CLUSTAL format seed alignment for MF_01552

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RIMK_ECO57       MKIAILSRDGTLYSCKRLREAAIQRGHLVEILDPLSCYMNIN----PAASSIHYKG----
RIMK_ECOLI       MKIAILSRDGTLYSCKRLREAAIQRGHLVEILDPLSCYMNIN----PAASSIHYKG----
RIMK_SHISS       MKIAILSRDGTLYSCKRLREAAIQRGHLVEILDPLSCYMNIN----PAASSIHYKG----
RIMK_ECOL6       MKIAILSRDGTLYSCKRLREAAIQRGHLVEILDPLSCYMNIN----PAASSIHYKG----
RIMK_SHIFL       MKIAILSRDGTLYSCKRLREAAIQRGHLVEILDPLSCYMNIN----PAASSIYYKG----
RIMK_SALCH       MKIAILSRDGTLYSCKRLREAAMRRGHLVEILDPLSCYMNIN----PAASSIHYKG----
RIMK_SALPA       MKIAILSRDGTLYSCKRLREAAMRRGHLVEILDPLSCYMNIN----PAASSIHYKG----
RIMK_SALTI       MKIAILSRDGTLYSCKRLREAAMRRGHLVEILDPLSCYMNIN----PAASSIHYKG----
RIMK_SALTY       MKIAILSRDGTLYSCKRLREAAMRRGHLVEILDPLSCYMNIN----PAASSIHYKG----
RIMK_PECAS       MKIAILSRDGTLYSCKRLREAAESRKHSVEIIDPLSCYMNIN----SAAPSVHYRG----
RIMK_PSE14       MKIAVLSRNPRLYSTRRLVEAGIERGHEMVVIDTLRAYMNIA----SHKPQIHYRG----
RIMK_PSESM       MKIAVLSRNPRLYSTRRLVEAGIERGHEMVVIDTLRAYMNIA----SHKPQIHYRG----
RIMK_PSEU2       MKIAVLSRNPRLYSTRRLVEAGIERGHEMVVIDTLRAYMNIA----SHKPQIHYRG----
RIMK_PSEF5       MKIAVLSRNPRLYSTRRLVEAGTERGHEMVVVDTLRAYMNIA----SHKPQIHYRG----
RIMK_PSEPK       MKIAVLSRNPRLYSTRRLVEAGTQRGHEMVVIDTLRAYMNIA----SHKPQIHYRG----
RIMK_PSEAE       MKIAVLSRNPRLYSTRRLVEAGRERGHEMVVIDTLRAYMNIA----SHKPQIHYRG----
RIMK_NITOC       MKIAVLSRNAKLYSTRRLVEAAKTRGHEVRVLDVLRCYMNIA----SHRPSIHYKG----
RIMK_IDILO       MRIAILSRNASLYSTRRLVEAAEERGHEVDVLNPLRCYMNIN----ARESSIHKHG----
RIMK2_SHEON      MRIAILSQGPELYSTKRLVEAATLRGHEVKVINPLECYMNIN----MRQSSIHIGG----
RIMK_PHOPR       MKIGILSQNETLYSTRRLREACEARGHEAVIINALRCYMNIN----SVQPSIHFEG----
RIMK1_SHEON      MKIGILSQFPELYSTRRLVAACESRGHEAVVINTLNCYMNIN----SIKPSIHYQG----
RIMK_VIBCH       MKIGILSRNASLYSTKRLIEACKQRGHEVRVIDALRCYMNIN----SDKPEIHYKG----
RIMK_ALIF1       MKIGILSRNQSLYSTSRLIEAAESRGHEVKVIDALRCYMNIN----SEKPQIHFKG----
RIMK_PSEHT       MKIGILSRNKKLYSTRRLIEAAEARGHEVKVVDALRCYMNIN----SELPEIHYRG----
RIMK_VIBVU       MRIAILSRNENLYSTMRLKQAGEARGHEVDVIDTLHCYMDIT----SNNPKIRYKG----
RIMK_VIBVY       MRIAILSRNENLYSTMRLKQAGEARGHEVDVIDTLHCYMDIT----SNNPKIRYKG----
RIMK_VIBPA       MRIAILSRNENLYSTMRLKQAGEERGHQIDVIDTLHCYMDIT----SNNPMIRYKG----
RIMK_PELCD       MKIGILSRNPELYSTRKLYEAAIIRGHQARIIDPLLCYMTIA----SQRPTIHYKG----
RIMK_COXBU       MKIAILSTKQELSSTQRLKEAALARGHKVKIINTLRCYMSLS----QEKPTIHYMG----
