CLUSTAL format seed alignment for MF_01554_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GLMM_BACAN      --------------------------------------MGKYFGTDGVRGVANKEL-TPE
GLMM_BACCZ      --------------------------------------MGKYFGTDGVRGVANKEL-TPE
GLMM_BACHK      --------------------------------------MGKYFGTDGVRGVANKEL-TPE
GLMM_BACC1      --------------------------------------MGKYFGTDGVRGVANQEL-TPE
GLMM_BACCR      --------------------------------------MGKYFGTDGVRGVANKEL-TPE
GLMM_BACLD      --------------------------------------MGKYFGTDGVRGVANSEL-TPE
GLMM_BACSU      --------------------------------------MGKYFGTDGVRGVANSEL-TPE
GLMM_GEOKA      --------------------------------------MGKYFGTDGVRGVANREL-TPE
GLMM_BACHD      --------------------------------------MGKYFGTDGVRGVANTEL-TPE
GLMM_BACSK      --------------------------------------MGKYFGTDGVRGVANSEL-TPE
GLMM_LISMF      --------------------------------------MGKYFGTDGVRGVANSEL-TPE
GLMM_LISMO      --------------------------------------MGKYFGTDGVRGVANSEL-TPE
GLMM_LISIN      --------------------------------------MGKYFGTDGVRGVANSEL-TPE
GLMM_OCEIH      --------------------------------------MGKFFGTDGVRGVANEGL-TPE
GLMM_STAAC      --------------------------------------MGKYFGTDGVRGVANQEL-TPE
GLMM_STAA8      --------------------------------------MGKYFGTDGVRGVANQEL-TPE
GLMM_STAAM      --------------------------------------MGKYFGTDGVRGVANQEL-TPE
GLMM_STAAN      --------------------------------------MGKYFGTDGVRGVANQEL-TPE
GLMM_STAAW      --------------------------------------MGKYFGTDGVRGVANQEL-TPE
GLMM_STAAR      --------------------------------------MGKYFGTDGVRGVANQEL-TPE
GLMM_STAAS      --------------------------------------MGKYFGTDGVRGVANQEL-TPE
GLMM_STAEQ      --------------------------------------MGKYFGTDGVRGVANQEL-TPE
GLMM_STAES      --------------------------------------MGKYFGTDGVRGVANQEL-TPE
GLMM_STAS1      --------------------------------------MAKYFGTDGVRGVANKEL-TPE
GLMM_STAHJ      --------------------------------------MVKYFGTDGVRGIANKEL-TPE
GLMM_LACAC      --------------------------------------MLKYFGTDGVRGVANQGL-TPE
GLMM_LACJO      --------------------------------------MLKYFGTDGVRGVANAGL-TPE
GLMM_LACPL      ---------------------------------------MKYFGTDGVRGIANSGL-TPE
GLMM_STRA3      --------------------------------------MGKYFGTDGVRGEANVEL-TPE
GLMM_STRA5      --------------------------------------MGKYFGTDGVRGEANVEL-TPE
GLMM_STRA1      --------------------------------------MGKYFGTDGVRGEANVEL-TPE
GLMM_STRT1      --------------------------------------MGKYFGTDGVRGEANVGL-TPE
GLMM_STRT2      --------------------------------------MGKYFGTDGVRGEANVEL-TPE
GLMM_STRP1      --------------------------------------MGKYFGTDGVRGEANVEL-TPE
GLMM_STRP3      --------------------------------------MGKYFGTDGVRGEANVEL-TPE
GLMM_STRP6      --------------------------------------MGKYFGTDGVRGEANVEL-TPE
GLMM_STRPM      --------------------------------------MGKYFGTDGVRGEANVEL-TPE
GLMM_STRP8      --------------------------------------MGKYFGTDGVRGEANVEL-TPE
GLMM_STRMU      --------------------------------------MGKYFGTDGVRGEANVEL-TPE
GLMM_STRPN      --------------------------------------MGKYFGTDGVRGEANLEL-TPE
GLMM_STRR6      --------------------------------------MGKYFGTDGVRGEANLEL-TPE
GLMM_LACLA      --------------------------------------MGKYFGTDGVRGEANVEL-TPE
GLMM_CLOAB      --------------------------------------MGRMFGTDGVRGIANKEL-TAE
GLMM_CLOTE      --------------------------------------MSRMFGTDGVRGIANEEL-TAE
GLMM_CLOPE      --------------------------------------MSRLFGTDGVRGIANTEL-TAE
GLMM_CALS4      --------------------------------------MGRLFGTDGVRGIANKEL-TPQ
GLMM_FUSNN      --------------------------------------MGRYFGTDGIRGEANREL-TVD
GLMM_COREF      --------------------------------------MTRLFGTDGVRGLANKTL-TAP
GLMM_CORGL      --------------------------------------MTRLFGTDGVRGLANEVL-TAP
GLMM_CORDI      --------------------------------------MTRLFGTDGVRGLANRKL-TAL
GLMM_CORJK      --------------------------------------MGKLFGTDGVRGLANKKL-TAP
GLMM_MYCBO      --------------------------------------MGRLFGTDGVRGVANREL-TAE
GLMM_MYCTU      --------------------------------------MGRLFGTDGVRGVANREL-TAE
GLMM_MYCLE      --------------------------------------MGRLFGTDGVRGVANREL-TPE
GLMM_MYCPA      --------------------------------------MGRLFGTDGVRGVANREL-TAE
GLMM_NOCFA      --------------------------------------MGRLFGTDGVRGLANGSL-SPE
GLMM_STRAW      --------------------------------------MGRLFGTDGVRGVANADL-TAE
GLMM_STRCO      --------------------------------------MGRLFGTDGVRGVANADL-TAE
GLMM_THEFY      --------------------------------------MTRLFGTDGVRGLAGRDL-TAG
GLMM_LEIXX      --------------------------------------MPRLFGTDGVRGLANGTL-TAD
GLMM_CUTAK      --------------------------------------MARLFGTDGVRGVANQDL-TAE
GLMM_BIFLO      --------------------------------------MPKMFGTDGVRGLANRDL-TAR
GLMM_TROW8      --------------------------------------MARLFGTDGIRALANGDLLTPE
GLMM_TROWT      --------------------------------------MARLFGTDGIRALANGDLLTPE
GLMM_SYMTH      --------------------------------------MPRMFGTDGVRGVANTEDLSPE
GLMM_THET2      --------------------------------------MRRYFGTDGVRGEAGKPPLTPE
GLMM_THET8      --------------------------------------MRRYFGTDGVRGEAGKPPLTPE
GLMM_DEIRA      ------------------------------------MTERKYFGTDGVRAVAGEFPLTPA
GLMM_AGRFC      -------------------------------------MARRYFGTDGIRGQSNVFPMTPD
GLMM_RHIME      -------------------------------------MKRRYFGTDGIRGQSNIFPMTPD
GLMM_BRUME      -------------------------------------MTRKFFGTDGIRGQANSFPMTPE
GLMM_BRUSU      -------------------------------------MTRKFFGTDGIRGQANSFPMTPE
GLMM_RHILO      -------------------------------------MAGNYFGTDGIRGRANKFPMTAE
GLMM_BARHE      -------------------------------------MPQKYFGTDGIRGKANVFPMTPD
GLMM_BARQU      -------------------------------------MAQKYFGTDGIRGKANVFPMTPD
GLMM_BRADU      -------------------------------------MSRKYFGTDGIRGRANGL-ITPE
GLMM_NITWN      -------------------------------------MSRRYFGTDGIRGRANGL-ITPE
GLMM_RHOPA      -------------------------------------MSRRYFGTDGIRGRANGL-ITPE
GLMM_CAUVC      ------------------------------------MSKRAYFGTDGIRGQANKHPMTAE
GLMM_GLUOX      -----------------------------------MATKRSLFGTDGIRGTANTAPMTVE
GLMM_ZYMMO      -------------------------------------MSRQYFGTDGIRGCTNKDPMTAD
GLMM_RUEPO      --------------------------------------MRKLFGTDGVRGTANTHPMTAE
GLMM_CAMJE      ---------------------------------------MKLFGTDGVRGKAGEF-LDSF
GLMM_CAMJR      ---------------------------------------MRLFGTDGVRGKAGEF-LDSF
GLMM_HELPJ      ---------------------------------------MKIFGTDGVRGKAGVK-LTPM
GLMM_HELPY      ---------------------------------------MKIFGTDGVRGKAGVK-LTPM
GLMM_HELHP      --------------------------------MKTKDTKAKLFGTDGVRGRAGEV-ITPS
GLMM_WOLSU      ---------------------------------------MKLFGTDGVRGKAGEK-LTAF
GLMM_PELUB      -------------------------------------MAKKYFGTDGIRGAVNSKNINGD
GLMM_ANAMM      ---------------------------------------MNIFGTDGVRGRANVYPMDPI
GLMM_DESPS      --------------------------------------MRKLFGTDGIRGVANVHPMTME
GLMM_GEOSL      --------------------------------------MKKLFGTDGVRGVANVYPMTTE
GLMM_DESVH      -------------------------------------MGRRLFGTDGLRGQVNIYPMTAD
GLMM_BDEBA      -----------------------------------MEKKTRLFGTDGIRGTANQYPMTPD
GLMM_CHLAB      ----------------------------------MTKEVKQLFGTDGVRGKANYEPMTVE
GLMM_CHLCV      ----------------------------------MTREEKQLFGTDGIRGRANYEPMTVE
GLMM_CHLPN      ----------------------------------MQQSVRKLFGTDGVRGRANFEPMTVE
GLMM_CHLMU      ----------------------------------MTCDVSPLFGTDGIRGRANFEPMTVE
GLMM_CHLTR      ----------------------------------MTRDVRQLFGTDGVRGRANFEPMTVE
GLMM_PARUW      ---------------------------------MELKRPFKIFGTDGIRGRANKSPMVPE
GLMM_LEGPA      ------------------------------------MSQRKYFGTDGIRGHVGLSNINPE
GLMM_LEGPH      ------------------------------------MSQRKYFGTDGIRGHVGLSNINPE
GLMM_LEGPL      ------------------------------------MSQRKYFGTDGIRGHVGLSNINPE
GLMM_COXBU      -------------------------------------MQKKYFGTDGIRGKVGNSLINAE
GLMM_AROAE      -------------------------------------MGRKYFGTDGVRGRVGDSTITPE
GLMM_DECAR      -------------------------------------MTRKYFGTDGVRGRVGQSPITPD
GLMM_BORBR      ------------------------------------MSQRKYFGTDGVRGEVGGPVINAA
GLMM_BORPA      ------------------------------------MSQRKYFGTDGVRGEVGGPVINAA
GLMM_BORPE      ------------------------------------MSQRKYFGTDGVRGEVGGPVINAA
GLMM_BURMA      -------------------------------------MGRRYFGTDGIRGKVGDAPITPD
GLMM_BURPS      -------------------------------------MGRRYFGTDGIRGKVGDAPITPD
GLMM_CUPPJ      -------------------------------------MTRKYFGTDGVRGKVGESPITPD
GLMM_RALSO      -------------------------------------MSRKYFGTDGIRGRVGESPITPD
GLMM_NEIG1      ------------------------------------MMAKKYFGTDGVRGEVGQFPITPD
GLMM_NEIMB      -------------------------------------MAKKYFGTDGVRGEVGQFPITPD
GLMM_NEIMA      -------------------------------------MAKKYFGTDGVRGEVGQFPITPD
GLMM_NEISU      -------------------------------------MAKKYFGTDGVRGEVGQFPITPD
GLMM_CHRVO      -------------------------------------MSRKYFGTDGVRGEVGKFPITPE
GLMM_NITEU      -------------------------------------MKKKYFGTDGIRGKVGDFPITPD
GLMM_METCA      -------------------------------------MKKEYFGTDGIRGRVGDYPITPD
GLMM_NITOC      -------------------------------------MEKKYFGTDGIRGKVGERPITPD
GLMM_PSE14      ------------------------------------MTTRKYFGTDGIRGRVGQFPITPE
GLMM_PSESM      ------------------------------------MTTRKYFGTDGIRGRVGQFPITPE
GLMM_PSEU2      ------------------------------------MTSRKYFGTDGIRGRVGQFPITPE
GLMM_PSEF5      -------------------------------------MTKKYFGTDGIRGRVGEFPITPD
GLMM_PSEPK      -------------------------------------MSRKYFGTDGIRGRVGEYPITPD
GLMM_PSEAE      -------------------------------------MSRKYFGTDGIRGRVGEFPITPD
GLMM_XANAC      ------------------------------------MSARKYFGTDGIRGRVGQGVISAD
GLMM_XANC5      ------------------------------------MSARKYFGTDGIRGRVGQGVISAD
GLMM_XANOR      ------------------------------------MSARKYFGTDGIRGRVGQGVISAD
GLMM_XANC8      ------------------------------------MSSRKYFGTDGIRGRVGQGVISAD
GLMM_XANCP      ------------------------------------MSSRKYFGTDGIRGRVGQGVISAD
GLMM_XYLFA      ------------------------------------MRVSRYFGTDGIRGRVGQGLISAD
GLMM_XYLFT      ------------------------------------MRVSRYFGTDGIRGRVGQGLISAD
GLMM_ECOL6      ------------------------------------MSNRKYFGTDGIRGRVGDAPITPD
GLMM_SHISS      ------------------------------------MSNRKYFGTDGIRGRVGDAPITPD
GLMM_ECO57      ------------------------------------MSNRKYFGTDGIRGRVGDAPITPD
GLMM_ECOLI      ------------------------------------MSNRKYFGTDGIRGRVGDAPITPD
GLMM_SHIFL      ------------------------------------MSNRKYFGTDGIRGRVGDAPITPD
GLMM_SALTI      ------------------------------------MSNRKYFGTDGIRGRVGNAPITPD
GLMM_SALTY      ------------------------------------MSNRKYFGTDGIRGRVGNAPITPD
GLMM_SALCH      ------------------------------------MSNRKYFGTDGIRGRVGNAPITPD
GLMM_SALPA      ------------------------------------MSNRKYFGTDGIRGRVGNAPITPD
GLMM_YERPE      ------------------------------------MSNRKYFGTDGIRGKVGESPITPD
GLMM_YERPS      ------------------------------------MSNRKYFGTDGIRGKVGESPITPD
GLMM_PECAS      ------------------------------------MSNRKYFGTDGIRGKVGDTPITPD
GLMM_PHOLL      ------------------------------------MSNRKYFGTDGIRGKVGDSPITPD
GLMM_PHOPR      ------------------------------------MAERKFFGTDGIRGLVGEGPITPE
GLMM_ALIF1      ------------------------------------MAERKYFGTDGVRGLVGQAPITPD
GLMM_VIBVU      -----------------------------------MSDKRRYFGTDGVRGKVGQYPITPD
GLMM_VIBVY      -----------------------------------MSDKRRYFGTDGVRGKVGQYPITPD
GLMM_VIBPA      -----------------------------------MSNKRRYFGTDGVRGKVGQYPITPD
GLMM_VIBCH      -----------------------------------MSDKRRYFGTDGVRGKVGQYPITPD
GLMM_HAEI8      ------------------------------------MANRKYFGTDGVRGKVGSYPITPD
GLMM_HAEIN      ------------------------------------MANRKYFGTDGVRGKVGAYPITPD
GLMM_MANSM      ------------------------------------MAERKYFGTDGVRGKVGTFPITPD
GLMM_PASMU      ------------------------------------MAERKYFGTDGVRGKVGTFPITPD
GLMM_HAEDU      ------------------------------------MAERKYFGTDGVRGKVGQFPITPD
GLMM_IDILO      ------------------------------------MSERKYFGTDGVRGRVGQFPITPE
GLMM_COLP3      ------------------------------------MSDRKYFGTDGIRGLVGQYPITPE
GLMM_SHEON      ------------------------------------MSERKFFGTDGIRGKVGSGQMTPE
GLMM_PSEHT      ------------------------------------MKERKYFGTDGVRGLVGEHPINPE
GLMM_BLOFL      ------------------------------------MKRSKYFGTDGIRGRVGLSPITPD
GLMM_BLOPB      ------------------------------------MKRRKYFGTDGIRGKVGSMPITPD
GLMM_BUCAI      ------------------------------------MTFLQYFKTDGIRGKVGVNPITPD
GLMM_BUCBP      --------------------------------------MIKYFGTDGIRGVVGKTPITAD
GLMM_WIGBR      ------------------------------------MENNKYFGTDGIRGKVGKNPITPE
GLMM_ACIAD      ---------------------------------------MSYFGTDGIRGKFGEMPITPE
GLMM_PSYA2      ---------------------------------------MSYFGTDGIRGKFGELPITPD
GLMM_FRATT      --------------------------------------MAKYFGTDGIRGEVANSTITVE
GLMM_THEMA      -------------------------------------MRVKYFGTDGIRGIFGETL-TDE
GLMM_NOSS1      MVSSITRIQNYVIDGAATSNGLETVLESNFAPSLISLPATPLFGTDGIRGK-VGELLSAP
GLMM_SYNY3      -----------MVASPIHSRGLDLPLPSTMGEFGLSLPRSPLFGTDGIRGK-AGELLTAP
GLMM_THEEB      ------------------MLVWREESTMTG-------QQPIRFGTDGIRGR-AGELLTPN
GLMM_SYNP6      ------------MCGMVSATRWETAIEVTPWIAAIA-EQVPLFGTDGIRGR-VGEHLTAP
GLMM_PROMM      ----------------------MVFAALDPLGVPLG-TAQASFGTDGIRGR-VGTLLTPA
GLMM_SYNPX      ----------------------MVQRAVPSIGPSLG-SSAPGFGTDGIRGR-AGTELSPA
GLMM_PROMA      ----------------------MSTNTISHVGDLNDEQALSFFGTDGIRGK-SQTFLTNS
GLMM_PROMP      --------------------------------------MQSIFGTDGIRGI-FDKELTYS
GLMM_PROM5      --------------------------------------MQSIFGTDGIRGR-FDKEITYS
GLMM_PROMS      --------------------------------------MQSIFGTDGIRGR-FNEELTYS
GLMM_PROM9      --------------------------------------MQSIFGTDGIRGR-FNEEITYS
                                                          * ***:*.          

