SEWDKRLAPDMLAVDLGAAPGGWTWQLVNREMRVTAVDNGPMAENLMYSGLVDHQKVDGY
RLMM_PSEA8      SEWDKRLAPDMLAVDLGAAPGGWTWQLVNREMRVTAVDNGPMAENLMYSGLVDHQKVDGY
RLMM_PSEAB      SEWDKRLAPDMLAVDLGAAPGGWTWQLVNREMRVTAVDNGPMAENLMYSGLVDHQKVDGY
RLMM_PSEA7      QEWDKRLAPDMLAVDLGAAPGGWTWQLVNREMRVTAVDNGPMAENLMYSGLVDHQKVDGY
RLMM_SACD2      EQWDQRIAPSMRAVDLGAAPGGWTWQLVNKSMFVEAVDNGPMAENIMASGQVTHRMEDAF
RLMM_TERTT      SEWDTRLAPSMKAVDLGAAPGGWTWQLVARSMFVDAVDNGPMAPTLMEGGQVTHRQVDGF
RLMM_CELJU      ADWDRRLAPGMRAVDLGAAPGGWTWQLVQRSIYVEAIDNGPMDKDLLDSGLVTHVLADGF
RLMM_MARHV      DRYLDYLGGGRKAVDLGAAPGGWTWQLVQQGMMVTAVDNGPMNPELMATGHVEHVRADGY
RLMM_METCA      PE--TMLRPGMSAVDLGAAPGGWTWQLVRRHIRTTAVDNGNLDPALLDSGLVTHLRTDGF
RLMM_XANAC      EERDALVKPGMRAADLGAAPGGWTWVLTRQHVHVTSVDNGPLREHVLETGLVEHLRADGF
RLMM_XANC5      EERDALVKPGMRAADLGAAPGGWTWVLTRQHVHVTSVDNGPLREHVLETGLVEHLRADGF
RLMM_XANOR      EEREALVKPGMRAADLGAAPGGWTWVLTRQHVHVTSVDNGPLRAHVLETGLVEHLRADGF
RLMM_XANOM      EEREALVKPGMRAADLGAAPGGWTWVLTRQHVHVTSVDNGPLRAHVLETGLVEHLRADGF
RLMM_XANOP      EEREALVKPGMRAADLGAAPGGWTWVLTRQHVHVTSVDNGPLRAHVLETGLVEHLRADGF
RLMM_XANCP      EEREQLVKPGMRAADLGAAPGGWTWVLTRQHVHVTSVDNGPLREHVLATGLVEHLRADGF
RLMM_XANC8      EEREQLVKPGMRAADLGAAPGGWTWVLTRQHVHVTSVDNGPLREHVLATGLVEHLRADGF
RLMM_XANCB      EEREQLVKPGMRAADLGAAPGGWTWVLTRQHVHVTSVDNGPLREHVLATGLVEHLRADGF
RLMM_STRMK      EEREALAKPGMRAADLGAAPGGWTWVLTRQHMHVLSIDNGPLRQHVLDTGLVEHLRADGF
RLMM_STRM5      EEREALAKPGMRAADLGAAPGGWTWVLTRQHMHVLSIDNGPLRQHVLDTGLVEHLRADGF
RLMM_XYLFT      NEREAKLRPGMCATDLGAAPGGWTWVLICQHLRVTSIDNAALRPPLLNHPLVQHVRADGF
RLMM_XYLF2      NEREAKLRPGMCATDLGAAPGGWTWVLICQHLRVTSIDNAALRPPLLNHPLVQHVRADGF
RLMM_XYLFM      NEREAKLRPGMQATDLGAAPGGWTWVLIRQHLRVTSIDNAALRPPLLNHPLVQHVRADGF
RLMM_XYLFA      NEREAKLRPGMRATDLGAAPGGWTWVLIRQHLRVTSIDNAVLRPSLLNHPLVQHVRADGF
RLMM_HAHCH      AEREFVLKRGQRGVDLGAAPGGWTWYMVTQGVKMTAVDHGALQQELLEDPAVTYVSDDGY
RLMM_AZOSB      EERDSLLRAGMRAVDLGAAPGGWTWQLAQRGIRVTAIDNGPLRDTVMATEMVEHLKADGF
RLMM_THASP      GERDSILRAGQRAVDLGAAPGGWTWQLVNRGLRVTAIDNGPLRDSVMATEMVEHLKADGF
RLMM_AROAE      TERNASLRAGLRAVDLGAAPGGWTWQLAHRGLRVTAVDNGPMAPSVMATEMVEHVRADGF
RLMM_ALKEH      VEREAALRPGMSAVDLGAAPGGWTWVLRQAGLHVTAVDNGPLAESLRADRAVRHLREDGF
RLMM_HALHL      NERP---YPGEHAVDLGAAPGGWTWLLRERGLTVTAIDNGPLAPALADDPGVEHQRTDAF
RLMM_LARHH      QGQQDKLKPGMTAVDLGAAPGGWTWQLLRRGIKVYAVDNGPMKGSCDGHPLVKHLRQDGF
                            ..***:.*****  :    :   .:*:. :         :     *.:

RLMM_ACTPJ      KFQPPKRKTIDWLVCDMVEQPMRISKLIGKWLINGWCRETIFNLKLPMKKRYQEVQLCLA
RLMM_ACTP7      KFQPPKRKTIDWLVCDMVEQPMRISKLIGKWLINGWCRETIFNLKLPMKKRYQEVQLCLA
RLMM_ACTP2      KFQPLKRKTIDWLVCDMVEQPMRISKLIGKWLINGWCRETIFNLKLPMKKRYQEVQLCLA
RLMM_HAEDU      KFQPPKLKQMDWLVCDMVERPMRISQLIGKWLMNGWCRETIFNLKLPMKKRYHEVQLCLS
RLMM_HAEIN      KFQPPKRKKVDWLVCDMVEQPSRISLLIGKWLLNGWCRETIFNLKLPMKKRYQEVILCLE
RLMM_HAEI8      KFQPPKRKKVDWLVCDMVEQPSRISLLIGKWLLNGWCRETIFNLKLPMKKRYQEVILCLE
RLMM_HAEIG      KFQPPKRKKVDWLVCDMVEQPSRISSLIGKWLLNGWCRETIFNLKLPMKKRYQEVILCLE
RLMM_HAEIE      KFQPPKRKKVDWLVCDMVEQPSRISLLIGKWLLNGWCRETIFNLKLPMKKRYQEVILCLE
RLMM_ACTSZ      KFQPPKRKKADWLVCDMVEQPGRIVALIGKWLSNEWCHETIFNLKLPMKKRYTEVRRCLQ
RLMM_MANSM      KFQPPKRSKIDWLVCDMVEQPIRIAALIAKWLVNEWCRESIFNLKLPMKKRYAEVQNCLQ
RLMM_PASMU      KFQPPKRSKIDWLVCDMVEQPSRISQLILKWLVNGWCHETIFNLKLPMKKRYLEVKKCLQ
RLMM_AGGAN      KFQPPKRQKIDWLVCDMVEKPSRIAELMTKWLLNGWCHSMIFNLKLPMKKRYAEVQQCLQ
RLMM_HAES1      KFRPPKHCKIDWLVCDMVEQPRRIADLISQWLVKGWCKETIFNLKLPMKKRYFEVQQCLR
RLMM_HISS2      KFRPPKHCKIDWLVCDMVEQPRRIADLISQWLVKGWCKETIFNLKLPMKKRYFEVKRCLQ