RIMK_LEGPA       MKIAILATNPHLYSHKRLKAEAEAAGHEVKIINPLYCYMNVA----ASNPKVHYRGG---
RIMK_LEGPH       MKIAILATNPHLYSHKRLKAEAEAAGHEVKIINPLYCYMNVA----ASNPKVHYRGG---
RIMK_LEGPL       MKIAILATNPHLYSHKRLKAEAEAAGHEVKIINPLYCYMNVA----ASNPKVHYRGG---
RIMK_XANAC       MKIAILSRNSKLYSTRRLIEAGRKRGHTVRILDPLRCYMRIA----ADGFSLHYKG----
RIMK_XANC5       MKIAILSRNSKLYSTRRLIEAGRKRGHTVRILDPLRCYMRIA----ADGFSLHYKG----
RIMK_XANOR       MKIAILSRNSKLYSTRRLIEAGRKRGHTVRILDPLRCYMRIA----ADGFSLHYKG----
RIMK_XANC8       MKIAILSRNSKLYSTRRLIEAGRTRGHTVRILDPLRCYMRIA----ADGFSLHYKG----
RIMK_XANCP       MKIAILSRNSKLYSTRRLIEAGRTRGHTVRILDPLRCYMRIA----ADGFSLHYKG----
RIMK_XYLFT       MKLAILSRNSKLYSTRRLVEVARMRGHTVRILDPLRCYMRIV----VGDFSMHYKG----
RIMK_HAEI8       MKLLMLCREPRLYSCQRLKEAAKRQGHEMDILDPNRCLLKLS--QNPPHFQIFYQENS--
RIMK_HAEIN       MKLLMLCREPRLYSCQRLKEAAKHQGHEMDILDPNHCFLKLS--QNPPHFQIFYQENS--
RIMK_MANSM       MKLLMLCREPNLYSCRRLKMTAENAGHKMDILDPNRFLLKIQ--ENRPHFALYYQPN---
RIMK_PASMU       MKLLMLCREPRLYSCQRLKEAAENSGHQMDILDPNRCLLKLS--ENSPHFELIYQATM--
RIMK_HAEDU       MKILMLCREPRLYSCQRLKQACQDRNIQLDILDPNRMLIKLAVIDAQMQAQLYYQAGEIY
                 *:: :*.    * *  :*            :::     : :          :        

RIMK_ECO57       -------RKLPHFDAVIPRIGTAITFYGTAALRQFEMLGSYPLNESVAIARARDKLRSMQ
RIMK_ECOLI       -------RKLPHFDAVIPRIGTAITFYGTAALRQFEMLGSYPLNESVAIARARDKLRSMQ
RIMK_SHISS       -------RKLPHFDAVIPRIGTAITFYGTAALRQFEMLGSYPLNESVAIARARDKLRSMQ
RIMK_ECOL6       -------RKLPHFDAVIPRIGTAITFYGTAALRQFEMLGSYPLNESVAIARARDKLRSMQ
RIMK_SHIFL       -------RKLPHFDAVIPRIGTAITFYGTAALRQFEMLGSYPLNESVAIARARDKLRSMQ
RIMK_SALCH       -------RRLPHFDAVIPRIGSAITFYGTAALRQFELLGSYPLNESVAITRARDKLRSLQ
RIMK_SALPA       -------RRLPHFDAVIPRIGSAITFYGTAALRQFELLGSYPLNESVAITRARDKLRSLQ
RIMK_SALTI       -------RRLPHFDAVIPRIGSAITFYGTAALRQFELLGSYPLNESVAITRARDKLRSLQ
RIMK_SALTY       -------RRLPHFDAVIPRIGSAITFYGTAALRQFELLGSYPLNESVAITRARDKLRSLQ
RIMK_PECAS       -------RRLDKFDAVIPRIGSQITFYGTAVLRQFEMLGSYPLNNSVAVIRARDKLHSLQ
RIMK_PSE14       -------KPLEGFDAVIPRIGASVTFYGCAVLRQFEMMGVFPLNESVAIARSRDKLRSLQ
RIMK_PSESM       -------KPLEGFDAVIPRIGASVTFYGCAVLRQFEMMGVFPLNESVAIARSRDKLRSLQ
RIMK_PSEU2       -------KPLEGFDAVIPRIGASVTFYGCAVLRQFEMMGVFPLNESVAIARSRDKLRSLQ
RIMK_PSEF5       -------KPLEGFDAVIPRIGASVTFYGCAVLRQFEMMGVFPLNESVAIARSRDKLRSLQ
RIMK_PSEPK       -------KPLEGFDAVIPRIGASVTFYGCAVLRQFEMMGVYPLNESVAIARSRDKLRSLQ
RIMK_PSEAE       -------QPLEGFDAVIPRIGASVTFYGCAVLRQFEMMGVFPLNESVAIARSRDKLRSLQ
