CLUSTAL format seed alignment for MF_01553

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Q1WU78_LIGS1          -----------MTFKVYYQPSKKSNPKRENTHVMYFEAKDEVE------ARHLVETHFPE
RPOY_LEVBA            -----------MIYKVYYQNDQKRNPKREDTHSLYLEAPTEVE------ARALVEAH-TE
A0A1X7NNA4_9LACT      -----------MIYKITYQETKLRNPKREETQSLYIESDTEIE------ARSLVETN-TP
A0A1E7X8U7_9LACO      -----------MIWKVLYQPSKKESPRRETTHSLYVEADTEVE------AHALVEDN-TD
A0A192H424_9LACO      -----------MIYKVLYQKDKDIAPRRESTETLYLEADSAVA------ARAIIERN-TP
RPOY_LEUMM            -----------MIYKIYYQEHPERNPKRETTISMYIEAESLPQ------AREIIEEN-TE
F8HY00_WEIKK          -----------MIYKVYFQPTKTQNPKRESTKSLYIEAPDLPT------ARLAVETN-TE
RPOY_LIMRD            -----------MTFKVYYQADKTKRPVRENTQSLYIEADSEAE------ALLMVEHN-TD
Q03F07_PEDPA          -----------MIFKVYYQESKKETPRRENTHSLFIEAETKPD------AIKRVETNNPD
G8PCX0_PEDCP          -----------MIYKVYYQESKAAMPKRENTHSLYIDATNKSE------AIARVENNNS-
A0A1G7U3E7_9LACT      -----------MIFKVMYQESKEQVPTREMTQSLYLEARDRVE------AIDKVTKN-TP
A0A1Q2D428_9ENTE      -----------MIFKVYYQEDKAFSPQREKTKSLYIEGESDVA------VRRLINKN-TP
RPOY_BACSU            -----------MIYKVFYQEKADEVPVREKTDSLYIEGVSERD------VRTKLKE--KK
A0A0M4G7C2_9BACI      -----------MIYKVFFQKRADEVPVRENTDSVYIEASTERE------VRRLLKS--RN
RPOY_HALH5            -----------MIYKIFYQKDFDQVPVRENTDSLYVEAESEAD------VRKKLSE--KN
A0A1G7YA58_9BACI      -----------MIYKVFYQKNFQEVPVRENTDAMFIEAETERE------VRRKLAD--KN
A0A1H9TKD4_9BACI      -----------MVYKVLYQEDSLEIPVREHTKSLYIEASSERE------VRQLLKE--KN
A0A345BX46_9BACI      -----------MIFKVLYQPNYDEMPVREKTETLFIEAETEQD------VRKKLAE--DH
A0A2X4Z883_LEDLE      -----------MIFKVYYQEIETEIPVRENTKTFYIDAENERA------VRHILKD--RP
A0A1Q2L0B0_9BACL      -----------MIFKVYYQTNRSEVPVRENTKSLYVDASNERE------VRRHLKD--RD
RPOY_BACAN            -----------MIFKVFYQEKMTEVPVRENTKVLYLEATSEKD------VRTKLNK--FA
RPOY_ALKCK            -----------MIFKVYYQEDAAQMPVRERTKSLYIEGESEAD------VRLKLAK--QN
A0A5B8Z2R2_9BACI      -----------MIFKVFYQESIKEVPVREKTQTIYMEAESERD------VRLKLAD--RP
A0A223KS70_9BACI      -----------MIFKVYYQEQLTEAPVREKTKTVFVEGEAEKD------VRIALKD--KP
A0A078LZ21_9STAP      ----------MAVFKVFFQTDMDTRIIREDTQIRYVEAETEEE------VRKYLKA--NN
A0A662Z3G5_9STAP      ----------MAIFKVFFQEVNNKRIIRETTRTRYFEANSESE------VRVALKG--ED
RPOY_STAAB            ----------MAVFKVFYQHNRDEVIVRENTQSLYVEAQTEEQ------VRRYLKD--RN
A0A1G9ZQE0_9BACI      -----------MIFKVYYQENLTEVPVRENTHTLYVEAETEEE------VRKGLKE--RA
RPOY_LISIN            -----------MIFKVFYQETLTETPVREKTQSLYVEAESEVK------VRQLLKD--EP
RPOY_OCEIH            -----------MIFKVLYQELPNEVPIRERTKSLYVEAETIRE------VRKKISDSDHN
A0A1B1Z3V1_9BACI      -----------MIFKVFFQTSLNEVPIREHTQTVYVEAETIND------VRIKLAD--RK
A0A3P5XEV2_9BACL      -----------MIFKVYYQESMLQIPVRENTKSMYIEADSERA------VREKLKK--RG
A0A1G6ISG6_9BACI      -----------MIFKVHYQPDTIQAPVREKTRALYIEAGSETA------VRQALGP--KG
A0A090IU97_9BACI      -----------MIFKVYVQESKNQIPVRERTKALYLEADSKIE------VYRKFKE--TP
A0A347WJC2_9LACT      -----------MIYKVLYQPSKTQAPRRETTQALFMEAESIKE------VRKLLDAN-TP
F9VFZ9_LACGL          -----------MIFKAFYQEDKTRSPRRETTKVLYLDLDVTDTREGIILARELLAAN-TD
RPOY_LACLM            -----------MIFKVFYQKDNTRSPRRETTDALYLDLDVATKEEGVILARELLAKN-TA
A0A290Q8T3_9LACT      -----------MLFKVFYQETKKRSPKRETTHSLYLELDTTDVRQGVIQSREIMRDN-TD
A0A239T203_9STRE      -----------MIYKIFYQETKTTNPKREMTKALYLEVDADNELAGRIKARQIVEAN-TA
A4VSP3_STRSY          MPVKKKGTILHMIYKVFYQESKIS-PRREQTRALYLDIDAASELEGRIIARELVETNRPE
                                   :*   *        ** *   :.:                .      