RLMM_ECOBR      KFRPT-RSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_ECO5T      KFRPT-RSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_ECO55      KFRPT-RSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_ECOLC      KFRPT-RSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_ECOBW      KFRPT-RSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_ECODH      KFRPT-RSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_ECOLI      KFRPT-RSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_ECOSE      KFRPT-RSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_ECOSM      KFRPT-RSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_ECOHS      KFRPT-RSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_ECO24      KFRPT-RSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_ECO57      KFRPT-RSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_ECO5E      KFRPT-RSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_ECOLU      KFRPT-RSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_ECO7I      KFRPT-RSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_ECO8A      KFRPT-RSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_SHIB3      KFRPT-RSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_SHIFL      KFRPT-RSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_SHIF8      KFRPT-RSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_SHISS      KFRPT-RSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_SHIBS      KFRPT-RSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_SHIDS      KFRPT-RSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_ECOUT      KFRPT-CSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_ECOK1      KFRPT-CSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_ECO45      KFRPT-CSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_ECO27      KFRPT-RSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_ECO81      KFRPT-RSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_ECOL6      KFRPT-RSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_ECOL5      KFRPT-RSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_ESCF3      KFRPT-RNNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_SALA4      RYRPN-RNNISWMVCDMVEKPAKVTALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_SALAR      RYRPN-RNNISWMVCDMVEKPAKVTALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_SALCH      RYRPN-RNNISWMVCDMVEKPAKVTALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_SALPC      RYRPN-RNNISWMVCDMVEKPAKVTALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_SALSV      RYRPN-RNNISWMVCDMVEKPAKVTALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_SALTI      RYRPN-RNNISWMVCDMVEKPAKVTALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_SALTY      RYRPN-RNNISWMVCDMVEKPAKVTALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_SALPB      RYRPN-RNNISWMVCDMVEKPAKVTALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_SALEP      RYRPN-RNNISWMVCDMVEKPAKVTALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_SALNS      RYRPN-RNNISWMVCDMVEKPAKVTALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_SALDC      RYRPN-RNNISWMVCDMVEKPAKVTALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_SALG2      RYRPN-RNNISWMVCDMVEKPAKVTALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_SALHS      RYRPN-RNNISWMVCDMVEKPAKVTALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_SALPA      RYRPN-RNNISWMVCDMVEKPAKVTALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_SALPK      RYRPN-RNNISWMVCDMVEKPAKVTALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLA
RLMM_CITK8      RYRPN-RNNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSQNLA
RLMM_KLEP3      RYRPN-RNNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSQNLA
RLMM_KLEP7      RYRPN-RNNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSQNLA
RLMM_CROS8      KYRPT-RTNITWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSQNIA
RLMM_ENT38      RYRPT-RNNITWMVCDMVEKPAKVAALMATWLVNGWCRETIFNLKLPMKKRYEEVSQNLA
RLMM_ERWT9      KYRPT-RNNNYWVVCDMVEKPVRVANLMADWLVNGWCREAIFNLKLPMKKRYEEVAQNLA
RLMM_PECAS      RFEPP-RNNVYWLVCDMVEKPAKVTSLMSDWLIKGWCRETIFNLKLPMKKRYEEVSQNLA
RLMM_PECCP      RFEPP-RNNVYWLVCDMVEKPAKVTSLMSDWLIKGWCREAIFNLKLPMKKRYEEVSHNLA
RLMM_SODGM      RFEPP-RNNVYWLVCDMVEKPSRVAQLAADWLVKGWCREAIFNLKLPMKKRYEEVSQNLR
RLMM_DICP7      RFEPP-RNNIYWLVCDMVEKPAKVTSRMADWLVNGWCREAIFNLKLPMKKRYEEVALNLE
RLMM_DICC1      RFEPP-RNNIYWLVCDMVEKPAKVTNRMADWLVNGWCREVIFNLKLPMKKRYEEVTQNLA
RLMM_EDWI9      RFTPE-GDN-DWLVCDMVEKPAKVSALMARWLVNGWCREAIFNLKLPMKKRYEEVSQNLA
RLMM_YERPA      KYEPT-RSNIYWLVCDMVEKPTKVTQLITKWLVNGWCREAIFNLKLPMKKRYEEVVQNLA
RLMM_YERPN      KYEPT-RSNIYWLVCDMVEKPTKVTQLITKWLVNGWCREAIFNLKLPMKKRYEEVVQNLA
RLMM_YERPS      KYEPT-RSNIYWLVCDMVEKPTKVTQLITKWLVNGWCREAIFNLKLPMKKRYEEVVQNLA
RLMM_YERPB      KYEPT-RSNIYWLVCDMVEKPTKVTQLITKWLVNGWCREAIFNLKLPMKKRYEEVVQNLA
RLMM_YERP3      KYEPT-RSNIYWLVCDMVEKPTKVTQLITKWLVNGWCREAIFNLKLPMKKRYEEVVQNLA
RLMM_YERPY      KYEPT-RSNIYWLVCDMVEKPTKVTQLITKWLVNGWCREAIFNLKLPMKKRYEEVVQNLA
RLMM_YERPE      KYEPT-RSNIYWLVCDMVEKPTKVTQLITKWLVNGWCREAIFNLKLPMKKRYEEVVQNLA
RLMM_YERPP      KYEPT-RSNIYWLVCDMVEKPTKVTQLITKWLVNGWCREAIFNLKLPMKKRYEEVVQNLA
RLMM_YERPG      KYEPT-RSNIYWLVCDMVEKPTKVTQLITKWLVNGWCREAIFNLKLPMKKRYEEVVQNLA
RLMM_YERE8      KYEPT-RSNIYWLVCDMVEKPAKVTQLIIKWLVNGWCREAIFNLKLPMKKRFEVVSENLE
RLMM_SERP5      RYEPS-SSKIYWLVCDMVEKPAKVTSLMIQWLVKGWCREAIFNLKLPMKKRYEEVSQNLL
RLMM_PHOLL      KFEPS-AKNIYWLVCDMVEKPAKVTQLMVDWLVNGWCREAIFNLKLPMKKRYEEVAHNLQ
RLMM_PHOAZ      KFVPS-TKNIYWLVCDMVEKPAKVTQLMADWLVNGWCREAIFNLKLPMKKRYEEVAHNLQ
RLMM_PHOAA      KFEPL-VKNIYWLVCDMVEKPAKVTQLMADWLVNGWCREAIFNLKLPMKKRYEEVAHNLQ
RLMM_PROMH      KFEPT-SKNITWLVCDMVEKPAKVAALMTTWIVNEWCREAIFNLKLPMKKRYEEVAHILD
RLMM_ALIF1      KFEPP-RKNVTWLICDMVEKPARVAHLMGEWLIKGWAKEALFNLKLPMKGRYDEVLQDIE
RLMM_ALIFM      KFEPP-RKNVTWLICDMVEKPARVAHLMGEWLIKGWAKEALFNLKLPMKGRYDEVLQDIE
RLMM_ALISL      KFEPQ-RKNVTWIVCDMIEKPARVAHLMGEWLIKGWAKEALFNLKLPMKGRYDEVLQDIE
RLMM_VIBCB      KFEPD-RKNVTWIVCDMVEKPARVAHLMGQWLLKGWAKEAIFNLKLPMKGRYDEVLQDLE
RLMM_VIBPA      KFEPD-RKNVTWIVCDMVEKPARVAHLMGQWLLKGWAKEAIFNLKLPMKGRYDEVLQDLE
RLMM_VIBA3      KFEPD-RKNVTWIICDMVEKPARVAHLMGEWIIKGWAKEALFNLKLPMKGRYDEVLQDIE
RLMM_VIBVU      KFEPD-RKNVTWLVCDMVEKPARVAHLMGEWLIKGWAKETIFNLKLPMKGRYDEVLQDIE
RLMM_VIBVY      KFEPD-RKNVTWLVCDMVEKPARVAHLMGEWLIKGWAKETIFNLKLPMKGRYDEVLQDIE
RLMM_PHOPR      KFEPA-RKNVTWIVCDMIEKPARVAHLMGEWLVKAWAKEAIFNLKLPMKGRYDEVLQDIE
RLMM_AERHH      VWRPS-KKNTYWLVCDMVDKPARVTHMIADWFRESDCQEAMFNLKLPMKKRYAEAVHNIE
RLMM_AERS4      VWRPS-KKNIYWLVCDMVEKPARVVHMIADWFRENDCQEAMFNLKLPMKKRYAEAVHNIE
RLMM_TOLAT      TYRPT-KKNPYWLVCDMVEKPARITHLIAQWFREGCCQEAIFNLKLPMKKRYAEVEHNLA
RLMM_SHEB5      RFEPQ-RKNIYWLVCDMVEKPARVAELIEAWAINGWFKEAIFNLKLPMKSRYKEVTAILE
RLMM_SHEB2      RFEPQ-RKNIYWLVCDMVEKPARVAELIEAWAINGWFKEAIFNLKLPMKSRYKEVTAILE
RLMM_SHEB8      RFEPQ-RKNIYWLVCDMVEKPARVAELIEAWAINGWFKEAIFNLKLPMKSRYKEVTAILE
RLMM_SHEB9      RFEPQ-RKNIYWLVCDMVEKPARVAELIEAWAINGWFKEAIFNLKLPMKSRYKEVTAILE
RLMM_SHESW      RFEPQ-RKNIYWLVCDMVEKPARVAELIEAWAINGWFKEAIFNLKLPMKSRYKEVTAILE
RLMM_SHEPC      RFEPQ-RKNIYWLVCDMVEKPARVAELIEAWAINGWFKEAIFNLKLPMKSRYKEVTAILE
RLMM_SHESM      RFEPQ-RKNIYWLVCDMVEKPARVAELIEAWAINGWFKEAIFNLKLPMKSRYKEVMAILN
RLMM_SHESR      RFEPQ-RKNIYWLVCDMVEKPARVAELIEAWAINGWFKEAIFNLKLPMKSRYKEVMAILN