RIMK_NITOC       -------EDLTGFDAVIPRIGASVTFYGTAVLRQFEMIGVYPLSESVAITRSRDKLRSLQ
RIMK_IDILO       -------KELPHYDCVIPRIGASVTFYGTAVLRQFEMIGSYPLNESVAISRSRDKLRSLQ
RIMK2_SHEON      -------EELPPFDAVIPRIGASITFYGSAVLRQFEMMGVYALNDSVGISRSRDKLRSMQ
RIMK_PHOPR       -------NDLTGFDAIIPRIGADITFYGCSVLRQFEMMDVFSVNQSIAISRSRDKLRSLQ
RIMK1_SHEON      -------QELTGFDAIIPRIHASVTFYGCAVVRQFEMMGVFAANDSISIARSRDKLRALQ
RIMK_VIBCH       -------EELAGFDAVIPRIGASVTFYGTAVLRQFEMMGVYPANESVAITRSRDKLRSMQ
RIMK_ALIF1       -------EELVDYDAIIPRIGASVTFYGTAVLRQFEMMGVYPVNESVAITRSRDKLRSMQ
RIMK_PSEHT       -------ENLKGFDAVIPRIGASVTFYGCSVLRQFEMMGVYPVNESVAISRSRDKLRSLQ
RIMK_VIBVU       -------EELPQYDAIIPRIGASVTFYGTAVVRQFEMMGTFVVNESVAISRSRDKLRSLQ
RIMK_VIBVY       -------EELPQYDAIIPRIGASVTFYGTAVVRQFEMMGTFVVNESVAISRSRDKLRSLQ
RIMK_VIBPA       -------EELPQYDAVIPRIGASITFYGTAVVRQFEMMGTFCVNESVAISRSRDKLRSLQ
RIMK_PELCD       -------EELTGFDAIIPRIGASITFYGTAVVRQFEMMNIYSVNESVAISRSRDKLRSLQ
RIMK_COXBU       -------KELARYDAVIPRIGASITFYGTAVVRQFEMMGTFCLNSSMSITRSRDKFRSLQ
RIMK_LEGPA       -------APLPHFDAVIPRIGASITYYGTAVLRHMETMGMYTLNESIAISRSRDKFRSLQ
RIMK_LEGPH       -------APLPHFDAVIPRIGASITYYGTAVLRHMETMGMYTLNESIAISRSRDKFRSLQ
RIMK_LEGPL       -------APLPHFDAVIPRIGASITYYGTAVLRHMETMGMYTLNESIAISRSRDKFRSLQ
RIMK_XANAC       -------KPITGFDAVIPRIGASVTRYGTAVLRQLEFMGTYTPNPSDAILRSRDKLRAHQ
RIMK_XANC5       -------KPITGFDAVIPRIGASVTRYATAVLRQLEFMGTYTPNPSDAILRSRDKLRAHQ
RIMK_XANOR       -------KPITGFDAVIPRIGASVTRYGTAVLRQLEFMGTYTPNPSDAILRARDKLRAHQ
RIMK_XANC8       -------KPITGFDAVIPRIGASVTRYGTAVLRQLEFMGTYTPNPSDAILRSRDKLRAHQ
RIMK_XANCP       -------KPITGFDAVIPRIGASVTRYGTAVLRQLEFMGTYTPNPSDAILRSRDKLRAHQ
RIMK_XYLFT       -------KPIDGYHAVIPRIGVSVTHYAAAVLRQFELMGTYSPNPSDAILRSRDKLRAHQ
RIMK_HAEI8       ---GSKPYLLPDYDAVLPRFGTTSTQMGCSVLQHFEGKGTFCLNLSQAFLNARDKWKSLQ
RIMK_HAEIN       ---ESKPYLLSDYDAVLPRFGTTSTQMGCSVLQHFEGKGTFCLNSSQAFLNARDKWKSLQ
RIMK_MANSM       ---QGTPYLLPDYDAVIPRFGTQSTKMGCSVLTHLAAKNIPCLNNPASFALARDKWLSLQ
RIMK_PASMU       ---EHEPSRLLNYDAVIPRFGSQSTKMGCAVLRHFEAQNIPCLNSATAFLQARDKWQSLQ
RIMK_HAEDU       DKCRAEPSLLAEYDAVLPRFGVSSTMMGCRVLDYFAAKKVVILNNSTAFRLARDKWSSLQ
                          :  :..::**:    *  .  .:  :        . . ..  :***  : *

RIMK_ECO57       LLARQGIDLPVTGIAHSPDDTSDLIDMVGGAPLVVKLVEGTQGIGVVLAETRQAAESVID
RIMK_ECOLI       LLARQGIDLPVTGIAHSPDDTSDLIDMVGGAPLVVKLVEGTQGIGVVLAETRQAAESVID