GLMM_BACAN      LAFKIGRFGGYVLT-----KDT----DRPKVIIGRDTRISGHMLEGALVAGLLSTGAEVM
GLMM_BACCZ      LAFKIGRFGGYVLT-----KDT----DRPKVIIGRDTRISGHMLEGALVAGLLSTGAEVM
GLMM_BACHK      LAFKIGRFGGYVLT-----KDT----DRPKVIIGRDTRISGHMLEGALVAGLLSTGAEVM
GLMM_BACC1      LAFKIGRFGGYVLT-----KDT----DRPKVIIGRDTRISGHMLEGALVAGLLSTGAEVM
GLMM_BACCR      LAFKIGRFGGYVLT-----KDT----DRPKVIIGRDTRVSGHMLEGALVAGLLSTGAEVM
GLMM_BACLD      LAFKVGRFGGYVLT-----KDK----ERPKVLIGRDTRISGHMLEGALVAGLLSIGAEVM
GLMM_BACSU      LAFKVGRFGGYVLT-----KDK----QRPKVLIGRDTRISGHMLEGALVAGLLSIGAEVM
GLMM_GEOKA      LAFQIGRCGGYVLT-----KSA----ERPKVLIGRDTRISGHMLEGALVAGLLSIGAEVM
GLMM_BACHD      LAFKLGRIGGYVLT-----KDK----ENPKVLIGRDTRISGEMLEGALVAGLLSIGVEVM
GLMM_BACSK      LAFKLGRAGGYVLT-----KEA----AQPKVLIGRDTRISGEMLEASLVAGLLSIGAEVM
GLMM_LISMF      LAFRLGRMGGYVLT-----RHVG---EHPRVLVARDTRISGEMLESALIAGLVSVGIEVM
GLMM_LISMO      LAFRLGRMGGYVLT-----RHVG---EHPRVLVARDTRISGEMLESALIAGLVSVGIEVM
GLMM_LISIN      LAFRLGRMGGYVLT-----RHVG---EHPRVLVARDTRISGEMLESALIAGLVSVGIEVM
GLMM_OCEIH      LAFKLGRFGGYVLT-----KDS----ERPRILIGRDTRVSGHMLEGALLAGLLSIGAEVM
GLMM_STAAC      LAFKLGRYGGYVLA-----HNKGE--KHPRVLVGRDTRVSGEMLESALIAGLISIGAEVM
GLMM_STAA8      LAFKLGRYGGYVLA-----HNKGE--KHPRVLVGRDTRVSGEMLESALIAGLISIGAEVM
GLMM_STAAM      LAFKLGRYGGYVLA-----HNKGE--KHPRVLVGRDTRVSGEMLESALIAGLISIGAEVM
GLMM_STAAN      LAFKLGRYGGYVLA-----HNKGE--KHPRVLVGRDTRVSGEMLESALIAGLISIGAEVM
GLMM_STAAW      LAFKLGRYGGYVLA-----HNKGE--KHPRVLVGRDTRVSGEMLESALIAGLISIGAEVM
GLMM_STAAR      LAFKLGRYGGYVLA-----HNKGE--KHPRVLVGRDTRVSGEMLESALIAGLISIGAEVM
GLMM_STAAS      LAFKLGRYGGYVLA-----HNKGE--KHPRVLVGRDTRVSGEMLESALIAGLISIGAEVM
GLMM_STAEQ      LAFKLGRYGGYVLA-----HNKGE--KHPRVLVGRDTRVSGEMLESALIAGLISIGAEVM
GLMM_STAES      LAFKLGRYGGYVLA-----HNKGE--KHPRVLVGRDTRVSGEMLESALIAGLISIGAEVM
GLMM_STAS1      LAFKLGRYGGYVLA-----HNEGE--KHPKVLVGRDTRVSGEMLESALIAGLISIGAEVM
GLMM_STAHJ      LAFKLGRYGGYVLA-----HNEGA--DRPKVLVGRDTRVSGEMLESALISGLASIGAEVM
GLMM_LACAC      MAFKLGRDGGYVLT-----KNKKD-GEQAKVLVSRDTRISGQMLEYALISGLLSVGIEVL
GLMM_LACJO      MAFKLGRDGGYVLT-----KDKKD-GERAKVLVSRDTRISGQMLEYALISGLLSVGIEVL
GLMM_LACPL      MAFRLGRAGGYVLT-----EHAENKSTQPRVLVARDTRISGQMLEEALIAGLLSAGIEVL
GLMM_STRA3      LAFKLGRFGGYVLS-----QHETD---RPRVFVARDTRISGEMLESALIAGLLSVGIEVY
GLMM_STRA5      LAFKLGRFGGYVLS-----QHETD---RPRVFVARDTRISGEMLESALIAGLLSVGIEVY
GLMM_STRA1      LAFKLGRFGGYVLS-----QHETD---RPRVFVARDTRISGEMLESALIAGLLSVGIEVY
GLMM_STRT1      LAFKLGRFGGYVLS-----QHETG---RPKVFVARDTRISGEMLESALVAGLLSVGIEVY
GLMM_STRT2      LAFKLGRFGGYVLS-----QHETG---RPKVFVARDTRISGEMLESALVAGLLSVGIEVY
GLMM_STRP1      LAFKLGRFGGYVLS-----QHETE---RPKVFVARDTRISGEMLESALIAGLLSVGIEVY
GLMM_STRP3      LAFQLGRFGGYVLS-----QHETE---RPKVFVARDTRISGEMLESALIAGLLSVGIEVY
GLMM_STRP6      LAFKLGRFGGYVLS-----QHETE---RPKVFVARDTRISGEMLESALIAGLLSVGIEVY
GLMM_STRPM      LAFKLGRFGGYVLS-----QHETE---RPKVFVARDTRISGEMLESALIAGLLSVGIEVY
GLMM_STRP8      LAFKLGRFGGYVLS-----QHETE---RPKVFVARDTRISGEMLESALIAGLLSVGIEVY
GLMM_STRMU      LAFKLGRFGGYVLS-----QHEPD---RPRVFVARDTRISGELLESALVAGLLSVGIEVY
GLMM_STRPN      LAFKLGRFGGYVLS-----QHETE---APKVFVGRDTRISGEMLESALVAGLLSVGIHVY
GLMM_STRR6      LAFKLGRFGGYVLS-----QHETE---APKVFVGRDTRISGEMLESALVAGLLSVGIHVY
GLMM_LACLA      MAFKLGRFGGYVLS-----QHELG---TPKVYVGRDTRISGQMLASSLISGLLSVGIEVY
GLMM_CLOAB      LAYRLGRAGAYVLT-----NETHK----PKILVGMDTRISGDMLEAALVSGILSVGAEAV
GLMM_CLOTE      VAYNLGKAGAYVLT-----EGTHK----PKIVVGMDTRISGHMLESALVAGILSMGGEAI
GLMM_CLOPE      LAYNLGRAGAYVLT-----EGTHK----PKILVAKDTRISGDMLEAALVAGILSVGAEAV
GLMM_CALS4      LAFELGRAGAYVLT-----EGSHR----PKVVVGKDSRISSDMLECALIAGLTSLGAEVV
GLMM_FUSNN      KALRLGYALGYYLK-----NNNPN-EEKIKVIMGSDTRISGYMLRSALTAGLTSMGIYID
GLMM_COREF      LALKLGAAAAHVLT-----AGTRPHGRRPVAIVGRDPRVSGEMLAAALAAGMASRGVDVL
GLMM_CORGL      LALKLGAAAAHVLT-----AEKRVDGRRPVAIVGRDPRVSGEMLAAALSAGMASQGVDVI
GLMM_CORDI      LALKLGAAAAEVLT-----KDNRSTSRRPVAVVGRDPRVSGEMLAAALSAGMASRGVDVL
GLMM_CORJK      LAMKLGAAAARVLV-----SKEEVGGRRPTAVVGRDPRVSGEMLTAALSAGMASQGVDVL
GLMM_MYCBO      LALALGAAAARRLS-----RSGA--PGRRVAVLGRDPRASGEMLEAAVIAGLTSEGVDAL
GLMM_MYCTU      LALALGAAAARRLS-----RSGA--PGRRVAVLGRDPRASGEMLEAAVIAGLTSEGVDAL
GLMM_MYCLE      LVLALGAAAARCLA-----NSGE--PGRRVAVIGRDPRASGEMLEAAVIAGLTSAGVDAL
GLMM_MYCPA      LALALGAAAARQLA-----SGSA--PGRRVAVIGRDPRASGEMLEAAVIAGLTSQGVDAL
GLMM_NOCFA      LALRVSGAAAQVLG-----RG----KTRALALVGRDPRASGEMLEAAVTAGLTAAGVNVL
GLMM_STRAW      LALGLSVAAAHVLA-----EAGTFEGHRPVAVVGRDPRASGEFLEAAVVAGLASAGVDVL
GLMM_STRCO      LALGLSVAAAHVLA-----EAGTFAGHRATAVVGRDPRASGEFLEAAVVAGLASAGVDVL
GLMM_THEFY      LTLELAIAAAEVLP-----ERG-IPGKRPRAVVGRDPRASGEFLEAAVVAGLASAGVDVI
GLMM_LEIXX      LALGLAQAAAAVLTRGRSAEARRAVGKRPLAIVARDPRVSGEFLSAAVAAGLASSGIDVY
GLMM_CUTAK      LALDLSVAAAHVLG-----EAGAFGHRQPTALVARDPRASGEFLEAAVCAGLASAGVDVL
GLMM_BIFLO      LALDLGDAAVRVLG--DAGTQDDQPEGRRRALVGRDTRVSGDFLASALSAGMAAGGFDVI
GLMM_TROW8      LAMAVARAAAVVFTHGRVAKRRQVLGKRPVAIVARDPRISGDFLVAAISAGLASSGVDVL
GLMM_TROWT      LAMAVARAAAVVFTHGRVAKRRQVLGKRPVAIVARDPRISGDFLVAAISAGLASSGVDVL
GLMM_SYMTH      LAFALGRAAATLAR--------ERSGGRVVGVIGRDTRRSGPMLAAALSAGICSAGGDVV
GLMM_THET2      FVLKLGQAAGAYFRTQEKRP---------VVLLAKDTRESSDLLEAALAAGLMSQGVRVE
GLMM_THET8      FVLKLGQAAGAYFLAQEKRP---------VVLLAKDTRESSDLLEAALAAGLMSQGVRVE
GLMM_DEIRA      WVMALGAAAGEVFKRRNPRA---------SVVIGKDTRQSGDMLEAALAAGLTSRGVNVV
GLMM_AGRFC      LAMRVGIAVGTIFRRGHHR---------HRVVIGKDTRLSGYMLENALVAGFTAAGLDVF
GLMM_RHIME      LAMRVGIAVGTIFRNGAHR---------HRVVIGKDTRLSGYMLENAMVAGFTAAGLDVF
GLMM_BRUME      IAMKVGMAVGYIFRRKGQA---------SRAVIGKDTRRSGYMLENALVAGFTAAGMDVF
GLMM_BRUSU      IAMKVGMAVGYIFRRKGQA---------SRVVIGKDTRRSGYMLENALVAGFTAAGMDVF
GLMM_RHILO      IAMRVGMAAGLSFQRGSHR---------HRVVLGKDTRLSGYMIENAMVAGLCAAGMDVF
GLMM_BARHE      FAMKVGMAVGILFRSQNQS---------RRVVIGKDTRLSGYMLENALVSGFTAAGMEAF
GLMM_BARQU      FAMKVGMAVGVLFRSQRQS---------RRVVIGKDTRLSGYMLENALVSGFTAAGMEAF
GLMM_BRADU      LALKVGQAAGLAFQRGDHR---------HRVVIGKDTRLSGYMIEYAMVAGFTSVGMDVL
GLMM_NITWN      LAMKVGQAAGLVFQRGEHR---------HRVVIGKDTRLSGYMIEYALVAGFTSVGMDVL
GLMM_RHOPA      LALKVGQAAGLAFQRGEHR---------HRVVIGKDTRLSGYMIENALVAGFTSVGMDVL
GLMM_CAUVC      VALRVGLAAGKLFRSQDERR--------HLVVIGKDTRLSGYMIEPALVAGLTSVGLDVR
GLMM_GLUOX      IAQRLGQAAGLYFMRSQNRR--------HSVVLGKDTRLSGYMLECALVAGFLSAGMDVI
GLMM_ZYMMO      VAMRVGQAAGAYFKRGLHR---------HRVLIGKDTRLSGYMVESALMAGFTSVGMDVV
GLMM_RUEPO      MALRIGAAVGRYFRREAGGV--------HRVVIGKDTRLSGYMFENALTAGLASTGMNVL
GLMM_CAMJE      LAMRLAMAAGIYFKDKSITN--------NI-LVGKDTRRSGYMIENAIVSGLTSIGYNVI
GLMM_CAMJR      LAMRLAMAAGIYFKDKSITN--------NI-LVGKDTRRSGYMIENAIVSGLTSIGYNVI
GLMM_HELPJ      FVMRLGIAAGLYFKKHSQTN--------KI-LIGKDTRKSGYMVENALVSALTSIGYNVI
GLMM_HELPY      FVMRLGIAAGLYFKKHSQTN--------KI-LIGKDTRKSGYMVENALVSALTSIGYNVI
GLMM_HELHP      SVIALGTSAGIHFRQHSLTN--------KI-LVGKDTRRSGYMIENALVSALTSVGYDVI
GLMM_WOLSU      SAMKLGLAAGIYFRKQSKTN--------KI-LVGKDTRRSGYMIENALVSGLTAVGYNVI
GLMM_PELUB      MFFKFGLATGTYFKTQKKKK--------QIAIIAKDTRLSGYSLEPALVSGLTSAGMHVY
GLMM_ANAMM      TVLRLGMAIGLEARKVGTQ-----------VVLGKDTRISGYMVESALVSGLVAMGVNVG
GLMM_DESPS      IAMQVGRAIAFLVKKENYR---------HRIVIGKDTRLSGYMIENAIVAGICSMGVDVL