RLMM_SHESA      RFEPQ-RKNIYWLVCDMVEKPARVAELIEAWAINGWFKEAIFNLKLPMKSRYKEVMAILN
RLMM_SHEON      RFEPQ-RKNIYWLVCDMVEKPARVAELIEAWAINGWFKEAIFNLKLPMKSRYKEVMAILN
RLMM_SHEDO      RFEPP-RKNIYWLVCDMVEKPSRVAELMEAWAINGWFKEAIFNLKLPMKSRYKEVRVILD
RLMM_SHEFN      RFEPP-RKNVYWLVCDMVEKPARVAELMEAWAINGWFKEAIFNLKLPMKSRYKEVSVILE
RLMM_SHEHH      RFEPP-RKNITWLVCDMIEKPSRVAELIEAWAINGWFKESIFNLKLPMKARYKEVSTILA
RLMM_SHEPA      RFEPP-RKNITWLVCDMIEKPSRVAELIEAWAINGWFKESIFNLKLPMKARYKEVSTILA
RLMM_SHESH      RFEPP-RKNIYWLVCDMIEKPSRVAELIEAWAINGWFKEAMFNLKLPMKSRYQDVTTILE
RLMM_SHEWM      RFEPP-RKNIYWLVCDMIEKPSRVAELIEAWAINGWFKEAMFNLKLPMKSRYQDVSTILE
RLMM_SHELP      RFEPP-KKNIYWLVCDMVEKPSRVAELMEAWAINGWFKEAIFNLKLPMKSRYKEVSTILA
RLMM_SHEAM      KFEPA-RRNIYWLVCDMVEKPARVAELMEYWAIQGWFKEAIFNLKLPMKSRYKEVSQILA
RLMM_PSYIN      KYEPE-RKNIDWLVCDMIEKPKRVAKLMGQWLIDGWCKEAIFNFKLPMKKRYQEASEDIK
RLMM_ALTMD      TYRPQ-FGRVDLLVCDMIEQPDRVAKLMGDWLVKHWATHAIFNIKLPMKRRYETVVEAMT
RLMM_COLP3      KYVPL-KQNVYWLVCDMIEKPQRVAKLMSEWLLHGHCKEAMFNLKLPMKGRYQQVTNDLQ
RLMM_PSEA6      KFQPR-KNNVYWLVCDMIEQPQRVAKLMATWIATKRCQETVFNLKLPMKKRYESVKEALQ
RLMM_IDILO      KFRPK-RKNVTWLVCDMVEKPARVGELMTSWLLEGDCEEAIFNLKLPMRQRYAAVKGYLD
RLMM_PSET1      KYRPE-KRNITWLVCDMVEKPTKVTSLMIDWAVNAYAKELIFNLKLPMKKRFDSVYECLS
RLMM_CHRSD      VWQPP--MRLDWLVCDIVDKPMRVIDMVERWLVAPWCHEAIFNLKLPMKKRWDEVSRCLE
RLMM_MARMS      KYEPP--YTVDWLVCDMVERPIKVAELMAKWLASGWTRRAIFNLKLPMKKRYQEVTLCLQ
RLMM_PSEP1      TWQPK--HPVDWMVCDIVEKPARTTSLIETWLGEGLCREAVVNLKLPMKQRYAEVRRLLD
RLMM_PSEPK      TWQPK--QPVDWMVCDIVEKPARTTSLIETWLGEGLCREAVVNLKLPMKQRYAEVRRLLD
RLMM_PSEPG      TWQPK--QPVDWMVCDIVEKPARTTSLIETWLGEGLCREAVVNLKLPMKQRYAEVRRLLD
RLMM_PSEPW      TWQPK--QPVDWMVCDIVEKPARTTSLIETWLGEGLCREAVVNLKLPMKQRYAEVRRLLD
RLMM_PSEE4      TWKPK--HTVDWMVCDIVEKPARTASLIETWLGEGLCREAVVNLKLPMKQRHAEVRKLLD
RLMM_PSEPF      TFKPK--QPVDWMVCDIVEKPARNAAMLEEWIGEGHCREAVVNLKLPMKQRYAEVKRLLE
RLMM_PSEFS      TFVPK--QPVDWMVCDIVEKPARNAALLETWIGEGHCREAVVNLKLPMKQRYAEVKRLLE
RLMM_PSEF5      TYKPR--QPVDWMVCDIVEKPARNAALLETWIGEGHCREAVVNLKLPMRQRYAEVKRLLE
RLMM_PSE14      TYKPR--HPVDWMVCDIVEKPARNAALLETWLGEGLCREAVVNLKLPMKQRYAEVRRLLD
RLMM_PSEU2      TYKPR--QPVDWMVCDIVEKPARNAALLETWLGEGLCREAVVNLKLPMKQRYAEVRRLLD
RLMM_PSESM      TYKPR--HPVDWMVCDIVEKPARNAALLETWLGEGLCREAVVNLKLPMKQRYAEVRRLLD
RLMM_PSEMY      TFRPR--HPVHWMVCDIVEKPARTAAMIETWLGEGLCREAVVNLKLPMKQRYAEVRRLLD
RLMM_PSEU5      TFRPK--RPVDWMVCDIVEKPARNAALLETWIGEGLCREAVVNLKLPMKQRYAEVKRLLE
RLMM_AZOVD      VFRPR--RPVDWMVCDIVEKPARTAALIETWLGEGLCREAVVNLKLPMKQRHAEVRRLLE
RLMM_PSEAE      QYRPR--QRVDWMVCDIVEKPARTGALIETWIGEGLCREAVVNLKLPMKQRYAEVRKILQ
RLMM_PSEA8      QYRPR--QRVDWMVCDIVEKPARTGALIETWIGEGLCREAVVNLKLPMKQRYAEVRKILQ
RLMM_PSEAB      QYRPR--QRVDWMVCDIVEKPARTGALIETWIGEGLCREAVVNLKLPMKQRYAEVRKILQ
RLMM_PSEA7      QYRPR--QRVDWMVCDIVEKPARTGALIETWIGEGLCREAVVNLKLPMKQRYAEVRKILQ
RLMM_SACD2      RFAPE--RAVHWLVSDIADKPARVAELITRWAENKWFKEAVFNLKLPMKKRYIELQLCSE
RLMM_TERTT      AYHPP--KPVDWLVCDIADKPARVADMIASWAENSWFREAVFNLKLPMKQRYKEVLRCRE
RLMM_CELJU      LFEPK--KPVDWLVCDIVDKPARVSSMVIKWFSKGHCRQAIFNLKLPMKQRYMEVQKCRT
RLMM_MARHV      AWRPK--RAVDWMVCDIVDKPRKTARLALDWVGGKLCRYTVFNLKLPMKKRYEEWLICRD
RLMM_METCA      RFRPS--RPVDWLVCDMVEQPSRIARLVADWAADGAFRYAVFNLKLPMNRRYEEVERCRG
RLMM_XANAC      HWKPA--QPLDWMVCDMVEQPRRVAERMATWVREGWCRNTIFNLKLPMKKRWDETRLCLD
RLMM_XANC5      HWKPA--QPLDWMVCDMVEQPRRVAERMATWVREGWCRNTIFNLKLPMKKRWDETRLCLD
RLMM_XANOR      HWKPA--QPLDWMVCDMVEQPRRVAERMATWVREGWCRNTIFNLKLPMKKRWDETRLCLE
RLMM_XANOM      HWKPA--QPLDWMVCDMVEQPRRVAERMATWVREGWCRNTIFNLKLPMKKRWDETRLCLE
RLMM_XANOP      HWKPA--QPVDWMVCDMVEQPRRVAERMATWVREGWCRNTIFNLKLPMKKRWDETRLCLE