RIMK_SHISS       LLARQGIDLPVTGIAHSPDDTSDLIDMVGGAPLVVKLVEGTQGIGVVLAETRQAAESVID
RIMK_ECOL6       LLARQGIDLPVTGIAHSPDDTSDLIDMVGGAPLVVKLVEGTQGIGVVLAETRQAAESVID
RIMK_SHIFL       LLARQGIDLPVTGIAHSPDDTSDLIDMVGGAPLVVKLVEGTQGIGVVLAETRQAAESVID
RIMK_SALCH       LLARQGIDLPITGIAHSPDDTSDLIKMVGGAPLVVKLVEGTQGIGVVLAETRQAAESVID
RIMK_SALPA       LLARQGIDLPITGIAHSPDDTSDLIKMVGGAPLVVKLVEGTQGIGVVLAETRQAAESVID
RIMK_SALTI       LLARQGIDLPITGIAHSPDDTSDLIKMVGGAPLVVKLVEGTQGIGVVLAETRQAAESVID
RIMK_SALTY       LLARQGIDLPITGIAHSPDDTSDLIKMVGGAPLVVKLVEGTQGIGVVLAETRQAAESVID
RIMK_PECAS       LLAREGIDLPITGFAHSPDDTGDLIAMVGGAPLVVKLVDGTQGIGVVLAETRQAAESVID
RIMK_PSE14       LLSRRGIGLPVTGFAHSPDDIPDLIQMVNGAPLVIKVLEGTQGIGVVLCETATAAESVIE
RIMK_PSESM       LLSRRGIGLPVTGFAHSPDDIPDLIQMVNGAPLVIKVLEGTQGIGVVLCETATAAESVIE
RIMK_PSEU2       LLSRRGIGLPVTGFAHSPDDIPDLIQMVNGAPLVIKVLEGTQGIGVVLCETATAAESVIE
RIMK_PSEF5       LLSRRGIGLPVTGFAHSPDDIPDLIEMVNGAPLVIKVLEGTQGIGVVLCETATAAESVIE
RIMK_PSEPK       LLSRRGIGLPITGFAHSPDDIPDLIQMVNGAPLVIKVLEGTQGIGVVLCETPQAAESVIE
RIMK_PSEAE       LLSRKGIGLPVTGFAHSPDDVPDLIEMVGGAPLVIKLLEGTQGIGVVLCETEKAAESVLE
RIMK_NITOC       LLARKGIGLPVTGFAHAPDEIDDLIKMVGGAPVVIKLLEGTQGIGVVLAENKKAAQSVIE
RIMK_IDILO       LLSRKGIGLPTTGFASQPQDIPDLIDMVGGAPLVIKLLEGTQGIGVVLAETRQAAESVIE
RIMK2_SHEON      LMSRRGIGLPITGFANKPSDIPDLIDMVGGAPLVIKLLEGTQGIGVVLAETRKAAESVIE
RIMK_PHOPR       LLSRKGVGMPITGFASKPDDVPDLIKMVGGAPLVIKLLEGTQGIGVVLAETQTAAESVIE
RIMK1_SHEON      LLSRKGIGMPITGFANKPNDIPDLINMVGGAPLVIKLLEGTQGIGVVLAETKTAAESVIE
RIMK_VIBCH       LLSRRGIGMPITGFASKPDDVKDLLDMVGGAPVVIKLLEGTQGIGVVLAETRTAAESVIE
RIMK_ALIF1       LLSRKGIGMPITGFASKPDDVKDLLDMVGGAPVVIKLLEGTQGIGVVLAETRKAAESVVE
RIMK_PSEHT       LLSRKGVGMPVTGFASKPDDVKDLLEMVGGAPVVIKLLEGTQGIGVVLAETRKAAESVIE
RIMK_VIBVU       LLSRKGIGLPRTGFAHHPDNIQDVIRNVGGAPLVIKLLEGTQGIGVVLAETNKAAESVIE
RIMK_VIBVY       LLSRKGIGLPRTGFAHHPDNIQDVIRNVGGAPLVIKLLEGTQGIGVVLAETNKAAESVIE
RIMK_VIBPA       LLSRKGIGLPRTGFAHHPDNIQDVIKNVGGAPLVIKLLEGTQGIGVVLAETNKAAESVIE
RIMK_PELCD       LLSRKGIGLPHTCFAHSTRYTKDLINQVGGAPLVVKLLEGTQGIGVVLAETQKAAESVIE
RIMK_COXBU       FLSRKGIDLPITGFAHSPDDIEDLIQMVGGTPLIIKLIEGTQGIGVVLAETKKAAESVIQ
RIMK_LEGPA       LLARKGIPMPLTSFAQSPDDTEDLIHMVGGAPLVIKLLEGTQGKGVILADSHQSAVSIIN
RIMK_LEGPH       LLARKGIPMPLTSFAQSPDDTEDLIHMVGGAPLVIKLLEGTQGKGVILADSHQSAVSIIN
RIMK_LEGPL       LLARKGIPMPLTSFAQSPDDTEDLIHMVGGAPLVIKLLEGTQGKGVILADSHQSAVSIIN