GLMM_GEOSL      MAMQIGRAAAYLFKDGNRR---------HRIVIGKDTRLSGYMLENALVAGICSMGVDVL
GLMM_DESVH      MALRLGLAAGTRFRNGNRR---------HRVVIGKDTRLSGYMFESALTAGLCAAGMDVF
GLMM_BDEBA      MVVKIGQAIGYLLRKEAEEKSSSV----RKVVIGKDTRLSGYMIEQALASGLNSMGVFVQ
GLMM_CHLAB      LSVLLGKAVAGVLQESKSGK--------HRVVVGKDTRLSGYMFENALVAGLTSMGIETL
GLMM_CHLCV      LSVLLGKAVAGVLQERKPGK--------HRVVVGKDTRLSGYMFENALVAGLTSMGIETL
GLMM_CHLPN      TTVLLGKAVARVLREGRSGK--------HRVVVGKDTRLSGYMFENALIAGLNSMGIETL
GLMM_CHLMU      TSVLLGKAVAGVLLERHSGK--------HRVVVGKDTRLSGYMFENALIAGLTSMGIETL
GLMM_CHLTR      TSVLLGKAIAGVLLEKHAGK--------HRVVVGKDTRLSGYMFENALIAGLTSMGIETL
GLMM_PARUW      IALALGRAAGQLL--SRLGK--------SRVVIGKDTRLSCYVFENALIAGLCSMGVDTL
GLMM_LEGPA      FVLKLGWAVGCVLANGARKK----------VVIGKDTRVSGYMLESALEAGLSAAGVDVA
GLMM_LEGPH      FVLKLGWAVGCVLANGARKK----------VVIGKDTRVSGYMLESALEAGLSAAGVDVA
GLMM_LEGPL      FVLKLGWAVGCVLANGARKK----------VVIGKDTRVSGYMLESALEAGLSAAGVDVA
GLMM_COXBU      FMLKLGWAVGRVLANSHSAT----------VLIGKDTRISGYMIESALQAGLSAAGVNIK
GLMM_AROAE      FVMRLGYAAGVTLVGREQLPPGE----RPAILIGKDTRISGYMLEAALEAGFAAAGVDVM
GLMM_DECAR      FVMRLGYSAGKALLGRSEMPAGD----RPAVLIGKDTRLSGYMLESALEAGFSAAGVEVC
GLMM_BORBR      FALRLGYAAGRVLAREHREHASGRGRNRPQVVIGKDTRISGYMLESALEAGLSAAGIDVL
GLMM_BORPA      FALRLGYAAGRVLAREHREHASGRGRNRPQVVIGKDTRISGYMLESALEAGLSAAGIDVL
GLMM_BORPE      FALRLGYAAGRVLAREHREHASGRGRNRPQVVIGKDTRISGYMLESALEAGLSAAGIDVL
GLMM_BURMA      FVLRLGYAAGKVLASAPGRAASGA---RPTVLIGKDTRVSGYMLEAALEAGFSAAGVDVM
GLMM_BURPS      FVLRLGYAAGKVLASAPGRAASGA---RPTVLIGKDTRVSGYMLEAALEAGFSAAGVDVM
GLMM_CUPPJ      FVMRLGHAAGKVLAHGA-STGQG----RPTVLIGKDTRISGYMLEAALEAGFTSAGVHVL
GLMM_RALSO      FVLRLGYAAGRVLAHGSEAHGHG----RPTVLIGKDTRLSGYMLEAALEAGFTAAGVDVL
GLMM_NEIG1      FVLKLGYAAGQVLVQHDTDQ-------KPTVLIGKDTRISGYMLEAALVAGFTAAGVNVV
GLMM_NEIMB      FVLKLGYAAGQVLVQHDTDQ-------KPTVLIGKDTRISGYMLEAALVAGFTAAGVNVV
GLMM_NEIMA      FVLKLGYAAGQVLVQHDTDQ-------KPTVLIGKDTRISGYMLEAALVAGFTAAGVNVV
GLMM_NEISU      FVLKLGYAAGQVLVQHDGGQ-------KPTVLIGKDTRISGYMLEAALVAGFTAAGVNVI
GLMM_CHRVO      FVMKLGYAAGRVLVNHDQDS-------RPTVLIGKDTRISGYMLEAALQAGFTAAGVNVL
GLMM_NITEU      FFLRLGYAVGKVLLASDRQLAADK---RPTVLIGKDTRISGYMLESALEAGFSAAGVDVL
GLMM_METCA      FMLKLGWAAGCVFAREMPGRR---------VLIGKDTRISGYMFESALEAGFSAAGVDTQ
GLMM_NITOC      FILHLGWAVGRVLAQGRQSK----------VLIGKDTRISGYMFESALQAGLSAAGVDIR
GLMM_PSE14      FMLKLGWAAGMAFRKMGACR----------ILVGKDTRISGYMFESALEAGLSAAGADVL
GLMM_PSESM      FMLKLGWAAGMAFRKMGACR----------ILVGKDTRISGYMFESALEAGLSAAGADVL
GLMM_PSEU2      FMLKLGWAAGMAFRKMGACR----------ILVGKDTRISGYMFESALEAGLSAAGADVL
GLMM_PSEF5      FMLKLGWAAGMAFRSMGACR----------VLVGKDTRISGYMFESALEAGLSAAGADVM
GLMM_PSEPK      FMLKLGWAAGMAFRKQGHCR----------VLVGKDTRISGYMFESALEAGLSAAGADVM
GLMM_PSEAE      FVLKLGWAVGMAFRRQGNCR----------VLIGKDTRSSGYMFESAFEAGLSASGADTL
GLMM_XANAC      FVLRLGNALGRVLTQGRSKRP--------LVLIGKDTRISGYMFEAALEAGLVAAGADVQ
GLMM_XANC5      FVLRLGNALGRVLTQGRSKRP--------LVLIGKDTRISGYMFEAALEAGLVAAGADVQ
GLMM_XANOR      FVLRLGNALGRVLTQIRGKRP--------LVLIGKDTRISGYMFEAALEAGLVAAGADVQ
GLMM_XANC8      FVLRLGNALGRVLTAGRSKRP--------LVLIGKDTRISGYMFEAALEAGLVAAGADVQ
GLMM_XANCP      FVLRLGNALGRVLTAGRSKRP--------LVLIGKDTRISGYMFEAALEAGLVAAGADVQ
GLMM_XYLFA      FVLRLGNALGRVLAQGRDTRP--------MVLIGKDTRISGYMFESALEAGLVAAGADVQ
GLMM_XYLFT      FVLRLGNALGRVLAQGRDTRP--------MVLIGKDTRISGYMFESALEAGLVAAGADVQ
GLMM_ECOL6      FVLKLGWAAGKVLARHGSRK----------IIIGKDTRISGYMLESALEAGLAAAGLSAL
GLMM_SHISS      FVLKLGWAAGKVLARHGSRK----------IIIGKDTRISGYMLESALEAGLAAAGLSAL
GLMM_ECO57      FVLKLGWAAGKVLARHGSRK----------IIIGKDTRISGYMLESALEAGLAAAGLSAL
GLMM_ECOLI      FVLKLGWAAGKVLARHGSRK----------IIIGKDTRISGYMLESALEAGLAAAGLSAL
GLMM_SHIFL      FVLKLGWAAGKVLARHGSRK----------IIIGKDTRISGYMLESALEAGLAAAGLSAL
GLMM_SALTI      FVLKLGWAAGKVLARHGSRK----------IIIGKDTRISGYMLESALEAGLAAAGLSAS
GLMM_SALTY      FVLKLGWAAGKVLARHGSRK----------IIIGKDTRISGYMLESALEAGLAAAGLSAS
GLMM_SALCH      FVLKLGWAAGKVLARHGSRK----------IIIGKDTRISGYMLESALEAGLAAAGLSAS
GLMM_SALPA      FVLKLGWAAGKVLARHGSRK----------IIIGKDTRISGYMLESALEAGLAAAGLSAS
GLMM_YERPE      FVLKLGWAAGKVLARHGSRK----------IIIGKDTRISGYMLESALEAGLAAAGLSAL
GLMM_YERPS      FVLKLGWAAGKVLARHGSRK----------IIIGKDTRISGYMLESALEAGLAAAGLSAL
GLMM_PECAS      FVLKLGWAAGKVLARHGSRK----------IIIGKDTRISGYMLESALEAGLAAAGLSAS
GLMM_PHOLL      FVLKLGWAAGKVLARHGSRK----------IIIGKDTRISGYMLESSLEAGLAAAGLSAS
GLMM_PHOPR      FVLKLGWAAGRVLSQQGTKK----------VLIGKDTRISGYMLESALEAGLAAAGLQ-Q
GLMM_ALIF1      FVMKLGWAAGQVLAKQGTKK----------VIIGKDTRISGYMLESALEAGLAAAGLQAK
GLMM_VIBVU      FVLKLGWAAGRVLAKQGTKK----------VIIGKDTRISGYMLESALEAGLAAAGLKAT
GLMM_VIBVY      FVLKLGWAAGRVLAKQGTKK----------VIIGKDTRISGYMLESALEAGLAAAGLKAT
GLMM_VIBPA      FVLKLGWAAGRVLAKQGTKK----------VIIGKDTRISGYMLESALEAGLAAAGLKAT
GLMM_VIBCH      FVLKLGWAAGRVLAKQGTRK----------VIIGKDTRISGYMLESALEAGLAAAGLKAT
GLMM_HAEI8      FALKLGWAAGKVLASQGSKM----------VLIGKDTRISGYMLESALEAGLAAAGLSAA
GLMM_HAEIN      FALKLGWAAGKVLASQGSKM----------VLIGKDTRISGYMLESALEAGLAAAGLSAA
GLMM_MANSM      FALKLGWAAGKVLASQGSRQ----------VLIGKDTRISGYMLESALEAGLAAAGLSAA
GLMM_PASMU      FALKLGWAAGKVLATQGSRT----------VLIGKDTRISGYMLESALEAGLAAAGLSAA
GLMM_HAEDU      FALKLGWAAGKILATQGTKQ----------VLIGKDTRISGYMLESALEAGLAAAGLSAA
GLMM_IDILO      FAVKLGWAAGRVLAAKGTSR----------VLVGKDTRVSGYMLESALEAGLAAAGVGVD
GLMM_COLP3      FVMKLGYAAGKVLAGQGTKK----------VLIGKDTRISGYMLESALEAGFSAAGIDVG
GLMM_SHEON      LALKLGWAAGRVLSRSGTKK----------VIIGKDTRISGYMFESALEAGLSAAGLNVM
GLMM_PSEHT      FAMKLGWAAGRVLSENGTKK----------VMIGKDTRISGYMLETALQAGLIAAGIDVV
GLMM_BLOFL      FILKLGWAAGKVLSNYGSGRSKQ-------VIIGKDTRISGYMLESALEAGLAASGLSAA
GLMM_BLOPB      FILKLGWAAGKVLSRFSGGRSNY-------IIIGKDTRISGYMLESALESGLAAAGLSAA
GLMM_BUCAI      FLLKLGWSIGIVLGK---NKTQK-------IIIGRDTRISGTMLQSILEFGILSTGVSTL
GLMM_BUCBP      FFFKLGAVIGKILYF---YDVKK-------IIIGRDTRLSSYMLEEALQFGLSLVGVSVI
GLMM_WIGBR      FFFKLGFVIGNLLYKE--NSFNK-------VLIGNDTRQSGFILESTLAYGLSCSGLSSL
GLMM_ACIAD      FALKLGFAAGKVLKRTS--PINKP-----IVVLGKDTRLSGYILESALQAGLNAAGVYVH
GLMM_PSYA2      FILKLGYVTGLVLIENSQNSARKP-----SVVIGKDTRLSGYVIEGALQAGFNAAGVDVH
GLMM_FRATT      FTQKLGNAVGSLINQKNYPKF---------VIVGQDTRSSGGFLKFALVSGLNAAGIDVL
GLMM_THEMA      LAFKVGKALGEIVGEG-------------KVIVGKDTRVSGDSLEAAISAGLTSMGVDVL
GLMM_NOSS1      LALQIGFWAGVVLRNHADQ--------LGPVILGQDSRNSSDMLAMALSAGLTAAGLEVW
GLMM_SYNY3      LALSLGFWAGQVLREQTDT--------AGPVIIGQDSRLSSDMLANAMAAGLNSAGVEVW
GLMM_THEEB      LALSLGYWVGEVLRQTTDAP-------QRPFIIGQDSRNSSDMLATALAAGLTAAGFEVW
GLMM_SYNP6      LAQQVGFWTGQVLRQAGGD--------RGPVVVGQDSRNSSNMLAMALSSGLAAAGVEVL
GLMM_PROMM      FILQVGYWCGQVLPD------------QGPVLIGMDSRSSGAMVASALTAGLTAAGREVW
GLMM_SYNPX      LCLQVGYWIGRVLKA------------DGPVLIGMDSRSSGSMLVAALTAGLTAAGRDVW
GLMM_PROMA      LVSQIGYWCNHVLLG------------EGPILIGQDSRASSERIASALAHGLATKNREIW
GLMM_PROMP      LAYKVGYALGVSTKT------------NNPILIGRDTRVSGYILIEAISRGINAAGKEFI
GLMM_PROM5      LAYKVGYALGFIVKT------------NNPILIGRDTRISGEILFEAISKGIKDAGKEFI
GLMM_PROMS      LAYKVGYALGSTLKK------------KSPILIGRDTRISGDILLQAITQGINESGKKFI
GLMM_PROM9      LAYKVGYALGSNLEN------------NNPILIGRDTRISGDILLHAITKGINASGKKFI
                    ..                          :. *.* *   .   .  .:   .    