Q1WU78_LIGS1          CNVEFIEALDKATLEYEKQ--S-VNFKLTEF----------
RPOY_LEVBA            HNIEFIEAIEGETLAYEQQ--N-PNYKLTEFSE--------
A0A1X7NNA4_9LACT      FNIEFIQPIDGSHLEYEQK--S-PDFKLTEFAK--------
A0A1E7X8U7_9LACO      YDIEFIEPLQGKHLEYEQS--S-PDYKVTEFNNK-------
A0A192H424_9LACO      YNIEFIQELNGNHLDYEQK--S-ANYKLTEFSVNEKTERQE
RPOY_LEUMM            YNVEFIEELSDKAVTYEKA--N-PNFEVTTF----------
F8HY00_WEIKK          YNVEQIEELSEAALTYEQQSLG-ERFKLTEF----------
RPOY_LIMRD            YNIEFVEQLDEKALAYEKQ--N-PNFKLTTF----------
Q03F07_PEDPA          FNVEQVELLEGKALEYEQQ--G-VNYKLVEY----------
G8PCX0_PEDCP          FNVEQVELLEGNALEYEQQ--S-ASYKLVEY----------
A0A1G7U3E7_9LACT      YNIQYVQELDEAHLAYEKE--Q-EDFKLVEF----------
A0A1Q2D428_9ENTE      YNIELIQLLEGNHLEYEKE--N-ADFTLVEFE---------
RPOY_BACSU            FNIEFITPVDGAFLEYEQQS---ENFKVLEL----------
A0A0M4G7C2_9BACI      YNIEFIQKVEGAFLEYERKN---ENFKVLEL----------
RPOY_HALH5            YNLEFITPISGEFLAYEQQK---EHFTVEKL----------
A0A1G7YA58_9BACI      FNIEYVQPVSESLLQFEQQR---EDFKVENL----------
A0A1H9TKD4_9BACI      INIELIQLLDEAHLAYEQQS---EFFRVVND----------
A0A345BX46_9BACI      LNIEYVQRLSDAHLEYEQKS---EDFKVEKR----------
A0A2X4Z883_LEDLE      INIEYVQLLEGAYLEYEKKS---EDFSLQEIN---------
A0A1Q2L0B0_9BACL      LNIEYIQLLEGNHLEYEQAN---PHYEVETADNR-------
RPOY_BACAN            YNIEFVQSVTGNHLEYEKAN---ADLTLAEIV---------
RPOY_ALKCK            FNIEYVTAVTGAYLEYEQAN---SDFKVVNI----------
A0A5B8Z2R2_9BACI      YNIEFIAELKGDFLEFEKQR---EDFNVLEIR---------
A0A223KS70_9BACI      YNIEIVIPVEGEYLAYEQQS---EHFKVLEIG---------
A0A078LZ21_9STAP      NNIEFIQALSPAHLEYEQNN--NDDFKVETIA---------
A0A662Z3G5_9STAP      YNIEFVQELSPEHLQYEEAN--NPDYKVENV----------
RPOY_STAAB            FNIEFITKLEGAHLDYEKEN--SEHFNVEIAK---------
A0A1G9ZQE0_9BACI      YNIEFVTPLSEKALAYEKES--NVDFEVENLK---------
RPOY_LISIN            FHIEFVEKISDAHLAYEKEN---PDFALWEK----------
RPOY_OCEIH            YNIEFVQPLDEAHLQYEKDT---GKLELENL----------
A0A1B1Z3V1_9BACI      YNIEYIQEINGKFLEYEKET---NSLELENV----------
A0A3P5XEV2_9BACL      YNIEFIQHLDGQYLEHEQAA---PYFEIEQV----------
A0A1G6ISG6_9BACI      YNIESIIKLSDAYLAYEQEH---AKYEIVSV----------
A0A090IU97_9BACI      YLIEHIQELEGNYLEYEKQS---NNFKLMEI----------
A0A347WJC2_9LACT      YNVEFIQALEGEFLDYEREN--NPDFEVVTF----------
F9VFZ9_LACGL          YHVEFIDSLSDEAVEYEKEN---GGLEITSF----------
RPOY_LACLM            YHVEFIDSLSDESVEYEKET---GVFEITSF----------
A0A290Q8T3_9LACT      YHIEFIDAISDEQAAYERES---EGFNITTF----------
A0A239T203_9STRE      YHIEFIELLSEKHLAYEKET---GAFQLMEF----------
A4VSP3_STRSY          YNIEFIDLLSDNHLEYEKEH---ADFKITEF----------
                        :: :  :      .*.         :