RIMK_XANAC       LLAAQGIDMPVTVFGDNPDDTQDLLSMLGPPPHVVKLNEGAQGAGVILTEKASASRGVVE
RIMK_XANC5       LLAAQGIDMPVTVFGDNPDDTQDLLSMLGPPPHVVKLNEGAQGAGVILTEKASASRGVVE
RIMK_XANOR       LLAAQGIDMPVTVFGDNPDDTQDLLSMLGPPPHVVKLNEGAQGAGVILTEKASASRSVVE
RIMK_XANC8       LLASQGIDMPVTVFGDNPDDTQDLLSMLGPPPHVVKLNEGAQGAGVILTEKASASRGVVE
RIMK_XANCP       LLASQGIDMPVTVFGDNPDDTQDLLSMLGPPPHVVKLNEGAQGAGVILTEKASASRGVVE
RIMK_XYLFT       LLAAQGIDMPMTVFGDNPDDTQDLLSMLGPPPHVVKLNEGAQGKGVILSEKNSASRGLVE
RIMK_HAEI8       LLLKTGVPVPNSFLSGGEVQAQATIPHIS-SPTILKMLNGSQGIGVILAEKPQSAVSIME
RIMK_HAEIN       LLLKAGIPVPNSLLSGGEVQAQATIPHIS-SPTILKTLNGSQGIGVILAEKPQSAVSIME
RIMK_MANSM       ALAAANIAVPVTVFAGQDFQAGSAVEKVS-SPTILKTLNGSQGIGVILADRSQSAVSIME
RIMK_PASMU       MLMAQGIAIPHSLLAGPEFQAPSTMQYVQ-SPTILKTLSGAQGIGVILAEKRQSAVSILE
RIMK_HAEDU       VLAAQHIPIPTSSFAGALFSTAAHISQHR-IPLVIKTCSGSQGVGVMLSESKVHSVSLLQ
                  :    : :* : :.         :      * ::*  .*:** **:* :    : .:::

RIMK_ECO57       AFRGLNAHILVQEYIKEAQGCDIRCLVVGDEVVAAIERRAKEGDFRSNLHRGGAASVASI
RIMK_ECOLI       AFRGLNAHILVQEYIKEAQGCDIRCLVVGDEVVAAIERRAKEGDFRSNLHRGGAASVASI
RIMK_SHISS       AFRGLNAHILVQEYIKEAQGCDIRCLVVGDEVVAAIERRAKEGDFRSNLHRGGAASVASI
RIMK_ECOL6       AFRGLNAHILVQEYIKEAQGCDIRCLVVGDEVVAAIERRAKEGDFRSNLHRGGAASVASI
RIMK_SHIFL       AFRGLNAHILVQEYIKEAQGCDIRCLVVGDEVVAAIERRAKEGYFRSNLHRGGAASVASI
RIMK_SALCH       AFRGLNAHILVQEYIAEAKGCDIRCLVVGNEVVAAIERCAKAGDFRSNLHRGGVASIATI
RIMK_SALPA       AFRGLNAHILVQEYIAEAKGCDIRCLVVGNEVVAAIERCAKAGDFRSNLHRGGVASIATI
RIMK_SALTI       AFRGLNAHILVQEYIAEAKGCDIRCLVVGNEVVAAIERCAKAGDFRSNLHRGGVASIATI
RIMK_SALTY       AFRGLNAHILVQEYIAEAKGCDIRCLVVGNEVVAAIERCAKAGDFRSNLHRGGVASIATI
RIMK_PECAS       AFRGLNAHILVQEYVHEAQGKDIRCFVIGNRVVAAIERQAKAGEFRSNLHRGGSANKVKI
RIMK_PSE14       AFMGLKQDIMVQEYIKEAGGADIRCFVVGDKVIASMKRQAKPGEFRSNLHRGGSASLIKI
RIMK_PSESM       AFMGLKQDIMVQEYIKEAGGADIRCFVVGDKVIASMKRQAKPGEFRSNLHRGGSASLIKI
RIMK_PSEU2       AFMGLKQDIMVQEYIKEAGGADIRCFVVGDKVIASMKRQAKPGEFRSNLHRGGSASLIKI
RIMK_PSEF5       AFMGLKQNIMVQEYIKEAGGADIRCFVVGDKVIAAMKRQAKPGEFRSNLHRGGSASLIKI
RIMK_PSEPK       AFMGLKQNIMVQEYIKEAGGADIRCFVVGDKVIASMKRQAKPGEFRSNLHRGGVASLIKI
RIMK_PSEAE       AFMGLKHNIMVQEYIKEAGGADIRCFVVGDKVIASMKRQAAPGEFRSNLHRGGSASLIKI
RIMK_NITOC       AFMGLKTHILVQEFIKETAGSDIRCFIIGDKVVAAMKRQAPEGEFRSNLHRGGSASLVRI
RIMK_IDILO       AFMGLHSNFMVQEYIKEAGGADIRCLVIGDKVIAAMKRQAKAGEFRSNLHRGGSASLVKL
RIMK2_SHEON      AFMGLKANIMVQEYIKEANGADIRCFVLGDKVVAAMKRQAMPGEFRSNLHRGGTASLVKL