GLMM_BACAN      RLGVISTPGVAYLTKALDAQAGVMISASHNPVQDNGIKFFGSDGFKLTDEQEAEIEAL--
GLMM_BACCZ      RLGVISTPGVAYLTKALDAQAGVMISASHNPVQDNGIKFFGSDGFKLTDEQEAEIEAL--
GLMM_BACHK      RLGVISTPGVAYLTKALDAQAGVMISASHNPVQDNGIKFFGSDGFKLTDEQEAEIEAL--
GLMM_BACC1      RLGVISTPGVAYLTKALDAQAGVMISASHNPVQDNGIKFFGSDGFKLTDEQEAEIEAL--
GLMM_BACCR      RLGVISTPGVAYLTKALDAQAGVMISASHNPVQDNGIKFFGSDGFKLTDEQEAEIEAL--
GLMM_BACLD      RLGVISTPGVAYLTKAMDAEAGVMISASHNPVQDNGIKFFGGDGFKLSDEQELEIERL--
GLMM_BACSU      RLGVISTPGVSYLTKAMDAEAGVMISASHNPVQDNGIKFFGGDGFKLSDEQEAEIERL--
GLMM_GEOKA      RLGVISTPGVAYLTKALGAQAGIMISASHNPVQDNGIKFFGPDGFKLSDEQEAEIEAL--
GLMM_BACHD      RLGVISTPGVAFLTKAVSASAGVMISASHNPVADNGIKFFGPDGFKLLDEQEKEIETL--
GLMM_BACSK      RLGVISTPGVAFLTKQLSATAGIMISASHNPVEDNGIKFFGSDGFKLLDSQEEEIEAL--
GLMM_LISMF      RLGVISTPGVAYLTKAQGASASVMISASHNPVDDNGIKFFGSDGFKLSDDQEEEIEQL--
GLMM_LISMO      RLGVISTPGVAYLTKAQGASASVMISASHNPVDDNGIKFFGSDGFKLSDDQEEEIEQL--
GLMM_LISIN      RLGVISTPGVAYLTKAQGASASVMISASHNPVDDNGIKFFGSDGFKLSDDQEEEIEQL--
GLMM_OCEIH      RLGVISTPGVAYLTKATSAQAGVMISASHNPVEDNGIKFFGPDGFKLTDAQENEIESL--
GLMM_STAAC      RLGIISTPGVAYLTRDMGAELGVMISASHNPVADNGIKFFGSDGFKLSDEQENEIEAL--
GLMM_STAA8      RLGIISTPGVAYLTRDMGAELGVMISASHNPVADNGIKFFGSDGFKLSDEQENEIEAL--
GLMM_STAAM      RLGIISTPGVAYLTRDMGAELGVMISASHNPVADNGIKFFGSDGFKLSDEQENEIEAL--
GLMM_STAAN      RLGIISTPGVAYLTRDMGAELGVMISASHNPVADNGIKFFGSDGFKLSDEQENEIEAL--
GLMM_STAAW      RLGIISTPGVAYLTRDMGAELGVMISASHNPVADNGIKFFGSDGFKLSDEQENEIEAL--
GLMM_STAAR      RLGIISTPGVAYLTRDMGAELGVMISASHNPVADNGIKFFGSDGFKLSDEQENEIEAL--
GLMM_STAAS      RLGIISTPGVAYLTRDMGAELGVMISASHNPVADNGIKFFGSDGFKLSDEQENEIEAL--
GLMM_STAEQ      RLGVISTPGVAYLTKEMEAALGVMISASHNPVADNGIKFFGSDGFKLSDDQENEIEQL--
GLMM_STAES      RLGVISTPGVAYLTKEMEAALGVMISASHNPVADNGIKFFGSDGFKLSDDQENEIEQL--
GLMM_STAS1      RLGVISTPGVAYLTREMEADLGVMISASHNPVPDNGIKFFGSDGFKLSDDQEQEIEHL--
GLMM_STAHJ      RLGVISTPGVAYLTREMGAELGVMISASHNPVADNGIKFFGADGFKLSDAQEEEIETL--
GLMM_LACAC      EVGVITTPGLSYLVRAQGADAGIQISASHNPVEDNGIKFFGSDGLKLSDEMEGEIEKL--
GLMM_LACJO      EVGVITTPGLSYLVRAQGADAGVQISASHNPVEDNGIKFFGSDGLKLSDAKEEEIEKL--
GLMM_LACPL      RLGVITTPGVAYLVRIQDADAGVMISASHNPVEDNGIKFFGGDGFKLSDAKEEEIEEL--
GLMM_STRA3      KLGVLATPGVSYLVRTEKASAGVMISASHNPALDNGIKFFGSDGFKLDDDRELEIEAL--
GLMM_STRA5      KLGVLATPGVSYLVRTEKASAGVMISASHNPALDNGIKFFGSDGFKLDDDRELEIEAL--
GLMM_STRA1      KLGVLATPGVSYLVRTEKASAGVMISASHNPALDNGIKFFGSDGFKLDDDRELEIEAL--
GLMM_STRT1      KLGVLATPGVSYLVRTENASAGVMISASHNPALDNGIKFFGGDGFKLDDAREAEIEAL--
GLMM_STRT2      KLGVLATPGVSYLVRTENASAGVMISASHNPALDNGIKFFGGDGFKLDDAREAEIEAL--
GLMM_STRP1      KLGVLATPGVSYLVRTEKASAGVMISASHNPALDNGIKFFGNDGFKLADDQELEIEAL--
GLMM_STRP3      KLGVLATPGVSYLVRTEKASAGVMISASHNPALDNGIKFFGNDGFKLADDQELEIEAL--
GLMM_STRP6      KLGVLATPGVSYLVRTEKASAGVMISASHNPALDNGIKFFGNDGFKLADDQELEIEAL--
GLMM_STRPM      KLGVLATPGVSYLVRTEKASAGVMISASHNPALDNGIKFFGNDGFKLADDQELEIEAL--
GLMM_STRP8      KLGVLATPGVSYLVRTEKASAGVMISASHNPALDNGIKFFGNDGFKLADDQELEIEAL--
GLMM_STRMU      KLGVLATPGVSYLVRTEQASAGVMISASHNPALDNGIKFFGGDGFKLADEQEAEIEAL--
GLMM_STRPN      KLGVLATPAVAYLVETEGASAGVMISASHNPALDNGIKFFGGDGFKLDDEKEAEIEAL--
GLMM_STRR6      KLGVLATPAVAYLVETEGASAGVMISASHNPALDNGIKFFGGDGFKLDDEKEAEIEAL--
GLMM_LACLA      DLGVIATPGVAYLVKKDGASAGVMISASHNPALDNGIKFFGGDGYKLEDEKELEIEAL--
GLMM_CLOAB      CVGIVPTPAVAYLTRKYKADAGVVISASHNPVEYNGIKFFDAKGYKLSDNLEDEIQKI--
GLMM_CLOTE      CLGIVPTPAVAHLTRKYGADAGVVISASHNPVEYNGIKFFDKGGYKLPDELEDRIQSV--
GLMM_CLOPE      CLGVVPTPAVAHLTRVYGADAGVMISASHNPVEYNGIKFFDDKGYKLSDDLEDEIQRV--
GLMM_CALS4      SVGIIPTPAVAYLTRLYKADAGVMISASHNPIEYNGIKFFDKFGYKLPDKLEDRIEEI--
GLMM_FUSNN      FVGVIPTPGVAYITKQKKAKAGIMISASHNPAKDNGIKIFNLEGYKLSDEIENQIEDY--
GLMM_COREF      RVGVIPTPGVAFLTDDYGADMGVMISASHNPMPDNGIKFFSAGGHKLPDEVEDEIERV-M
GLMM_CORGL      RVGVIPTPAVAFLTDDYGADMGVMISASHNPMPDNGIKFFSAGGHKLPDHVEDEIERV-M
GLMM_CORDI      RVGVLPTPAVAYLTDFYGADMGVVISASHNPMPDNGIKFFSKGGHKLPDSVEDEIEKV-M
GLMM_CORJK      DVGVIPTPAVAFLTDDFGADMGVMISASHNPMPDNGIKFFAAGGRKLQDDVEDEIEAT-M
GLMM_MYCBO      RVGVLPTPAVAYLTGAYDADFGVMISASHNPMPDNGIKIFGPGGHKLDDDTEDQIEDL-V
GLMM_MYCTU      RVGVLPTPAVAYLTGAYDADFGVMISASHNPMPDNGIKIFGPGGHKLDDDTEDQIEDL-V
GLMM_MYCLE      RVGVLPTPAVAYLTGAYDADFGVMISASHNPMVDNGIKIFGPGGHKLDDDTEDQIEDL-V
GLMM_MYCPA      RVGVLPTPAVAYLTGAYDADFGVMISASHNPMPDNGIKIFGPGGHKLDDGTEDRIEAL-V
GLMM_NOCFA      SVGVLPTPAVAYLTGLYDACLGVMISASHNPMPDNGIKIFAAGGHKLDDAVEDRIEAL-V
GLMM_STRAW      LVGVLPTPAVAHLTGALGADLGVMLSASHNAMPDNGIKFFARGGHKLADDLEDRIEAVYE
GLMM_STRCO      RVGVLPTPAVAHLTGALGADLGVMLSASHNAMPDNGIKFFARGGHKLADELEDRIESVYA
GLMM_THEFY      RLGVLPTPAVAFLTGELDADFGVMLSASHNPAPDNGIKFFARGGHKLSDEVEDEIE----
GLMM_LEIXX      DAGVIPTPAAAFLIADFDADFGVMVSASHNPAPDNGIKIFARGGTKLPDVVEDRIE----
GLMM_CUTAK      RVGVIPTPAAAYLVNEYRTDLGVMLSASHNPMPDNGIKFFSRGGVKLPDDLEDAIE----
GLMM_BIFLO      DAGIIPTPGIAFLTSVLNVEMGAVISASHNPMPDNGIKFFARGGFKLPDQKEDDIEAV--
GLMM_TROW8      DAGVIPTPAVAFLVKNANADFGFMISASHNPGYDNGVKIFAHGGVKLPDVVEDRIEYF--
GLMM_TROWT      DAGVIPTPAVAFLVKNANADFGFMISASHNPGYDNGVKIFAHGGVKLPDVVEDRIEYF--
GLMM_SYMTH      DLGVITTPGVAYVTTHLKADFGVMISASHNPAPDNGIKFFSGDGYKLPDEVEDQLEAL--
GLMM_THET2      HLGVLPTPGVAHLTKALKATAGAVISASHNPYQDNGIKFFGPTGEKLPDEAEEEIERLL-
GLMM_THET8      HLGVLPTPGVAHLTKALKATAGAVISASHNPYQDNGIKFFGPTGEKLPDGAEEEIERLL-
GLMM_DEIRA      HLGVLPTPGVSYLTRHLGAEAGVVISASHNPYEDNGIKFFGPGGGKLSDATELEIEAAID
GLMM_AGRFC      LLGPIPTPAVAMLTRSLRADIGVMISASHNPFSDNGIKLFGPDGYKLSDELELEIEDLLD
GLMM_RHIME      LLGPIPTPGVAMLTRSLRADIGVMISASHNAFRDNGIKLFGPDGYKLSDDIEQKIEDLLE
GLMM_BRUME      LLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFKLSDQIELQIEAMIE
GLMM_BRUSU      LLGPIPTPAVAMLCRSLRADIGVMISASHNPFYDNGIKLFGPDGFKLSDQIELQIEAMIE
GLMM_RHILO      LLGPIPTPAVAMLVRSLRADIGVMISASHNPYYDNGIKLFGPDGYKLSDEIEERIESMLD
GLMM_BARHE      LLGPVPTPAVAMLCRSLRADLGVMISASHNPFYDNGIKLFGPDGFKLSDEIEEKIEQLID
GLMM_BARQU      LLGPVPTPAVAMLCRSLRADLGVMISASHNPFYDNGIKLFGPDGFKLSDEIEKKIEQLID
GLMM_BRADU      LVGPMPTPAVAMLTKSMRADLGVMISASHNLFEDNGIKLFGPQGFKLSDDVEKQIEQLLD
GLMM_NITWN      LLGPMPTPAVAMLTKSMRADLGVMISASHNLFEDNGIKMFGPRGFKLSDEVEKKIEKLLD
GLMM_RHOPA      LVGPMPTPAVAMLTKSMRADLGVMISASHNLFEDNGIKLFGPLGYKLSDDVEKQIELMLD
GLMM_CAUVC      LFGPLPTPAVAMMTRSMRADLGIMISASHNSFADNGIKLFGPDGYKLSDAQELGIEALMD
GLMM_GLUOX      LVGPLPTPAIAMLTRSLRADLGVMVSASHNPFTDNGIKLFGPDGFKLSDEVEGEIEDLMS
GLMM_ZYMMO      LVGPLPTPGVALLTRSMRADLGVMISASHNPFSDNGIKLFGPNGYKLSEEEEKAIEEAID
GLMM_RUEPO      LLGPVPTPAVGLMTRSMRADLGVMISASHNSAEDNGIKFFGPDGFKLSDQAEMEIEEMVA
GLMM_CAMJE      QIGPMPTPAIAFLTEDMRCDAGIMISASHNPYYDNGIKFFDAHGNKLSEDIEKKIEEIYF
GLMM_CAMJR      QIGPMPTPAIAFLTEDMRCDAGIMISASHNPYYDNGIKFFDAHGNKLSEDIEKKIEEIYF
GLMM_HELPJ      QIGPMPTPAIAFLTEDMRCDAGIMISASHNPFEDNGIKFFNSYGYKLKEEEERAIEEIFH
GLMM_HELPY      QIGPMPTPAIAFLTEDMRCDAGIMISASHNPFEDNGIKFFNSYGYKLKEEEEKAIEEIFH
GLMM_HELHP      QIGPMPTPAVAFLTEDMRCDAGIMISASHNPYDDNGIKFFNHYGYKLAQEEEESIESYYY
GLMM_WOLSU      QIGPMPTPAIAYLTEDMRCDAGIMISASHNPFDDNGIKFFNRFGFKLDEEAEREIEAIYA
GLMM_PELUB      TLGPLPTNGLAMLTKSMKANMGIMITASHNPYHDNGLKLFGPDGLKLSNKIEKKIETLI-
GLMM_ANAMM      LLGPMPTAAIATLVRNLRASMGVVISASHNSYLDNGVKIFDSEGIKIPLELEEVLESNVR
GLMM_DESPS      LVGPLPTPGIAFITTSMRADAGVVISASHNPFQDNGIKIFFSDGFKLPDAMELKIEDLVL
GLMM_GEOSL      VVGPLPTPGIANITSSMRADAGVVISASHNPFQDNGIKFFSRDGFKLPDEMELKIEDLIF
GLMM_DESVH      QVGPLPTPAISFLTRNMRADLGVVISASHNPFMDNGIKFFDRSGFKLPDDVENQMTDMVL
GLMM_BDEBA      LVGPLPTPGIGYLTRTMRAAAGIVISASHNPFHDNGIKVFGSDGFKISEEMEREIERLVL
GLMM_CHLAB      VLGPIPTPGVAFITRAYRADAGIMISASHNPYWDNGIKIFSSEGFKISDVIERRIEQMVA
GLMM_CHLCV      VLGPIPTPGVAFITRAYRADAGIMISASHNPYWDNGIKIFSSEGFKISDVIERRIEQMVA
GLMM_CHLPN      VLGPIPTPGVAFITRAYRADAGIMISASHNPYRDNGIKIFSLEGFKISDVLEQRIETMVS
GLMM_CHLMU      MLGPIPTPGVAFITRAYRADAGIMISASHNPYRDNGIKIFSSDGFKIGQAVEERIEAMIA
GLMM_CHLTR      MLGPIPTPGVAFITRAYRADAGIMISASHNPYRDNGIKIFSSDGFKIGQAVEERIEAMVA
GLMM_PARUW      MVGPLPTPGVAFITRAYRADAGIVISASHNPYYDNGIKLFDSQGFKLPDSWEAEMEAMIA
GLMM_LEGPA      LLGPMPTPGIAYLTQTLRANAGIVISASHNLFEDNGIKFFSADGGKLPDSVELAIEAQLE
GLMM_LEGPH      LLGPMPTPGIAYLTQTLRANAGIVISASHNLFEDNGIKFFSADGGKLPDSVELAIEAQLE
GLMM_LEGPL      LLGPMPTPGIAYLTQTLRANAGIVISASHNLFEDNGIKFFSADGGKLPDSVELAIEAQLE
GLMM_COXBU      LTGPMPTPAIAYLTHSVRADAGIVISASHNHYPDNGVKFFNKDGFKLSDELELAIEKQID
GLMM_AROAE      LAGPVPTPAVAYLTRALRLQAGVVISASHNPYDDNGIKFFSANGTKLPDALEEEIEFRVD
GLMM_DECAR      LVGPLPTPAVAYLTRALRLQAGIVISASHNPYYDNGIKFFSAQGTKLPDEVERAIEAGID