RLMM_XANCP      HWKPA--QPLDWMVCDMVEQPRRVAERMATWVREGWCRHTIFNLKLPMKKRWDETRLCLD
RLMM_XANC8      HWKPA--QPLDWMVCDMVEQPRRVAERMATWVREGWCRHTIFNLKLPMKKRWDETRLCLD
RLMM_XANCB      HWKPA--QPLDWMVCDMVEQPRRVAERMATWVREGWCRHTIFNLKLPMKKRWDETRLCLD
RLMM_STRMK      HWHPE--QPLDWMVCDMVEQPRRVAERMATWFREGWCRHAIFNLKLPMKKRWDETRLCLD
RLMM_STRM5      HWHPE--QPLDWMVCDMVEQPRRVAERMATWFREGWCRHAIFNLKLPMKKRWDETRLCLD
RLMM_XYLFT      RWIPP--RPMDWMVCDMVEQPRRVAERMAVWLREGWCRHMIFNLKLPMKKRWDETRLCLE
RLMM_XYLF2      RWIPP--RPMDWMVCDMVEQPRRVAERMAVWLREGWCRHMIFNLKLPMKKRWDETRLCLE
RLMM_XYLFM      RWTPP--RPMDWMVCDMVEQPRRVAERMAVWLREGWCRHMIFNLKLPMKKRWDETRLCLE
RLMM_XYLFA      RWTPP--RPMDWMVCDMVEQPRRVAERMAVWLREGWCRHMIFNLKLPMKKRWDETRLCLE
RLMM_HAHCH      VYKPQ--RKVDWVVCDIVDKPKRTMERMADWLCYDWTTYALFNLKLPMKTRMDEVEACLQ
RLMM_AZOSB      TWRPQ--RPVDWMVCDMVEQPSRIASLMAEWIATGRCRHTIFNLKLPMKRRLEAVEQCRE
RLMM_THASP      TWRPH--RPVDWMVCDMVEQPSRIASLMAEWVATGRCRYTIFNLKLPMKRRVEAVEQCRE
RLMM_AROAE      TWRPQ--RPVEWMVCDMVEQPTRIAALVADWIATGRCRRTIFNLKLPMKKRLEAVEQCRA
RLMM_ALKEH      RYRPP--HRVDWLVCDMVEQPHRVARLVRHWLVSGWCGRALFNLKLPMRRRWQCVAECRA
RLMM_HALHL      RFRPR--TEVDWLVCDVVDRPQGIARLMTQWLREEWARAAIFNLKLPMRRPLETVRQALD
RLMM_LARHH      RFRPP--HPVDWLVCDMVERPGRVAELMADWLAEGAARQAVFNLKLPMKKRAEALSDALE
                 : *        ::.*: ::*         *         :.*:****.           

RLMM_ACTPJ      YLEEELEKQ-GFWFKIQAKHLYHDREEITVHIAVMGKR-----------------
RLMM_ACTP7      YLEEELEKQ-GFWFKIQAKHLYHDREEITVHIAVMGKR-----------------
RLMM_ACTP2      YLEEELEKQ-GFWFKIQAKHLYHDREEITVHIAVMGRKPQ---------------
RLMM_HAEDU      -LFRQLTKQ-GLCFKLQAKHLYHDREEITVHIVIMGKK-----------------
RLMM_HAEIN      NLAVMLAEQ-NLNFDIQAKHLYHDREEITVHIALKP-------------------
RLMM_HAEI8      NLAVMLAEQ-NLNFDIQAKHLYHDREEITVHIALKP-------------------
RLMM_HAEIG      NLAVMLAEQ-NLNFEIQAKHLYHDREEITVHIALKP-------------------
RLMM_HAEIE      NLAVMLAEQ-NLNFEIQAKHLYHDREEITVHIALKP-------------------
RLMM_ACTSZ      KLADELTQS-GLKFRMQAKHLYHDREEITVHVRTWRH------------------
RLMM_MANSM      LITNELDKA-GFKYHIQAKHLYHDREEITVHISVKK-------------------
RLMM_PASMU      MIEESLEKQ-GFRYHIQAKHLYHDREEITVHIAVKSLD-----------------
RLMM_AGGAN      YIADKLTQR-GLAFQLKAKHLYHDREEITVYLRLL--------------------
RLMM_HAES1      QIEDKLNKQ-NISFQLQAKHLYHDREEITVYIRLM--------------------
RLMM_HISS2      QIKERLNEQ-HISFQIQAKHLYHDREEITVYIRLM--------------------
RLMM_ECOBR      YIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRIWAAVGGRRDER---------
RLMM_ECO5T      YIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRIWAAVGGRRDER---------
RLMM_ECO55      YIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRIWAAVGGRRDER---------
RLMM_ECOLC      YIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRIWAAVGGRRDER---------
RLMM_ECOBW      YIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRIWAAVGGRRDER---------
RLMM_ECODH      YIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRIWAAVGGRRDER---------
RLMM_ECOLI      YIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRIWAAVGGRRDER---------
RLMM_ECOSE      YIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRIWAAVGGRRDER---------
RLMM_ECOSM      YIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRIWAAVGGRRDER---------
RLMM_ECOHS      YIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRIWAAVGGRRDER---------
RLMM_ECO24      YIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRIWAAVGGRRDER---------
RLMM_ECO57      YIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRIWAAVGGRRDER---------
RLMM_ECO5E      YIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRIWAAVGGRRDER---------