RIMK_PHOPR       AFMGLKANIMVQEYIKEAGGADIRCFVIGDKVIATMKRQAADGEFRSNLHRGGSASLVRI
RIMK1_SHEON      AFLGLKANIMLQEYIKESNGSDIRCFVVGDKVVASMKRQGPEGDFRSNLHLGGCGEKVKI
RIMK_VIBCH       AFMGLKANIMVQEYIKEAGGADIRCFVIGDKVIAAMKRQGADGEFRSNLHRGGTASLVKI
RIMK_ALIF1       AFMGLKANIMVQEFIKEAGGADIRCFVIGGKVIAAMKRQGAEGEFRSNLHRGGSASLVKL
RIMK_PSEHT       AFMGLKANIMVQEYIKEAGGADIRCFVLGDKVIAAMKRQAQEGEFRSNLHRGGSATLVRI
RIMK_VIBVU       AFMGLKANIMVQEFIEEAKGADIRCFVVGNKVIAAMKRQAKEGEFRSNLHRGGSAQLVRL
RIMK_VIBVY       AFMGLKANIMVQEFIEEAKGADIRCFVVGNKVIAAMKRQAKEGEFRSNLHRGGSAQLVRL
RIMK_VIBPA       AFMGLKANIMVQEFIEEAKGADIRCFVVGNKVIAAMKRQAKEGEFRSNLHRGGSAQLVRL
RIMK_PELCD       AFKGLKEQILVQEFIEESGGADIRCLVVGGKVVAAMKRQGAEGEFRSNIHRGGKATVVRL
RIMK_COXBU       AFLGLKVNILIQEFIGETQGRDIRCFVIGNKVVATMQREARPGDFRSNVHRGGTTKLIKI
RIMK_LEGPA       AFKEMHANILVQEFIEESRGTDIRCFVIGEKVVAAVKRQAKDGEFRANVHQGGKAVKVKL
RIMK_LEGPH       AFKEMHANILVQEFIEESRGTDIRCFVIGEKVVAAVKRQAKDGEFRANVHQGGKAVKVKL
RIMK_LEGPL       AFKEMHANILVQEFIEESRGTDIRCFVIGEKVVAAVKRQAKDGEFRANVHQGGKAVKVKL
RIMK_XANAC       ALRGLYANFIVQEFIGEAEGADLRCFVVGDKVVAAMRRQAAEGDFRSNLHLGGTAAVAEA
RIMK_XANC5       ALRGLYANFIVQEFIGEAEGADLRCFVVGDKVVAAMRRQAAEGDFRSNLHLGGTAAVTEA
RIMK_XANOR       ALRGLYANFIVQEFIGEAEGADLRCFVVGDRVVAAMRRQAAEGDFRSNLHLGGTAVVADA
RIMK_XANC8       ALRGLYANFIVQEFIGEAEGADLRCFVVGDRVVAAMRRQAADGDFRSNLHLGGTAAMAEA
RIMK_XANCP       ALRGLYANFIVQEFIGEAEGADLRCFVVGDRVVAAMRRQAADGDFRSNLHLGGTAAMAEA
RIMK_XYLFT       ALRGLYANFLVQEFISEADSADLRCFVVGNQVVATMRRQAAEGDFRSNLHLGGSATAATA
RIMK_HAEI8       AFKQTNISMLQQDFIEEAGNADIRCFVIGDQVVATMQRIGQDGEFRANCHRGGKTEKIIL
RIMK_HAEIN       AFKQTNISMLQQDFIEEAGNADIRCFVIGDQVVATMQRIGQNGEFRANCHRGGKTEKITL
RIMK_MANSM       TLTLSHIPVLLQDFIGEAGASDIRCFVIGDKVVAAMQRSGQKGEFRANCHRGGITQQITL
RIMK_PASMU       TLKQADVSVLAQEFIEEANGADLRCFVIGERVVASMQRISQNGEFRANFHRGGLAEKVSL
RIMK_HAEDU       TLQQAKVDNLLQDFVVEARGQDIRAFVIGDRVVAAIERNGLENDFRANIHQGGSASVIQL
                 ::       : *::: *:   *:*.:::* .*:*::.* .  . **:* * **       

RIMK_ECO57       TPQEREIAIKAARTMALDVAGVDILRANRGPLVMEVNASPGLEGIEKTTGIDIAGKMIRW
RIMK_ECOLI       TPQEREIAIKAARTMALDVAGVDILRANRGPLVMEVNASPGLEGIEKTTGIDIAGKMIRW
RIMK_SHISS       TPQEREIAIKAARTMALDVAGVDILRANRGPLVMEVNASPGLEGIEKTTGIDIAGKMIRW
RIMK_ECOL6       TPQEREIAIKAARTMALDVAGVDILRANRGPLVMEVNASPGLEGIEKTTGIDIASKMIRW
RIMK_SHIFL       TLQEREIAIKAARTMALDVAGVDILRANRGPLVMEVNASPGLEGIEKTTGIDIAGKMIRW