GLMM_BORBR      LAGPVPTPAVAYLTRTLRLAAGIVISASHNPYQDNGIKFFSAHGMKLPDDIEAAIEQALD
GLMM_BORPA      LAGPVPTPAVAYLTRTLRLAAGIVISASHNPYQDNGIKFFSAHGMKLPDDIEAAIEQALD
GLMM_BORPE      LAGPVPTPAVAYLTRTLRLAAGIVISASHNPYQDNGIKFFSAHGMKLPDDIEAAIEQAVD
GLMM_BURMA      LAGPMPTPGVAYLTRALRLSAGVVISASHNPYHDNGIKFFSADGNKLPDEIEAEIEAWLD
GLMM_BURPS      LAGPMPTPGVAYLTRALRLSAGVVISASHNPYHDNGIKFFSADGNKLPDEIEAEIEAWLD
GLMM_CUPPJ      LTGPLPTPGIAYLTRALRLSAGVVISASHNPYYDNGIKFFSADGDKLPDEVEAKIEAALE
GLMM_RALSO      MSGPLPTPGVAYLTRALRLSAGVVISASHNPYYDNGIKFFSATGDKLPDETESQIEAELE
GLMM_NEIG1      QTGPLPTPGVAYLTRALRLSAGVMISASHNTYSDNGIKFFAEGGVKLSDEVELEIEAKID
GLMM_NEIMB      QTGPLPTPGVAYLTRALRLSAGVMISASHNAYSDNGIKFFAEGGVKLSDEVELEIEAKID
GLMM_NEIMA      QTGPLPTPGVAYLTRALRLSAGVMISASHNAYSDNGIKFFAEGGVKLSDEIELEIEAKID
GLMM_NEISU      QTGPLPTPGVAYLTRALRLSAGVMISASHNVYSDNGIKFFAEGGVKLSDEIELEIEAKID
GLMM_CHRVO      LTGPLPTPGIAYLTRALRLEAGVVISASHNPFQDNGIKFFAEGGNKLDDALELEIEAMLD
GLMM_NITEU      LSGPLPTPAVAYLVRALRIQAGAVISASHNPFDDNGIKFFSSAGSKLPDSMELQIEAELD
GLMM_METCA      LLGPMPTPAVAYLTRTLRAQAGVVISASHNPYYDNGIKFFGPDGMKLPDELELLIEDYLG
GLMM_NITOC      LLGPMPTPAIAYLTRTLHAKAGIVISASHNPYYDNGIKFFSSAGTKLPDEIEVAIEAELE
GLMM_PSE14      LLGPMPTPAIAYLTRTFHAEAGIVISASHNPHYDNGIKFFSGQGTKLPDEIEMMIEELLD
GLMM_PSESM      LLGPMPTPAIAYLTRTFHAEAGIVISASHNPHYDNGIKFFSGQGTKLPDEIEMMIEELLD
GLMM_PSEU2      LLGPMPTPAIAYLTRTFHAEAGIVISASHNPHYDNGIKFFSGQGTKLPDEIEMMIEELLD
GLMM_PSEF5      LLGPMPTPAIAYLTRTFHAEAGIVISASHNPHDDNGIKFFSGEGTKLPDEVELMIEELLD
GLMM_PSEPK      LLGPMPTPAIAYLTRTFHAEAGIVISASHNPHDDNGIKFFSGQGTKLPDEVELMIEELLD
GLMM_PSEAE      LLGPMPTPGIAYLTRTFHAEAGVVISASHNPHDDNGIKFFSGQGTKLPDDVELMIEELLD
GLMM_XANAC      LIGPMPTPAIAFLTSTLRADAGVVISASHNPHYDNGIKFFSAEGEKLDDATEAAIEAALD
GLMM_XANC5      LIGPMPTPAIAFLTSTLRADAGVVISASHNPHYDNGIKFFSAEGEKLDDATEAAIEAALD
GLMM_XANOR      LIGPMPTPAIAFLTSTLRADAGVVISASHNPHYDNGIKFFSAEGEKLDDATEAAIEAALD
GLMM_XANC8      LIGPMPTPAIAFLTSTLRADAGVVISASHNPHYDNGIKFFSAEGEKLDDATEAAIEAALD
GLMM_XANCP      LIGPMPTPAIAFLTSTLRADAGVVISASHNPHYDNGIKFFSAEGEKLDDATEAAIEAALD
GLMM_XYLFA      LIGPMPTPAIAFLTNTLRADAGVVISASHNPHDDNGIKFFSAMGEKLDDATEAAIEAAIE
GLMM_XYLFT      LIGPMPTPAIAFLTNTLRADAGVVISASHNPHDDNGIKFFSAMGEKLDDATEAAIEAAIE
GLMM_ECOL6      FTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLPDAVEEAIEAEME
GLMM_SHISS      FTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLPDAVEEAIEAEME
GLMM_ECO57      FTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLPDAVEEAIEAEME
GLMM_ECOLI      FTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLPDAVEEAIEAEME
GLMM_SHIFL      FTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLPDAVEEAIEAEME
GLMM_SALTI      FTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLPDDVEEAIEAEME
GLMM_SALTY      FTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLPDDVEEAIEAEME
GLMM_SALCH      FTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLPDDVEEAIEAEME
GLMM_SALPA      FTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLPDDVEEAIEAEME
GLMM_YERPE      FTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLPDDVEEAIEAEME
GLMM_YERPS      FTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLPDDVEEAIEAEME
GLMM_PECAS      FTGPMPTPAVAYLTRTFRAEAGIVISASHNPYYDNGIKFFSIDGTKLPDDVEEAIEAEME
GLMM_PHOLL      FTGPMPTPAVAYLTRTFRAEAGIVISASHNPYYDNGIKFFSIDGTKLPDDVEEAIEAEME
GLMM_PHOPR      FTGPMPTPAVAYLTRTFRAEAGIVISASHNPYYDNGIKFFSSEGTKLPDAIELAIEAEME
GLMM_ALIF1      FTGPMPTPAVAYLTQTFRAEAGIVISASHNPYYDNGIKFFSSEGTKLPDDVEMAIEAELD
GLMM_VIBVU      FTGPMPTPAVAYLTQTFRAEAGIVISASHNPYYDNGIKFFSSEGTKLPDDIELAIEAELD
GLMM_VIBVY      FTGPMPTPAVAYLTQTFRAEAGIVISASHNPYYDNGIKFFSSEGTKLPDDIELAIEAELD
GLMM_VIBPA      FTGPMPTPAVAYLTQTFRAEAGIVISASHNPYYDNGIKFFSSEGTKLPDDIELAIEAELD
GLMM_VIBCH      FTGPMPTPAVAYLTQTFRAEAGIVISASHNPYYDNGIKFFSYEGTKLPDDIELAIEAELD
GLMM_HAEI8      FTGPMPTPAIAYLTRTFRAEAGIVISASHNPYYDNGIKFFSAKGTKLPDEIEEAIEAMLE
GLMM_HAEIN      FTGPMPTPAIAYLTRTFRAEAGIVISASHNPYYDNGIKFFSAKGTKLPDEIEEAIEAMLE
GLMM_MANSM      FIGPMPTPAVAYLTRTFRAEAGIVISASHNPYYDNGIKFFSAQGTKLPDEIEEAIEAMLE
GLMM_PASMU      FTGPMPTPAIAYLTRTFRAEAGIVISASHNPYYDNGIKFFSAQGTKLPDDVEEAIEAMLD
GLMM_HAEDU      FVGPMPTPAVAYLTRTFRAEAGIVISASHNPYYDNGIKFFSANGEKLPDEVEEAIEALLD
GLMM_IDILO      FLGPMPTPGIAYLTRTFRAAAGIVISASHNPYYDNGIKFFADNGHKLPDAVELEIERLLD
GLMM_COLP3      LLGPMPTPGIAYLTKTFRAEAGIVISASHNPFYDNGIKFFSNTGEKLPDAVELAIEAELD
GLMM_SHEON      LMGPMPTPAVAYLTRTFRAEAGVVISASHNPYYDNGIKFFSTDGSKLDDNLELEIEAELE
GLMM_PSEHT      LLGPMPTPAIAYLAQTFRAEAGIVISASHNPYYDNGIKFFNCRGLKLDDKVELEIEAMLD
GLMM_BLOFL      LTGPMPTPAIAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIKGTKLDTQVEYFIETELN
GLMM_BLOPB      LTGPMPTPAIAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIKGTKLDNEVEHSIEIELE
GLMM_BUCAI      LAGCMPTSAISYFTKSLNASAGIVISGSHNPFYDNGIKIFYKNGVKLTKEIEFSIEQKVQ
GLMM_BUCBP      SVGVLPTPAISYFTKLFNLEVGVVISASHNQFRDNGIKFFVKNGVKLSAKFERRIEKQLN
GLMM_WIGBR      LIGSIPTPAISYLTSYLKADAGISVSASHNLCSDNGIKIFSVNGKKLSDKLENDIEIKLS
GLMM_ACIAD      LLGPLPTPAIAHLTRALHADAGIVISASHNPYFDNGIKFFSGEGKKLPDSLQDEINQELE
GLMM_PSYA2      MLGPLPTPAIAHLTRSFNADAGVVISASHNPYYDNGIKFFSGDGKKLTDEMQNAINDKLD
GLMM_FRATT      DLGVVPTPVVAFMTVKHRAAAGFVITASHNKFTDNGIKLFSSNGFKLDDALEEEVEDMID
GLMM_THEMA      LCGILPTPAVALLTR-ITRSFGVVISASHNPPEYNGIKVL-KGGYKIPDEMEAEIEKRLE
GLMM_NOSS1      YLGLCPTPCVAYLTSMSEAIGGVMISASHNPPEDNGIKIFGANGGKLSQALQAEIEKGLR
GLMM_SYNY3      QLGLCPTPCVAYLTRKTAAIGGIMISASHNPPEDNGIKFFDHQGLKLPKSLATAIEAGLR
GLMM_THEEB      HVGLCPTPCIAYLTATTEAIGGAMISASHNPPADNGIKIFGSDGSKLCPDLQKEIEAHLN
GLMM_SYNP6      HLGLCPTPGVAYLTHHSEAIGGVMISASHNPPGDNGIKVFGADGSKLDRQLQAAIEAGLR
GLMM_PROMM      TLGLCPTPAVPGLIRKLGAAGGLMVSASHNPPEDNGIKVFGADGAKLSPAKQGLIEAGLR
GLMM_SYNPX      ELGLCATPAVPLLIREVGAAGGLMVSASHNPPADNGIKVFGADGTKLSAERQARVETGLR
GLMM_PROMA      LLGLCPTPAVSHLIKKYNASGGLMISASHNPPEDNGIKIFDKTGEKISLEKQIFIDNKLK
GLMM_PROMP      YLGICPTPAIPFLIKKEKFSGGIMISASHNPPEYNGIKIFDNNGEKIKKKLENQIELILE
GLMM_PROM5      YLGICPTPAIPFLIKKEKFSSGIMISASHNPPEFNGIKIFDKNGEKIKRDFEKRIELIMA
GLMM_PROMS      NLGICPTPAIPFLIKKENLSSGIMISASHNPPEYNGIKIFDHNGQKITRYFENKIQKLIE
GLMM_PROM9      NLGICPTPAIPFLIKQEQLSSGIMISASHNPPEYNGIKIFDHNGQKITKNFENKIQKFIE
                  *  .*     .        .  ::.***    **:*.:   * *:       :     

GLMM_BACAN      LDKEVDELPRPT-----GTNLGQVSDYF----------------EGGQKYLQYIKQTVEE
GLMM_BACCZ      LDKEVDELPRPT-----GTNLGQVSDYF----------------EGGQKYLQYIKQTVEE
GLMM_BACHK      LDKEVDELPRPT-----GTNLGQVSDYF----------------EGGQKYLQYIKQTVEE
GLMM_BACC1      LDKEVDELPRPT-----GTNLGQVSDYF----------------EGGQKYLQYIKQTVEE
GLMM_BACCR      LDKEVDELPRPT-----GTNLGQVSDYF----------------EGGQKYLQYIKQTVEE
GLMM_BACLD      MDQPEDHLPRPV-----GADLGMVNDYF----------------EGGQKYLQFLKQSADE
GLMM_BACSU      MDEPEDKLPRPV-----GADLGLVNDYF----------------EGGQKYLQFLKQTADE
GLMM_GEOKA      IDSAEDMLPRPI-----GAGLGQVNDYF----------------EGGQKYLQYLKQTIDE
GLMM_BACHD      LDQ-EDALPRPT-----GADLGQANDYF----------------EGAQKYLQFLKQTVDE
GLMM_BACSK      IDG-EDTMPRPI-----GGDVGQLNDYF----------------EGSQKYMQFLKQTVEG
GLMM_LISMF      LDTAEDTLPRPS-----GEGLGTVSDYF----------------EGKQKYIQYLKQTIEN
GLMM_LISMO      LDTAEDTLPRPS-----GEGLGTVSDYF----------------EGKQKYIQYLKQTIEN
GLMM_LISIN      LDTAEDTLPRPS-----GEGLGTVSDYF----------------EGKQKYIQYLKQTIEN
GLMM_OCEIH      MEG-EDNLPRPT-----GADIGVVNDYF----------------EGGQKYLSYLKDTIDN
GLMM_STAAC      LDQENPELPRPV-----GNDIVHYSDYF----------------EGAQKYLSYLKSTVDV
GLMM_STAA8      LDQENPELPRPV-----GNDIVHYSDYF----------------EGAQKYLSYLKSTVDV
GLMM_STAAM      LDQENPELPRPV-----GNDIVHYSDYF----------------EGAQKYLSYLKSTVDV
GLMM_STAAN      LDQENPELPRPV-----GNDIVHYSDYF----------------EGAQKYLSYLKSTVDV
GLMM_STAAW      LDQENPELPRPV-----GNDIVHYSDYF----------------EGAQKYLSYLKSTVDV
GLMM_STAAR      LDQENPELPRPV-----GNDIVHYSDYF----------------EGAQKYLSYLKSTVDV
GLMM_STAAS      LDQENPELPRPV-----GNDIVHYSDYF----------------EGAQKYLSYLKSTVDV
GLMM_STAEQ      LDQTNPDLPRPV-----GEDIVHYSDYF----------------EGAQKYLSYLKSTVDV
GLMM_STAES      LDQTNPDLPRPV-----GEDIVHYSDYF----------------EGAQKYLSYLKSTVDV
GLMM_STAS1      LDQDNPDLPRPV-----GEDIVHYSDYF----------------EGAQKYISYLKSTVDV
GLMM_STAHJ      LDQDNPDLPRPV-----GTDIVHFSDYF----------------EGAQKYLSYLKSTIDV
GLMM_LACAC      IDAEEDTLPRPS-----AEGLGTVTDFH----------------EGSAKYLQFIENTIPE
GLMM_LACJO      IDAPEDKLPRPS-----AEGLGTVTNYH----------------EGASKYLQFIENTLPE