RLMM_ECOLU      YIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRIWAAVGGRRDER---------
RLMM_ECO7I      YIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRIWAAVGGRRDER---------
RLMM_ECO8A      YIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRIWAAVGGRRDER---------
RLMM_SHIB3      YIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRIWAAVGGRRDER---------
RLMM_SHIFL      YIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRIWAAVGGRRDER---------
RLMM_SHIF8      YIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRIWAAVGGRRDER---------
RLMM_SHISS      YIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRIWAAVGGRRDER---------
RLMM_SHIBS      YIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRIWAAVGGRRDER---------
RLMM_SHIDS      YIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRIWAAVGGRRDER---------
RLMM_ECOUT      YIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRIWAAVGGRRDER---------
RLMM_ECOK1      YIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRIWAAVGGRRDER---------
RLMM_ECO45      YIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRIWAAVGGRRDER---------
RLMM_ECO27      YIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRIWAAVGGRRDER---------
RLMM_ECO81      YIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRIWAAVGGRRDER---------
RLMM_ECOL6      YIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRIWAAVGGRRDER---------
RLMM_ECOL5      YIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRIWAAVGGRRDER---------
RLMM_ESCF3      YIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRIWAAVGGRRDER---------
RLMM_SALA4      YLQAQLDEH-GVNAQIQARQLYHDREEVTVHVRRLWAAVGGRRDER---------
RLMM_SALAR      YLQAQLDEH-GVNAQIQARQLYHDREEVTVHVRRLWAAVGGRRDER---------
RLMM_SALCH      YLQAQLDEH-GVNAQIQARQLYHDREEVTVHVRRLWAAVGGRRDER---------
RLMM_SALPC      YLQAQLDEH-GVNAQIQARQLYHDREEVTVHVRRLWAAVGGRRDER---------
RLMM_SALSV      YLQAQLDEH-GVNAQIQARQLYHDREEVTVHVRRLWAAVGGRRDER---------
RLMM_SALTI      YLQAQLDEH-GVNAQIQARQLYHDREEVTVHVRRLWAAVGGRRDER---------
RLMM_SALTY      YLQAQLDEH-GVNAQIQARQLYHDREEVTVHVRRLWAAVGGRRDER---------
RLMM_SALPB      YLQAQLDEH-GVNAQIQARQLYHDREEVTVHVRRLWAAVGGRRDER---------
RLMM_SALEP      YLQAQLDEH-GVNAQIQARQLYHDREEVTVHVRRLWAAVGGRRDER---------
RLMM_SALNS      YLQAQLDEH-GVNAQIQARQLYHDREEVTVHVRRLWAAVGGRRDER---------
RLMM_SALDC      YLQAQLDEH-GVNAQIQARQLYHDREEVTVHVRRLWAAVGGRRDER---------
RLMM_SALG2      YLQAQLDEH-GVNAQIQARQLYHDREEVTVHVRRLWAAVGGSRDER---------
RLMM_SALHS      YLQAQLDEH-GVNAQIQARQLYHDREEVTVHVRRLWAAVGGRRDER---------
RLMM_SALPA      YLQAQLDEH-GVNAQIQARQLYHDREEVTVHVRRLWAAVGGRRDER---------
RLMM_SALPK      YLQAQLDEH-GVNAQIQARQLYHDREEVTVHVRRLWAAVGGRRDER---------
RLMM_CITK8      YIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRLWAAVGGRRDER---------
RLMM_KLEP3      YIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRLWAAVGGRRDER---------
RLMM_KLEP7      YIQAQLDEH-GVNAQIQARQLYHDREEVTVHVRRLWAAVGGRRDER---------
RLMM_CROS8      SIQAQLDEH-GINAQIQARQLYHDREEVTVHVRRWWAAVGGRRDER---------
RLMM_ENT38      YIQEQLNAQ-GINAEIQARQLYHDREEVTVHVRRWWAAVGGRRDER---------
RLMM_ERWT9      MIHEKLAQN-GINAQIQARQLYHDREEVTVHIRRVWSATPGRRDER---------
RLMM_PECAS      LLRERLSEN-GIHAEVHAKHLYHDREEVTVHVRRFWSAVPGRRDER---------
RLMM_PECCP      VLQERLSEN-GINAEVHAKHLYHDREEITVHVRRFWSAVPGRRDER---------
RLMM_SODGM      LLIDHLQVN-GVHGEVHAKQLYHDREEVTVHARRFWSAVPGRRDER---------
RLMM_DICP7      KLTQRLQEG-GINAEIHAKQLYHDREEVTVHVRRIWSAIPGRRDER---------
RLMM_DICC1      LLAQRLEEN-GINFEIHAKHLYHDREEITVHARRIWGAIPGRRDER---------