RIMK_SALCH       TPRERDIAIKAAQTLGLDVAGVDILRAARGPLVMEVNASPGLEGIEKTTGVDIAGRMIQW
RIMK_SALPA       TPRERDIAIKAAQTLGLDVAGVDILRAARGPLVMEVNASPGLEGIEKTTGVDIAGRMIQW
RIMK_SALTI       TPRERDIAIKAAQTLGLDVAGVDILRAARGPLVMEVNASPGLEGIEKTTGVDIAGRMIQW
RIMK_SALTY       TPRERDIAIKAAQTLGLDVAGVDILRAARGPLVMEVNASPGLEGIEKTTGVDIAGRMIQW
RIMK_PECAS       TAQERAIAIKAAKTLGLNVAGVDILRADRGPLVMEVNASPGLEGIETTTGLDIADMMIEF
RIMK_PSE14       TPEERMTALRAAKVMGLSVAGVDILRSNHGPLVMEVNSSPGLEGIEVTTSKDVAGMIIEY
RIMK_PSESM       TPEERMTALRAAKVMGLSVAGVDILRSNHGPLVMEVNSSPGLEGIEVTTSKDVAGMIIEY
RIMK_PSEU2       TPEERMTALRAAKVMGLSVAGVDILRSNHGPLVMEVNSSPGLEGIEVTTSKDVAGMIIGY
RIMK_PSEF5       TPEERMTALRAAKVMGLSVAGVDILRSNHGPLVMEVNSSPGLEGIETTTGKNVAGIIIEH
RIMK_PSEPK       TPEERITAIRAAKVMGLSVAGVDILRSNHGPLVMEVNSSPGLEGIEVTTGKNVAGMIIEH
RIMK_PSEAE       TPEERMTAIRAARVMGLNVAGVDILRSNHGPLVMEVNSSPGLEGIESTTGKDIAGIIIQY
RIMK_NITOC       TPEERSTAIRAAQTMGLNVAGVDILRSNHGPLVMEVNSSPGLEGIESATGKDVATKVIEF
RIMK_IDILO       TPAERATAVKAAKTMGLNVAGVDILRSNHGPLVMEVNSSPGLEGIEQATEKDVASQIITF
RIMK2_SHEON      TPEERSVAIRAAKTMGLNVAGVDLLRSNHGPLVMEVNSSPGLEGIEGATAKDVAGAIIEF
RIMK_PHOPR       TPEERKTAVAAAKAMGLSVAGVDLLRSERGPLIMEVNSSPGLEGIEAATEKDIAGMIIEY
RIMK1_SHEON      TPKERKMAVAAVKAMGLVVAGVDILRSNRGPLILEVNSAPGIEGIEQTTGISVTEPIVEY
RIMK_VIBCH       TPQERKTAIEAAKIMGLNVAGVDLLRSARGPLVMEVNSSPGLEGIEAATGKDIAGMIVEF
RIMK_ALIF1       TPEERKTAVAAANIMGLNVAGVDLLRSDRGPLVMEVNSSPGLEGIEKATGKDVAGLIIDF
RIMK_PSEHT       TPEERKTAVAAAKAMGLNVAGVDLLRSSRGPLVMEVNSSPGLEGIEIATGKDIAGMVIDF
RIMK_VIBVU       SKEERATAINAAKVMGLNLCGVDILQSKNGPVVMEVNSSPGLEGIEQATNKDVAGMIYEF
RIMK_VIBVY       SKEERATAINAAKVMGLNLCGVDILQSKNGPVVMEVNSSPGLEGIEQATNKDVAGMIYEF
RIMK_VIBPA       SKEERATAVNAAKVMGLNLCGVDILQSKNGPVVMEVNSSPGLEGIELATGKDVAGMIFDF
RIMK_PELCD       TPEERATAVRSAHIMGLNVAGVDILQSNRGPIVMEVNSSPGLEGIETATGKDVADEIIRF
RIMK_COXBU       TPQEREISINAAKALGLNVAGVDLLRSKRGPLVLEVNSSPGLEGIENITKKDIAGMIIEF
RIMK_LEGPA       SPQERAIAVSAAKTMGLRVAGVDLIRSNHGPLVLEINSSPGLEGIEKATNINLAGKIIEY
RIMK_LEGPH       SPQERAIAVSAAKTMGLRVAGVDLIRSNHGPLVLEINSSPGLEGIEKATNINLAGKIIEY
RIMK_LEGPL       SPQERAIAVSAAKTMGLRVAGVDLIRSNHGPLVLEINSSPGLEGIEKATNINLAGKIIEY
RIMK_XANAC       TEQEQEVAVRSARALGLAVAGVDLIRSRRGPLVLEVNSTPGLEGVEGVCGVDVAAAIVVH
RIMK_XANC5       TEQEQEVAVRSARALGLTVAGVDLIRSKRGPLVLEVNSTPGLEGVEGVCGVDVAAAIVQH
RIMK_XANOR       TELEREVAVRSARALGLAVAGVDLIRSKRGPLVLEVNSTPGLEGVEGVCGVDVAGAIVQH