GLMM_LACPL      LDQPKDTLPRPA-----AEGLGTVADFP----------------EGNLKYSQFLEQTIPD
GLMM_STRA3      LDAKEDTLPRPS-----AQGLGTLVDYP----------------EGLRKYEKFMESTGI-
GLMM_STRA5      LDAKEDTLPRPS-----AQGLGTLVDYP----------------EGLRKYEKFMESTGI-
GLMM_STRA1      LDAKEDTLPRPS-----AQGLGTLVDYP----------------EGLRKYEKFMESTGI-
GLMM_STRT1      LDAAEDTLPRPS-----AEGLGTLVDYP----------------EGLRKYEKFLVTTGL-
GLMM_STRT2      LDAAEDTLPRPS-----AEGLGTLVDYP----------------EGLRKYEKFLVTTGL-
GLMM_STRP1      LDAPEDTLPRPS-----AEGLGTLVDYP----------------EGLRKYEKFLVTTGT-
GLMM_STRP3      LDAPEDTLPRPS-----AEGLGTLVDYP----------------EGLRKYEKFLVTTGT-
GLMM_STRP6      LDAPEDTLPRPS-----AEGLGTLVDYP----------------EGLRKYEKFLVTTGT-
GLMM_STRPM      LDAPEDTLPRPS-----AEGLGTLVDYP----------------EGLRKYEKFLVTTGT-
GLMM_STRP8      LDAPEDTLPRPS-----AEGLGTLVDYP----------------EGLRKYEKFLVTTGT-
GLMM_STRMU      LDAKEDDLPRPS-----AQGLGMVVDYP----------------EGLRKYEKFLVSTGS-
GLMM_STRPN      LDAEEDTLPRPS-----AEGLGILVDYP----------------EGLRKYEGYLVSTGT-
GLMM_STRR6      LDAEEDTLPRPS-----AEGLGILVDYP----------------EGLRKYEGYLVSTGT-
GLMM_LACLA      IDAEEDTLPRPS-----AQGLGMLHDYI----------------EGVRKYQAFLKTTAEG
GLMM_CLOAB      IESDFEGVPLPT-----GESVGRKVVEE----------------SAEEDYIKFAKSTIGT
GLMM_CLOTE      IENNFEGVPCPT-----GEDIGEKTIID----------------DAIKDYIEFAKGTIKG
GLMM_CLOPE      IESGFENVPSPT-----GANLGREIIEK----------------AALEDYISFAKDTIGI
GLMM_CALS4      INEKKE-LPVPT-----GIGIGRRKESL----------------TSHRDYIEFLKSTIDT
GLMM_FUSNN      MDNLDKILANPLA----GDKVGKFKYAE----------------DEYFQYKNYLTQCVKG
GLMM_COREF      DDL---PEEGPT-----GHGIGRVIEEA---------------PDARGRYLQHLADAVPT
GLMM_CORGL      DSL---PAEGPT-----GHGVGRVIEEA---------------TDAQDRYLEHLKEAVPT
GLMM_CORDI      ETI---PDGGPT-----GHGIGRVIEEA---------------VDAQETYLKHLKGAVPR
GLMM_CORJK      LEL---PETGPT-----GAAIGRILDES---------------SDALERYLAHVGTAINH
GLMM_MYCBO      LGVSRGPGLRPA-----GAGIGRVIDA----------------EDATERYLRHVAKAATA
GLMM_MYCTU      LGVSRGPGLRPA-----GAGIGRVIDA----------------EDATERYLRHVAKAATA
GLMM_MYCLE      TG---GPGLRPA-----GVAIGRVIDA----------------EDATERYLRHVGKASTI
GLMM_MYCPA      GD----AGPRPV-----GAGIGRVIDA----------------EDAADRYLRHLSKASTL
GLMM_NOCFA      AA---DDPVRPT-----GAGIGRVLNASGARDHGLHIPDQYSVEGTHERYVEHLVEATGR
GLMM_STRAW      EHRTGAPWDRPT-----GAGVGRVTSYG----------------EGADQYVAHLMSVLPN
GLMM_STRCO      DHRTGAPWDRPT-----GSGVGRVRDYD----------------EGLDQYVAHLVGVLPN
GLMM_THEFY      -RRLGRAVAGAT-----GRDVGRVTDDT----------------DSVERYITHLVNSLPN
GLMM_LEIXX      -EHLHLEKLTPT-----GAEVGRIQCFA----------------DAEDRYVLHLLASLPH
GLMM_CUTAK      -QRMGEPWARPI-----GDKVGRIRYTP----------------QAVDTYVDHLVRSLRQ
GLMM_BIFLO      ---LGQDWDRPT-----GAGVGRVSHDQ---------------TTATNLYIDHLVATIAP
GLMM_TROW8      ---LDKQKLSPI-----GSKVGRITRFV----------------DAEDRYQMHLLSTLFT
GLMM_TROWT      ---LDKQKLSPI-----GSKVGRITRFV----------------DAEDRYQMHLLSTLFT
GLMM_SYMTH      VKARPDTMPRPT-----GAELGSIRQSP----------------EAVEAYVEHLVSTGSP
GLMM_THET2      ----LEDHP--------TRGIGTVGDFR----------------EAERMYLDFLLAHAP-
GLMM_THET8      ----LEDHP--------TRGIGTVGDFR----------------EAERMYLDFLLAHAP-
GLMM_DEIRA      EAATLAPVT--------GVNLGSVTNYT----------------EAERLYTAFLSSHAP-
GLMM_AGRFC      KDIYAQLAKP--------AEIGRAKRVD----------------GDIYRYIEFVKRTLPR
GLMM_RHIME      QDMSGQLAKP--------EDIGRAKRVD----------------GDIYRYIEQAKRTLPR
GLMM_BRUME      GDMTPFLASH--------GDVGRAKRVD----------------GDIYRYIEFAKRTLPR
GLMM_BRUSU      GDMTPFLASH--------GDVGRAKRVD----------------GDIYRYIEFAKRTLPR
GLMM_RHILO      KDVELTLADS--------DGLGRAKRVD----------------GVHDRYIEFAKRTLPR
GLMM_BARHE      TDLSKSLASC--------AEIGYAKRVE----------------GDIYRYIEYAKRTLPR
GLMM_BARQU      TDLSKSLASC--------AEIGYAKRVE----------------GDIYRYIEYAKRTLPR
GLMM_BRADU      EPIDKRLAQS--------ASLGRARRID----------------GVHDRYIEFAKRTLPR
GLMM_NITWN      ENLDKKLAQS--------RNLGRARRID----------------GVHDRYIEFAKRTLPR
GLMM_RHOPA      ESLDKKLAQS--------ASLGRARRID----------------GVHDRYIEFAKRTLPR
GLMM_CAUVC      QGLQEGLAAP--------RELGRVKRID----------------DAQARYVEIVKATFPR
GLMM_GLUOX      QDLSARLASP--------AQIGRASRLT----------------DAAGRYIENAKASFPR
GLMM_ZYMMO      Q--PPLLAAP--------ADIGRARRID----------------DAQGRYIHAVKSSFPE
GLMM_RUEPO      TG--VRLAQA--------HNIGRVRRVD----------------DARFRYGERVKSSLTR
GLMM_CAMJE      DDKLIQASKVDM------EKIGQAKRID----------------DVIGRYIVSIKNSFPK
GLMM_CAMJR      DDKLIQASKVDM------EKIGQAKRID----------------DVIGRYIVSIKNSFPK
GLMM_HELPJ      DEELLHSSYKVG------ESVGSAKRID----------------DVIGRYIAHLKHSFPK
GLMM_HELPY      DEELLHSSYKVG------ESVGSAKRID----------------DVIGRYIAHLKHSFPK
GLMM_HELHP      NPTSLQSALKSG------LEIGSSKRID----------------DVVGRYIVHIKNSFPK
GLMM_WOLSU      DEALLEASQKSG------KEIGASKRID----------------DVVGRYIVHIKNSFPK
GLMM_PELUB      -DQKIEKSLSKP------KKLGRVKRLE----------------TANKDYIKILKNNLPK
GLMM_ANAMM      AELSSDLAQV--------RGMGKVYRIA----------------GAVGRYIEFVKGTFPK
GLMM_DESPS      SQRMLALQPLA-------EEVGRASRID----------------DAKGRYIVFLKNTFPK
GLMM_GEOSL      SGKIDSLRPVA-------TEVGKAYRID----------------DAVGRYVVFLKNSFPK
GLMM_DESVH      DPDWQWDYPAS-------EKVGRAYKIA----------------DAPGRYIVYIKSSFPA
GLMM_BDEBA      EEDLTPLLPPS-------KEIGRTRRIE----------------DSQGRYIVYVKGTFPL
GLMM_CHLAB      LKEFGN-FPDD-------CAVGKNKRVV----------------DAMGRYIEFAKATFPR
GLMM_CHLCV      CRDFGN-FPED-------YAVGKNKRVV----------------DAMGRYIEFAKATFPK
GLMM_CHLPN      EADFGP-LPED-------HAVGKNKRVI----------------DAMGRYVEFVKATFPK
GLMM_CHLMU      SKSFGG-LPED-------HAVGKNKRVK----------------DAMGRYIEYAKATFPK
GLMM_CHLTR      SKDFGK-LPDD-------HAVGKNKRVK----------------DATGRYIEYAKATFPK
GLMM_PARUW      KNHFDEELPAD-------DDIGKNTKII----------------DADGRYIEFVKATFPR
GLMM_LEGPA      KQLQTV----------PSAKLGKATRIN----------------DAAGRYIEFCKSTIPS
GLMM_LEGPH      KQLQTV----------PSAKLGKATRIN----------------DAAGRYIEFCKSTIPS
GLMM_LEGPL      KQLQTV----------PSAKLGKATRIN----------------DAAGRYIEFCKSTIPS
GLMM_COXBU      KPMKTV----------VADRLGKAARMN----------------EAHGRYIEFCKSTFPS
GLMM_AROAE      QPMVCA----------EASRLGKARRIV----------------DAAGRYVEFCKSAFPN
GLMM_DECAR      QPMVCA----------PPADLGRVRRIE----------------DARGRYIEFCKSTFPN
GLMM_BORBR      EPLGCV----------GSEELGRARRMA----------------DAQGRYIEFCKSTFPH
GLMM_BORPA      EPLGCV----------GSEELGRARRMA----------------DAQGRYIEFCKSTFPH
GLMM_BORPE      EPLGCV----------GSEELGRARRMA----------------DAQGRYIEFCKSTFPH
GLMM_BURMA      KPLDCA----------ASDGLGKARRLD----------------DAAGRYIEFCKSTFPA
GLMM_BURPS      KPLDCA----------ASDGLGKARRLD----------------DAAGRYIEFCKSTFPA
GLMM_CUPPJ      EPMTCA----------PSDDLGRARRIN----------------DAPGRYIEFCKSTFPN
GLMM_RALSO      KPMVYA----------ASDALGRARRID----------------DAAGRYIEFCKSTFPN
GLMM_NEIG1      EEMKTQ----------PSARLGRARRIS----------------GADDRYIEFCKSTFPG
GLMM_NEIMB      GEMKTQ----------PSARLGRARRIS----------------GADDRYIEFCKSTFPS
GLMM_NEIMA      EEMKTQ----------PSARLGRARRIS----------------GADDRYIEFCKSTFPS
GLMM_NEISU      EEMKTQ----------PSARLGRARRIN----------------GADDRYIEFCKSTFPS
GLMM_CHRVO      QPMATN----------PSLELGRARRID----------------GAAERYIEFCKSTFPN
GLMM_NITEU      QPMKTT----------PSIKLGRVQRLR----------------DAAGRYIEFCKSTFPN
GLMM_METCA      RPMTTV----------ECSHIGKATRIV----------------DAAGRYIEFCKSTIPL
GLMM_NITOC      KPMQTA----------TSSRLGKAERVV----------------DAAGRYIEFCKSTGPA
GLMM_PSE14      APMTVA----------ESENLGKVSRIN----------------DAAGRYIEFCKSSVPT
GLMM_PSESM      APMTVA----------ESENLGKVSRIN----------------DAAGRYIEFCKSSVPT
GLMM_PSEU2      APMTVA----------ESENLGKVSRIN----------------DAAGRYIEFCKSSVPT
GLMM_PSEF5      APMTVV----------ESSKLGKVSRIN----------------DASGRYIEFCKSSVPS
GLMM_PSEPK      QPMTVV----------ESGKLGKVSRIN----------------DAAGRYIEFCKSSVPS
GLMM_PSEAE      APMTVV----------ESARLGKVSRIN----------------DAAGRYIEFCKSSVPT
GLMM_XANAC      EPFHTV----------ESERLGKAIRTR----------------DAIGRYIEFCKASVAR
GLMM_XANC5      EPFHTV----------ESERLGKAIRTR----------------DAIGRYIEFCKASVAR
GLMM_XANOR      APFHTV----------ESERLGKAIRTR----------------DAIGRYIEFCKASVAR
GLMM_XANC8      APFHTV----------ESERLGKAIRTR----------------DAIGRYIEFCKASVPR
GLMM_XANCP      APFHTV----------ESERLGKAIRTR----------------DAIGRYIEFCKASVPR