RLMM_EDWI9      TLAQVLKEN-GINAQIAAKQLYHDREEVTVHVRRIWGAIPGRRDEREFRRREQRD
RLMM_YERPA      MMDEQLKEN-GINADIHAKQLYHDREEVTVHVRRIWSGAPGRRDERY--------
RLMM_YERPN      MMDEQLKEN-GINADIHAKQLYHDREEVTVHVRRIWSGAPGRRDERY--------
RLMM_YERPS      MMDEQLKEN-GINADIHAKQLYHDREEVTVHVRRIWSGAPGRRDERY--------
RLMM_YERPB      MMDEQLKEN-GINADIHAKQLYHDREEVTVHVRRIWSGAPGRRDERY--------
RLMM_YERP3      MMDEQLKEN-GINADIHAKQLYHDREEVTVHVRRIWSGAPGRRDERY--------
RLMM_YERPY      MMDEQLKEN-GINADIHAKQLYHDREEVTVHVRRIWSGAPGRRDERY--------
RLMM_YERPE      MMDEQLKEN-GINADIHAKQLYHDREEVTVHVRRIWSGAPGRRDERY--------
RLMM_YERPP      MMDEQLKEN-GINADIHAKQLYHDREEVTVHVRRIWSGAPGRRDERY--------
RLMM_YERPG      MMDEQLKEN-GINADIHAKQLYHDREEVTVHVRRIWSGAPGRRDERY--------
RLMM_YERE8      MIDEQLKEN-GINAHIQAKQLYHDREEVTVHVRRIWSGVPGRRDERF--------
RLMM_SERP5      AIKEALDTA-GISSEIHAKQLYHDREEVTVHVRRMWSAVAGRRDERD--------
RLMM_PHOLL      KMHLQLKEG-GINAQIQAKHLYHDREEITVHVRRIWSAYAASRNDY---------
RLMM_PHOAZ      KMHLQLKEN-GINAQIQAKHLYHDREEITVHVRRIWSAYAANRDDY---------
RLMM_PHOAA      KMNLQLKEN-GINAQIQAKHLYHDREEITVHVRRIWSAYAASRNND---------
RLMM_PROMH      KIRAELAEK-GINAKIQAKHLYHDREEITVHIQNIWAAYRPDREF----------
RLMM_ALIF1      NLKDFLKKN-GFQYKLQAKHLYHDREEITVHIQAISNISPH--------------
RLMM_ALIFM      NLKDFLKKN-GFQYKLQAKHLYHDREEITVHIQAISNISPH--------------
RLMM_ALISL      NLKEFLNKN-GFKYKLQAKHLYHDREEITVHIQAITNISPH--------------
RLMM_VIBCB      NLKTFLIEN-KVKFKLQAKHLYHDREEITIHIQCLSNISPH--------------
RLMM_VIBPA      NLKMFLIEN-KVKFKLQAKHLYHDREEITIHIQCLSNISPH--------------
RLMM_VIBA3      NLKQFLIDN-KVKFKMQAKHLYHDREEITVHIQSLSNISPY--------------
RLMM_VIBVU      NLKTFLIEN-KVKFKLQAKHLYHDREEITVHIQVLSNISPH--------------
RLMM_VIBVY      NLKTFLIEN-KVKFKLQAKHLYHDREEITVHIQVLSNISPH--------------
RLMM_PHOPR      NLKQYFIKN-GMKFELQAKHLYHDREEITVHVRCLDNRSPH--------------
RLMM_AERHH      VLRELLKEI-DNAFVIQAKQLYHDREEITVHVYNKYWVSKLSAKE----------
RLMM_AERS4      VLRGLLKEV-DNAFVIQAKQLYHDREEITVHVYNKYWVSKLEAKE----------
RLMM_TOLAT      VLKEWLAEI-DGEYVIQAKQLYHDREEITVHVYDERKLARRRSGAFN--------
RLMM_SHEB5      TMQTILKENGVTDFKVQCKHLYHDRDEVTVHLWLRPNTAWN--------------
RLMM_SHEB2      TMQTILKENGVTDFKVQCKHLYHDRDEVTVHLWLRPNTAWN--------------
RLMM_SHEB8      TMQTILKENGVSDFKVQCKHLYHDRDEVTVHLWLRPNTAWN--------------
RLMM_SHEB9      TMQTILKENGVSDFKVQCKHLYHDRDEVTVHLWLRPNTAWN--------------
RLMM_SHESW      TMQTILKENGVTDFKVQCKHLYHDRDEVTVHLWLRPNTAWN--------------
RLMM_SHEPC      TMQTILKENGVTDFKVQCKHLYHDRDEVTVHLWLRPNTAWN--------------
RLMM_SHESM      TMQEILKENGINEFQLQCKHLYHDRDEVTVHLWIRPSQAWN--------------
RLMM_SHESR      TMQEILKENGINEFQLQCKHLYHDRDEVTVHLWIRPSQAWN--------------
RLMM_SHESA      TMQEILKENGINEFQLQCKHLYHDRDEVTVHLWIRPSQAWN--------------
RLMM_SHEON      TMQDILKENGITEFKLQCKHLYHDRDEVTVHLWLKPSQPWN--------------
RLMM_SHEDO      TMGEIFKEN-EIDYRLQCKHLYHDRDEVTVHLWIFPEKGVSYAEMG---------
RLMM_SHEFN      TIGAILTEN-EIDFKMQCKHLYHDRDEVTVHLWIFPEKGVSYA------------
RLMM_SHEHH      TMEEILKENGVDDFSIAAKHLYHDRDEVTVHLCLRPSQPW---------------
RLMM_SHEPA      TMEEILKENGVDDFSIAAKHLYHDRDEVTVHLCLRPSQPW---------------
RLMM_SHESH      TMATVLKENEIKNFSIKCKHLYHDRDEVTVYLSLNPTQVS---------------
RLMM_SHEWM      TMATVLEENEIKNFSIKCKHLYHDRDEVTVYLSLNPTQ-----------------
RLMM_SHELP      TMQEVLRENGIDDFHLACKHLYHDRDEVTVHLWLKPSVGFNFG------------
RLMM_SHEAM      NMHAILKENGIHEFHLACKHLYHDRDEVTVHLWLRPSSPWI--------------
RLMM_PSYIN      ILTDMFEKE-DLQYELQAKQLYHDREEITLHVRLIGNHWGKQLGNG---------
RLMM_ALTMD      SLNSRLDAL-DDAFAVKVRHLYHDRDEVTVTIVRTSKDEV---------------
RLMM_COLP3      TIKDAFTKH-NVKYELYAKHLYYDREEVTVHARLLSPAPLRAKE-----------