RIMK_XANC8       SPQEQDVAVRSARALGLAVAGVDLIRSQRGPLVLEVNSTPGLEGVEGVCGVDVAGTIIQH
RIMK_XANCP       SPQEQDVAVRSARALGLAVAGVDLIRSQRGPLVLEVNSTPGLEGVEGVCGVDVAGTIIQH
RIMK_XYLFT       SEEEQEVAVRSAHALGLTVAGVDLIRSRRGPLVLEVNPTPGLEGIEATSGTNVAIKIVRH
RIMK_HAEI8       SDDEKQIAIRATKAIGLDVAGVDLIRSKNGLLVLEVNASPGLEMIEKTSGVDIAAEIIDY
RIMK_HAEIN       SDEEKQIAIQATKAIGLDVAGVDLIRSKKGLLVLEVNASPGLEMIEKTSGIDIAAEIIDY
RIMK_MANSM       SDDEKLIAVRAAQALGLDVAGVDLIQSKKGLLVLEVNASPGLEMIEKTSGIDVATQMIAY
RIMK_PASMU       SEAEKTMAVKATKALGLDVAGVDLIRAKRGTLVLEVNASPGLEMIEKTSGIDIALQMIVH
RIMK_HAEDU       NTAEQQLAVLAAKTIGLDVAGVDLIRSNKGLLVLEVNACPGLDGIEKASKLDIAGLIIDY
                 .  *:  :: :.. :.* :.***:::: .* :::*:*. **:: :*     .::  :   

RIMK_ECO57       IERHATTEYCLKTGG------
RIMK_ECOLI       IERHATTEYCLKTGG------
RIMK_SHISS       IERHATTEYCLKTGG------
RIMK_ECOL6       IERHATTEYCLKTGG------
RIMK_SHIFL       IERHATTEYCLKTGG------
RIMK_SALCH       IERHATPEFCLKIGG------
RIMK_SALPA       IERHATPEFCLKIGG------
RIMK_SALTI       IERHATPEFCLKIGG------
RIMK_SALTY       IERHATPEFCLKIGG------
RIMK_PECAS       IEQKTQRRIATSSTIGKS---
RIMK_PSE14       LEKNSGPHMTRTKGKG-----
RIMK_PSESM       LEKNSGPHMTRTKGKG-----
RIMK_PSEU2       LEKNSGPHMTRTKGKG-----
RIMK_PSEF5       IEKNGGPNMTRTKGKG-----
RIMK_PSEPK       LEKNGGPNQTRTKGKG-----
RIMK_PSEAE       LEKNGGPHLARTKGKG-----
RIMK_NITOC       IEKNATRGRTRTRGKG-----
RIMK_IDILO       LEKNAKAHKTRTKGQG-----
RIMK2_SHEON      VEKNALKTKKPTQA-------
RIMK_PHOPR       IEKNAAKKNRRHLQYQ-----
RIMK1_SHEON      IEKMVLAQKSNRPVIA-----
RIMK_VIBCH       IEKNAASKRTKTRGKG-----
RIMK_ALIF1       IEKNAATKRTKTRGKG-----
RIMK_PSEHT       IEKTASSKGTATRGKG-----
RIMK_VIBVU       IEKNAKPNSNRTKGRG-----
RIMK_VIBVY       IEKNAKPNSNRTKGRG-----
RIMK_VIBPA       IEKNAKPNSNRTRGKG-----
RIMK_PELCD       IEKHTKPGRTKTRGKG-----
RIMK_COXBU       IEKNAKPIKAYSRYQG-----
RIMK_LEGPA       IEKKAKPISSNHRFHG-----
RIMK_LEGPH       IEKKAKPISSNHRFHG-----
RIMK_LEGPL       IEKKAKPISSNHRFHG-----
RIMK_XANAC       LEQSVRRSAG-----------
RIMK_XANC5       LEQSVRRSAG-----------
RIMK_XANOR       LEQSVRRSAD-----------
RIMK_XANC8       LEQAIR---------------
RIMK_XANCP       LEQAIR---------------
RIMK_XYLFT       VEEMLATICSSNICKP-----
RIMK_HAEI8       IEINAFINLR-----------
RIMK_HAEIN       IEINAFINSR-----------
RIMK_MANSM       LEKKIAGL-------------
RIMK_PASMU       LEKKYQALQNVTKTIELRSHK
RIMK_HAEDU       LLAMKK---------------
                 :