GLMM_XYLFA      APFLTV----------DSEYLGKVKRTR----------------DAIGRYIEFSKASVPR
GLMM_XYLFT      APFLTV----------DSEYLGKVKRTR----------------DAIGRYIEFSKASVPR
GLMM_ECOL6      KEISCV----------DSAELGKASRIV----------------DAAGRYIEFCKATFPN
GLMM_SHISS      KEISCV----------DSAELGKASRIV----------------DAAGRYIEFCKATFPN
GLMM_ECO57      KEISCV----------DSAELGKASRIV----------------DAAGRYIEFCKATFPN
GLMM_ECOLI      KEISCV----------DSAELGKASRIV----------------DAAGRYIEFCKATFPN
GLMM_SHIFL      KEISCV----------DSAELGKASRIV----------------DAAGRYIEFCKATFPN
GLMM_SALTI      KEITCV----------DSAELGKASRIV----------------DAAGRYIEFCKGTFPN
GLMM_SALTY      KEITCV----------DSAELGKASRIV----------------DAAGRYIEFCKGTFPN
GLMM_SALCH      KEITCV----------DSAELGKASRIV----------------DAAGRYIEFCKGTFPN
GLMM_SALPA      KEITCV----------DSAELGKASRIV----------------DAAGRYIEFCKGTFPN
GLMM_YERPE      KPLTCV----------ESAELGKANRIV----------------DAAGRYIEFCKGTFPS
GLMM_YERPS      KPLTCV----------ESAELGKANRIV----------------DAAGRYIEFCKGTFPS
GLMM_PECAS      KPLTCV----------ESSELGKASRIV----------------DAAGRYIEFCKGTFPG
GLMM_PHOLL      KPLTCV----------ESAELGRANRIV----------------DAAGRYIEFCKGTFPS
GLMM_PHOPR      KPLTCV----------ESAMLGKAYRIN----------------DAAGRYIEFCKGTFPS
GLMM_ALIF1      KPMTCVES----------ALLGKASRLN----------------DAAGRYIEFCKSTFPK
GLMM_VIBVU      KEIECV----------ESAELGKATRLN----------------DAAGRYIEFCKSTFPS
GLMM_VIBVY      KEIECV----------ESAELGKATRLN----------------DAAGRYIEFCKSTFPS
GLMM_VIBPA      KDIECV----------ESSELGKATRLN----------------DAAGRYIEFCKSTFPS
GLMM_VIBCH      KDIECV----------ESAELGKASRMV----------------DAAGRYIEFCKSTFPS
GLMM_HAEI8      QPMDCV----------ESAELGKASRIN----------------DAAGRYIEFCKGTFPA
GLMM_HAEIN      QPMDCV----------ESAELGKASRIN----------------DAAGRYIEFCKGTFPA
GLMM_MANSM      QPIDCV----------ESAELGRASRIK----------------DAAGRYIEFCKGTFPT
GLMM_PASMU      EPMDCV----------ESAELGRASRIN----------------DAVGRYIEFCKGTFPA
GLMM_HAEDU      QPMDYV----------ESDQLGKAIRIN----------------DAAGRYIEFCKGTFPA
GLMM_IDILO      EPMDCV----------ISEELGRAKRIN----------------DAAGRYIEFCKSVFPN
GLMM_COLP3      NPMGCV----------ESAKLGKASRVN----------------DAAGRYIEFCKSNFPS
GLMM_SHEON      KPLVCV----------ESHLLGKVSRIE----------------DARGRYIEYCKGNFPA
GLMM_PSEHT      EPMTCV----------ESDKLGKASRLT----------------SADGRYIEFCKSQFPQ
GLMM_BLOFL      KCLKCI----------QPKLLGKAKRII----------------DAAGRYIEFCKGTFPA
GLMM_BLOPB      KCLTCV----------DPKELGKASRIV----------------DAAGRYIEFCKGTFPA
GLMM_BUCAI      HTFLYP----------DYVNFGHSNNIL----------------DPESLYIDFCKKNFPK
GLMM_BUCBP      KTIILK----------QFVDLGHISYKR----------------ALQQKYINFCISTLPN
GLMM_WIGBR      KLTILK----------KNIYCKNKYQKV----------------NLINQYIKFCRSTVSN
GLMM_ACIAD      HELHIE----------DTANLGKSVRLI----------------DANGRYIEFCKSTFPY
GLMM_PSYA2      TIMAATGSNDALMPILDPAQLGKNNRID----------------DAKGRYIEFCKGSFPY
GLMM_FRATT      GDFIYQ----------PQFKFGSYKILA----------------NAIDEYIESIYSRFAK
GLMM_THEMA      NGSFLT-----------RSVVGRTKSFR----------------EGRDMYIGAVLEMFRD
GLMM_NOSS1      G-NLPITSN--V------SNCGRHYSRW----------------ELVKNYGEALKRPWQN
GLMM_SYNY3      GQNQTSGLN--A------SQWGRSYGQP----------------HRVQYYQDFLLGSLPQ
GLMM_THEEB      A--GRSLPY--R------EDWGHLHHRP----------------ELVQRYRHAVQAPLQD
GLMM_SYNP6      G--QQTSLP--A------TTWGQHYYQP----------------QLADHYQAAIAQSLGQ
GLMM_PROMM      GEAIGDKGRPTI------TSCGPAYQRN----------------ELLSHYRDALLASVLH
GLMM_SYNPX      GEVEDDGP----------SRCGRSVQRQ----------------DLLRSYQDKLLSSVGD
GLMM_PROMA      RKVLIPICK----------DKDNCINRN----------------DLLKDYKNSLLNTVDK
GLMM_PROMP      TANNLKLST---------YKKTSIRENN----------------NLFNIYTEGLINTMGD
GLMM_PROM5      RVDNNKIIT---------NKYKSVSKNN----------------ELLNIYTKGLIDSMEN
GLMM_PROMS      ETNQNISVP---------TKVIPLNTNK----------------NLMDIYIKSLVQAMDG
GLMM_PROM9      ESNQNISVT---------TKEISLKANK----------------ELMDIYMKSLIQSMGG
                                                                 *          

GLMM_BACAN      ---------DFSGLHIALDCAHGATSSLAPYLFADLEADISTMGTSPNGMNINDGVGSTH
GLMM_BACCZ      ---------DFSGLHIALDCAHGATSSLAPYLFADLEADISTMGTSPNGMNINDGVGSTH
GLMM_BACHK      ---------DFSGLHIALDCAHGATSSLAPYLFADLEADISTMGTSPNGMNINDGVGSTH
GLMM_BACC1      ---------DFSGLHIALDCAHGATSSLAPYLFADLEADISTMGTSPNGMNINDGVGSTH
GLMM_BACCR      ---------DFSGLHIALDCAHGATSSLAPYLFADLEADISTMGTSPNGMNINEGVGSTH
GLMM_BACLD      ---------DFTGIHVALDCAHGATSSLATHLFADLDADVSTMGTSPNGLNINDGVGSTH
GLMM_BACSU      ---------DFTGIHVALDCANGATSSLATHLFADLDADVSTMGTSPNGLNINDGVGSTH
GLMM_GEOKA      E--------DFSGMKIALDCAHGATSSLATYLFADLDADVVTMGASPNGLNINEGVGSTH
GLMM_BACHD      ---------DFTGIHIALDCANGAASSLAPHLFADLEADISTMGTSPNGKNINDGVGSTH
GLMM_BACSK      ---------GFEGIHVAIDCANGAASSLATHVLADLDADISSMGSSPNGTNINACCGSTH
GLMM_LISMF      ---------DFNGYHIALDCANGATSGLATHLFADLDADISSMGASPNGLNINDGVGSTH
GLMM_LISMO      ---------DFNGYHIALDCANGATSGLATHLFADLDADISSMGASPNGLNINDGVGSTH
GLMM_LISIN      ---------DFNGYHIALDCANGATSGLATHLFADLDADISSMGASPNGLNINDGVGSTH
GLMM_OCEIH      ---------DFEGIHIAIDCANGATSSLATHLFADLEADIYSIGSSPDGLNINDGFGSTH
GLMM_STAAC      ---------NFEGLKIALDGANGSTSSLAPFLFGDLEADTETIGCSPDGYNINEKCGSTH
GLMM_STAA8      ---------NFEGLKIALDGANGSTSSLAPFLFGDLEADTETIGCSPDGYNINEKCGSTH
GLMM_STAAM      ---------NFEGLKIVLDGANGSTSSLAPFLFGDLEADTETIGCSPDGYNINEKCGSTH
GLMM_STAAN      ---------NFEGLKIVLDGANGSTSSLAPFLFGDLEADTETIGCSPDGYNINEKCGSTH
GLMM_STAAW      ---------NFEGLKIVLDGANGSTSSLAPFLFGDLEADTETIGCSPDGYNINEKCGSTH
GLMM_STAAR      ---------NFEGLKIVLDGANGSTSSLAPFLFGDLEADTETIGCSPDGYNINEKCGSTH
GLMM_STAAS      ---------NFEGLKIVLDGANGSTSSLAPFLFGDLEADTETIGCSPDGYNINEKCGSTH
GLMM_STAEQ      ---------NFEGLKIVLDGANGSTSSLAPFLFGDLEADTETIGCNPDGYNINEQCGSTH
GLMM_STAES      ---------NFEGLKIVLDGANGSTSSLAPFLFGDLEADTETIGCNPDGYNINEQCGSTH
GLMM_STAS1      ---------DLAGMKIALDGAHGSTSSLAPFLFGDLEADTVTIGCNPNGYNINQEVGSTH
GLMM_STAHJ      ---------NLEGLKITLDGANGSTSALAPFLFGDLEADTETIGCSPDGYNINDNCGSTH
GLMM_LACAC      ---------ELDGIKVVIDGANGASSALISRLFADCGVDFTTIYTHPNGLNINDHCGATH
GLMM_LACJO      ---------ELSGIKVVVDGANGAASALISRLFADMGVDFTTIATHPDGLNINDHVGATH
GLMM_LACPL      ---------DLSGIHLAVDGANGSTSNLVSRIFADLNVEFDTMATAPDGLNINKGVGSTH
GLMM_STRA3      ---------DLEGMKVALDTANGAATASARNIFLDLNADISVIGDQPDGLNINDGVGSTH
GLMM_STRA5      ---------DLEGMKVALDTANGAATASARNIFLDLNADISVIGDQPDGLNINDGVGSTH
GLMM_STRA1      ---------DLEGMKVALDTANGAATASARNIFLDLNADISVIGDQPDGLNINDGVGSTH
GLMM_STRT1      ---------DLGGMKVALDAANGAAAVSARNIFLDLNAEIAVIGDQPDGLNINAGVGSTH
GLMM_STRT2      ---------DLGGMKVALDAANGAAAVSARNIFLDLNAEIAVIGDQPDGLNINAGVGSTH
GLMM_STRP1      ---------DLSGMTVALDTANGAASVSARDVFLDLNAEIAVIGEKPNGLNINDGVGSTR
GLMM_STRP3      ---------DLSGMTVALDTANGAASVSARDVFLDLNAEIAVIGEKPNGLNINDGVGSTH
GLMM_STRP6      ---------DLSGMTVALDTANGAASVSARDVFLDLNAEIAVIGEKPNGLNINDGVGSTH
GLMM_STRPM      ---------DLSGMTVALDTANGAASVSARDVFLDLNAEIAVIGEKPNGLNINDGVGSTH
GLMM_STRP8      ---------DLSGMTVALDTANGAASVSARDVFLDLNAEIAVIGEKPNGLNINDGVGSTH
GLMM_STRMU      ---------DLEGMKIAIDAANGAASYSARQVFLDLNADITVIGEEPDGLNINDGVGSTH
GLMM_STRPN      ---------PLDGMKVALDTANGAASTSARQIFADLGAQLTVIGETPDGLNINLNVGSTH
GLMM_STRR6      ---------PLDGMKVALDTANGAASTSARQIFADLGAQLTVIGETPDGLNINLNVGSTH
GLMM_LACLA      ---------NFEGYKVVLDTANGAAYTSARAVFADLEANLTVIGENPDGLNINVKVGSTH
GLMM_CLOAB      ---------DLKGMKIALDCANGAAYKTAVKTFRELGAQVTVINNDPDGININCNCGSTH
GLMM_CLOTE      ---------DLKGLRVALDCANGASYKASVETFKDLGAEVYVINNEPNGKNINKDCGSTH
GLMM_CLOPE      ---------SLEGLRVALDCANGASHEAAVRAFRELGAEIFVINDNPDGTNINENCGSTH
GLMM_CALS4      ---------DLKGLKIVIDCAYGASSTVAPILFKELGAEVIAYAAELLGEKINVGCGSTH
GLMM_FUSNN      ---------NFKDIKIVLDTANGAAYRAAKDVFLDLRAELVVINDAPNGRNINVKCGSTH
GLMM_COREF      D---------LSGITVVVDAANGAASVIAPQAYEAAGAKVIAIHNTPNAYNINEKCGSTH
GLMM_CORGL      S---------LEGIKIVVDAANGAASVVAPTAYEAAGATVIAIHNKPDSYNINMDCGSTH
GLMM_CORDI      S---------LEGITVVVDCANGAASEVAPLAYAAAGAKVIPIHNHPNAYNINDSCGSTH
GLMM_CORJK      P---------LDGIRVVVDCANGAASTAAPEAYRQAGADVVAIHSRPNSFNINDGVGSTH
GLMM_MYCBO      R---------LDDLAVVVDCAHGAASSAAPRAYRAAGARVIAINAEPNGRNINDGCGSTH
GLMM_MYCTU      R---------LDDLAVVVDCAHGAASSAAPRAYRAAGARVIAINAEPNGRNINDGCGSTH
GLMM_MYCLE      R---------LDGLTVVVDCAHGAASSAAPRAYRAAGARVIAINADPNGININDRCGSTD
GLMM_MYCPA      R---------LDGLTVVVDCAHGAASAVAPRAYRAAGARVIAINADPNGLNINDNCGSTH