RLMM_PSEA6      IIDQCIDQHRAGPYDLKVKHLYHDREEVTVHMRLNT-------------------
RLMM_IDILO      QIKEQLQTEGTKPFEIQAKHLYHDREEITVHLRW--LPRS---------------
RLMM_PSET1      MIRAELEKYGI-SYELQAKHLYHDREEVTVHLNVTKVPQSLYS------------
RLMM_CHRSD      RLASSLDQA-GIRARIRCRHLYHDREEVTVHVCLLD-------------------
RLMM_MARMS      TMEGLLRKA-GVSYQYQVKHLYHDREEVTVCIMVK--------------------
RLMM_PSEP1      RMEATFKAR-KIRVSIACKQLYHDREEVTCHLRRLDLKPR---------------
RLMM_PSEPK      RMEATFKAR-KIRVSIACKQLYHDREEVTCHLRRLDLKPR---------------
RLMM_PSEPG      RMEATFKAR-KIRVSIACKQLYHDREEVTCHLRRLDLKPR---------------
RLMM_PSEPW      RMEATFKAR-KLKVSIACKQLYHDREEVTCHLRRLDLKPRK--------------
RLMM_PSEE4      RMEAGFKER-KVKVSIACKQLYHDREEVTCHLRRLDLKPH---------------
RLMM_PSEPF      RIADGFKAR-GIKVDIGCKQLYHDREEVTCHLRRLD-VKKAKAR-----------
RLMM_PSEFS      RIEEGFKAR-GIRVEIGCKQLYHDREEVTCHLRRLETAKKTKAR-----------
RLMM_PSEF5      RIEEGFKAR-GIRVAIGCKQLYHDREEVTCHLRRLD-LKKPKSA-----------
RLMM_PSE14      RIEEGFQAR-GVRVSIGCKQLYHDREEVTCHLRRLDVAKAATK------------
RLMM_PSEU2      RIEEGFQAR-GVRVSIGCKQLYHDREEVTCHLRRLDVAKAARK------------
RLMM_PSESM      RIEEGFQAR-GVRVSIGCKQLYHDREEVTCHLRRLDVAKAARK------------
RLMM_PSEMY      RIESGLAER-GLKVSIGCKQLYHDREEVTCHLRRHGK------------------
RLMM_PSEU5      RIADGLAER-GVKASIGCKQLYHDREEVTCHLRRL--------------------
RLMM_AZOVD      RIRDGLSAR-GAKVSVACRQLYHDREEVTCHLCRLPAPA----------------
RLMM_PSEAE      RLRESFDAR-GLKVAIGCKQLYHDREEVTCHLRRLER------------------
RLMM_PSEA8      RLRESFDAR-GLKVAIGCKQLYHDREEVTCHLRRLER------------------
RLMM_PSEAB      RLRESFDAR-GLKVVIGCKQLYHDREEVTCHLRRLER------------------
RLMM_PSEA7      RLRESFDAR-GLKVAFGCKQLYHDREEVTCHLRRLER------------------
RLMM_SACD2      IITLALDNA-GIEYTLKFKQLYHDREEVTGHLVLF--------------------
RLMM_TERTT      QIELRLLAA-GRDYRLRFKQLYHDREEVTGHLELR--------------------
RLMM_CELJU      RILGELGSL-GMRAELDFKQLYHDREEVTGYLRVF--------------------
RLMM_MARHV      ILLQGLAEA-ELNCRLRARHLYHDREEITCFIERLD-------------------
RLMM_METCA      LIEERLAAQ-GVSHRLRFRQLYHDREEVTGFLELVS-------------------
RLMM_XANAC      LFEQQ----AERSLSVRAKQLYHDREEITVLAMRD--------------------
RLMM_XANC5      LFEQQ----AEKSLIVRAKQLYHDREEITVLAMRE--------------------
RLMM_XANOR      LFEQQ----AEKSLIVRAKQLYHDREEITVLAMRG--------------------
RLMM_XANOM      LFEQQ----AEKSLIVRAKQLYHDREEITVLAMRG--------------------
RLMM_XANOP      LFEQQ----AEKSLIVRAKQLYHDREEITVLAMRG--------------------
RLMM_XANCP      LFEQQ----AEKSLTVRAKQLYHDREEITVLAMRG--------------------
RLMM_XANC8      LFEQQ----AEKSLTVRAKQLYHDREEITVLAMRG--------------------
RLMM_XANCB      LFEQQ----AEKSLTVRAKQLYHDREEITVLAMRG--------------------
RLMM_STRMK      LFQDQ----AGKPLVVRAKQLYHDREEITVLASPLR-------------------
RLMM_STRM5      LFQEQ----AGKPLVVRAKQLYHDREEITVLASPLR-------------------
RLMM_XYLFT      RFETQ----AAVPLTLRAKQLYHDREEITVYASNDAR------------------
RLMM_XYLF2      RFETQ----AAVPLTLRAKQLYHDREEITVYASNDAR------------------
RLMM_XYLFM      RFETQ----AAVPLTLRAKQLYHDREEITVYASNDAR------------------
RLMM_XYLFA      RFETQ----AVVPLTLRAKQLYHDREEITVYASNNAR------------------
RLMM_HAHCH      RLQERL-LGADIESEVRVKQLYHDREEVTVLALTGHFLTAFQKH-----------
RLMM_AZOSB      LIRKRLASI--GPFDLRIKQLYHDREEVTAYLTLKK-------------------
RLMM_THASP      LIRKRLASV--GPYDLRIKHLYHDREEVTAFLTLKR-------------------
RLMM_AROAE      LITKRLAQA--GPFELRFKHLYHDREEITGYLALRAAAV----------------
RLMM_ALKEH      LVTGG-SGELGW----RSAQLYHDREEITVLAWRPAAGSRG--------------
RLMM_HALHL      AVR---TTGARA----HAAQLYHDREEITVYARRMASRNRP--------------
RLMM_LARHH      RIEAR-MLAAGLAYTLQVKQLYHDREEVTVYLARPAATGRRRR------------
                 .                 :**:**:*:*