GLMM_NOCFA      D---------LSGLTVVVDCANGAAAEVGPAAYREAGATVIAINAEPDGLNINDGCGSTH
GLMM_STRAW      R---------LDGIKVVLDEAHGAAARVSPDAFTRAGAEIITIGAEPDGLNINDGCGSTH
GLMM_STRCO      R---------LDGLKIVLDEAHGAASRVSPEAFARAGAELVTIGAVPDGLNINDGCGSTH
GLMM_THEFY      R---------LDGLKVVVDCANGAAAGIAPEALRRAGADVIAIGDKPDGFNINEGCGSTN
GLMM_LEIXX      R---------LDGIHVVLDCAHGAAAGISPEVFTDAGARVTVIGDAPDGMNINDGVGSTH
GLMM_CUTAK      QDT-------LKGMKIVLDTANGASFHTATAAFTTQGAEVIAIHDQPDGLNINERCGSTH
GLMM_BIFLO      LNDDKTQPKPLKGLKIVADCANGATSVVAPEALRRAGADVIVINASPDGYNINKNAGSTH
GLMM_TROW8      R---------IDGVKVVIDCANGAASGVSPDVFKSAGAAVKVICADPNGVNINDGVGSAY
GLMM_TROWT      R---------IDGVKVVIDCANGAASGVSPDVFKSAGAAVKVICADPNGVNINDGVGSAY
GLMM_SYMTH      L----------SGLRVVVDCGHGAAYRLSPEVLRRLGAEVIALNTAPDGLNINAGCGSTH
GLMM_THET2      ---------DLTGLKVGLDLAHGATYRIGPKLFQKAGAEVMAFFNTPDGRNINRGCGSTH
GLMM_THET8      ---------DLTGLKVGLDLAHGATYRIGPKLFQKAGAEVMAFFNTPDGRNINRGCGSTH
GLMM_DEIRA      ---------DLSGMRIALDCANGAAYRVAPKVFQQAGADVFAVYTTPDGRNINRGCGSTH
GLMM_AGRFC      DV-------TLSGLRIAIDCANGAAYKVAPAALWELGAEVVTIGNEPNGININLECGSTH
GLMM_RHIME      DV-------TLKGLRIAIDCANGAAYKVAPSALWELGAEVVTIGTEPNGVNINLECGSTH
GLMM_BRUME      NI-------SLNGLRVVVDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTH
GLMM_BRUSU      NI-------SLNGLRVVVDCANGAGYKVAPAALWELGAEVITINNEPNGININEDCGSTH
GLMM_RHILO      SM-------SLSGLRIVVDCANGAAYKVAPEALWELGAEVVAINIEPNGFNINKECGSTH
GLMM_BARHE      DV-------RLDNLRIVVDCANGAAYKAAPRALWELGAEVFAINDTPNGTNINHKCGSTD
GLMM_BARQU      DV-------RLDALRIVVDCANGAAYKAAPRALWELGAEVFAINDAPNGTNINQKCGSTD
GLMM_BRADU      DL-------SLDGLRVVVDCANGAAYKVVPEALWELGADVVPIGVEPDGFNINKDCGSTS
GLMM_NITWN      EL-------SLEGLRVVVDCAHGAAYKVVPEALWELGADVVPIGVEPDGLNINKECGSTA
GLMM_RHOPA      EL-------SLEGLRVVIDCANGAAYKVVPEALWELGADVISIGVEPDGFNINKECGSTA
GLMM_CAUVC      HL-------NLSGLRIVIDCANGAAYKVAPTALYELGAEVITLGVSPDGTNINEECGSTH
GLMM_GLUOX      GL-------RLDGLKIVIDCANGSAYRVAPTALWELGAEVIKIGCSPDGLNINDGVGSTH
GLMM_ZYMMO      SL-------RLDKLRLVLDCANGAAYQVAPAVLWELGAEVITLGVAPNGLNINDHCGSTD
GLMM_RUEPO      GL-------RLDGLKVVVDCANGAAHRTAPEILWELGADVVPIGTSPDGLNINRGCGSTC
GLMM_CAMJE      DL-------TLKSLRVVLDVAHGAAYKVAPTVFKELGAEVIVMSDKPNGLNINENCGALH
GLMM_CAMJR      DL-------TLKSLRVVLDVAHGAAYKVAPTVFKELGAEVIVMSDKPNGLNINENCGALH
GLMM_HELPJ      HL-------NLQKLRIVLDTANGAAYKVAPVVFSELGADVLVINDEPNGCNINEQCGALH
GLMM_HELPY      HL-------NLQSLRIVLDTANGAAYKVAPVVFSELGADVLVINDEPNGCNINDQCGALH
GLMM_HELHP      NL-------TLRGLRIVCDCANGAAYRVAPIVLSELGADVIAINDEPNGYNINKQCGAMH
GLMM_WOLSU      EL-------SLHGVRMVLDTANGAAYKVAPTIFSELGAEVFVINDAPNGHNINESCGATQ
GLMM_PELUB      DF-------NLRGLRIVIDCANGAGYKAGPELLKSLGAKVFSIGINPNGLNINKNCGSTF
GLMM_ANAMM      RL-------KLSGMKIVVDCANGAAYHIGGEVFWELGADVVVIGNKPDGLNINHNCGSLH
GLMM_DESPS      KY-------TLDGFHIVIDCAHGATYGVAPHVFEELGAKVTALGIEPNGQNINAGCGALH
GLMM_GEOSL      DL-------DLAGMKIVLDCANGAAYKVAPAVLEELGAEVIPYGVKPNGTNINAGCGSLY
GLMM_DESVH      DL-------TLDGLRVVIDCANGANYKVAPLALEELGAEVIKLGTEPNGLNINHQCGSLY
GLMM_BDEBA      EY-------TLDGMRIVLDTANGASYKVAPSIFQELGAEVIQLGDDPNGTNINDKVGALY
GLMM_CHLAB      GR-------TLKGLKIVLDCAHGAAYKVAPSVFEELDAEVICYGCEPTGSNINDNCGALF
GLMM_CHLCV      GR-------TLKGLKIVLDCAHGAAYKVAPSVFEELDAEVICYGCEPTGSNINDNCGALF
GLMM_CHLPN      GR-------TLKGLKIVLDCAHGASYKVAPSVFEELDAEVICYGCEPTGININEHCGALF
GLMM_CHLMU      GR-------TLKGLRIVLDCAHGAAYRVAPSVFEELDAEVICYGCEPSGCNINEGCGALW
GLMM_CHLTR      GR-------TLKGLRIVLDCAHGATYRVAPSVFEELDAEVICYGCEPSGCNINAGCGALW
GLMM_PARUW      KI-------SLKNLKIVLDCANGAGYKVAPLVFKELDATVFTCGVTPNGLNINSQCGSMH
GLMM_LEGPA      LS-------RLSNLKIVVDCANGATYHIAPNVFSELGADVVPIGIKPDGFNINQECGSTA
GLMM_LEGPH      LS-------RLSNLKIVVDCANGATYHIAPNVFSELGADVVPIGIKPDGFNINQECGSTA
GLMM_LEGPL      LS-------RLSNLKIVVDCANGATYHIAPNVFSELGADVVPIGIKPDGFNINQECGSTA
GLMM_COXBU      NL-------TLKGLKIVVDCANGAAYAVAPSIFHELGAEVVAIADDPDGFNINQTCGATD
GLMM_AROAE      EF-------DLRGYRIVLDCAHGAAYHIGPSVFHELGAEVIPLGVEPNGLNINDQVGATH
GLMM_DECAR      DL-------DLRGLKIVIDCAHGAAYHIAPSVFHELGADVVSIGVQPNGLNINDAVGATA
GLMM_BORBR      DL-------DLNGLKLVVDAAHGAAYNVAPHVFRELGAEVHAIGVSPDGFNINKGVGALH
GLMM_BORPA      DL-------DLNGLKLVVDAAHGAAYNVAPHVFRELGAEVHAIGVSPDGFNINKGVGALH
GLMM_BORPE      DL-------DLNGLKLVVDAAHGAAYNVAPHVFRELGAEVHAIGVSPDGFNINKGVGALH
GLMM_BURMA      AF-------DLRGMKLVVDCAHGAAYQVAPHVFHELGADVIPIGVAPNGFNINDGVGATA
GLMM_BURPS      AF-------DLRGMKLVVDCAHGAAYQVAPHVFHELGADVIPIGVAPNGFNINDGVGATA
GLMM_CUPPJ      SQ-------DLRGLKLVVDCAHGAAYHIAPHVFHELGADVIAIGNQPDGRNINDGYGATA
GLMM_RALSO      DL-------NLFGMKIVLDSAHGAAYHIAPHVFHELGAEVVSIGNQPNGRNINDGYGATE
GLMM_NEIG1      HS-------DLRGLKLVIDTANGAGYGVAPKVFHELGAQVVSIGNEPNGYNINEKCGATH
GLMM_NEIMB      HS-------DLRGLKLVVDTANGAGYGVAPKVFHELGAQVVSIGNEPNGYNINEKCGATY
GLMM_NEIMA      HS-------DLRGLKLVIDTANGAGYGVAPKVFHELGAQVVSIGDEPNGYNINEKCGATY
GLMM_NEISU      HL-------DLRGLKLVVDTAHGAGYDVAPKVFHELGAQVVSIGDEPNGYNINEKCGATH
GLMM_CHRVO      EL-------SLKGLKLVVDCANGATYHIAPKVFHELGAELVEIGCEPNGYNINDKVGATY
GLMM_NITEU      QL-------DLRGLRIVVDCANGADYHIAGHVMHELGADVITTHASPDGFNINYECGATH
GLMM_METCA      GM-------HFSGMKIVVDCAHGSTYHVAPDVFSELRATVSTLGVAPDGLNINDRVGATD
GLMM_NITOC      SV-------DLSELRLVLDCAHGATYQVAPEVFAEMGADITVIGASPNGLNINENCGSTA
GLMM_PSE14      ST-------DFAGLKVVIDCAHGATYKVAPNVFRELGAQVVVLSAQPDGLNINKNCGSTH
GLMM_PSESM      ST-------DFAGLKVVIDCAHGATYKVAPNVFRELGAQVVVLSAQPDGLNINKDCGSTH
GLMM_PSEU2      ST-------DFAGLKVVIDCAHGATYKVAPNVFRELGAQVVVLSAQPDGLNINKDCGSTH
GLMM_PSEF5      ST-------SFAGLKVVLDCAHGATYKVAPSVFRELGAQVTVLSAQPNGLNINENCGSTH
GLMM_PSEPK      ST-------SFEGLKLVVDCAHGATYKVAPSVFRELGADVTVLHAQPDGLNINEGCGSTH
GLMM_PSEAE      ST-------DFNGLKVVLDCANGATYKIAPSVFRELGAEVTVLAASPNGLNINDKCGSTH
GLMM_XANAC      GF-------TLHGLKMVLDCAHGATYHIAPMLFRELGAEVVVIGAAPDGLNINAGVGSTH
GLMM_XANC5      GF-------TLHGLKMVLDCAHGATYHIAPMLFRELGAEVVVIGAAPDGLNINAGVGSTH
GLMM_XANOR      GF-------TLKWLKMVLDCAHGATYHIAPMLFRELGAEVVVIGAAPDGLNINAGVGSTH
GLMM_XANC8      GF-------TLHGLKMVLDCAHGATYHIAPMLFRELGAEVVVIGAAPDGLNINDGVGSTH
GLMM_XANCP      GF-------TLHGLKMVLDCAHGATYHIAPMLFRELGAEVVVIGAAPDGLNINDGVGSTH
GLMM_XYLFA      GF-------TLRGLKLVLDCAHGATYHIAPMLFRELGAELVAIGVDPDGLNINAGVGSTH
GLMM_XYLFT      GF-------TLRGLKLVLDCAHGATYHIAPMLFRELGAELVTIGVDPDGLNINAGVGSTH
GLMM_ECOL6      EL-------SLSELKIVVDCANGATYHIAPNVLRELGANVIAIGCEPNGVNINAEVGATD
GLMM_SHISS      EL-------SLSELKIVVDCANGATYHIAPNVLRELGANVIAIGCEPNGVNINAEVGATD
GLMM_ECO57      EL-------SLSELKIVVDCANGATYHIAPNVLRELGANVIAIGCEPNGVNINAEVGATD
GLMM_ECOLI      EL-------SLSELKIVVDCANGATYHIAPNVLRELGANVIAIGCEPNGVNINAEVGATD
GLMM_SHIFL      EL-------SLSELKIVVDCANGATYHIAPNVLRELGANVIAIGCEPNGVNINAEVGATD
GLMM_SALTI      EL-------SLNGLKVVVDCANGATYHIAPNVLRELGATVIAIGCEPNGVNINEEVGATD
GLMM_SALTY      EL-------SLNGLKVVVDCANGATYHIAPNVLRELGATVIAIGCEPNGVNINEEVGATD
GLMM_SALCH      EL-------SLNGLKVVVDCANGATYHIAPNVLRELGATVIAIGCEPNGVNINEEVGATD
GLMM_SALPA      EL-------SLNGLKVVVDCANGATYHIAPNVLRELGATVIAIGCEPNGVNINEEVGATD
GLMM_YERPE      EL-------SLNELKIVVDCANGATYHIAPSVLRELGATVITIGCEPDGMNINEECGATD
GLMM_YERPS      EL-------SLNELKIVVDCANGATYHIAPSVLRELGATVITIGCEPDGMNINEECGATD
GLMM_PECAS      EL-------SLNGLKIVVDCANGATYHIAPSVLRELGAKVIAIGCEPDGMNINEECGATD
GLMM_PHOLL      EQ-------SLNGLKIVLDCANGATYHIAPNVLRELGADVVTIGCEPNGININEKCGATD
GLMM_PHOPR      QY-------DLSEYKIVVDCAHGATYHIAPNVFRELGAEVITIGCEPNGININDQVGATD
GLMM_ALIF1      EL-------SLAGLKIVIDCANGATYHIAPNVFKELGAEIITIGCEPNGTNINHEVGATD
GLMM_VIBVU      EL-------SLAKLKIVVDCANGATYHIAPNVFTELGADVIAMGVTPNGTNINHEVGATD
GLMM_VIBVY      EL-------SLAKLKIVVDCANGATYHIAPNVFTELGADVIAMGVTPNGTNINHEVGATD
GLMM_VIBPA      TL-------SLSNLKIVVDCAHGATYHIAPNVFKELGADVIAMGVEPNGININEEVGATD
GLMM_VIBCH      KL-------SLSGLKLVVDCANGATYHIAPNVFRELGAEVIAMGVEPNGLNINDQVGATD
GLMM_HAEI8      HL-------GLEGYKIVVDCANGATYHIAPNVLRELGAEVIEIGTDPNGLNINEKCGATD
GLMM_HAEIN      HL-------GLEGYKIVVDCANGATYHIAPNVLRELGAEVIEIGTDPNGLNINEKCGATD
GLMM_MANSM      EL-------SLSGYKIVVDCANGATYHIAPNVMRELGAEVIEIGTSPNGMNINEKCGATD
GLMM_PASMU      HL-------SLENYKIVVDCAHGATYHIAPNVMRELGAEVIEIGAKPNGLNINEKCGATD
GLMM_HAEDU      DA-------SLKGYKIVVDCAHGATYHIAPNVMRELGAEVIEIGTHPNGLNINDKCGATD
GLMM_IDILO      EM-------TLEGLHIVVDCAHGATYHIAPNVLRELGAEVTEIGTQPNGLNINKECGATH
GLMM_COLP3      KI-------SLKDLTIVVDCAHGATYHIAPNVFRELGATVIEIGTAPNGTNINQGCGATS
GLMM_SHEON      DQ-------TLTGLKIVVDCAHGATYHIAPAVFRELGAEVIAIGDKPNGVNINDKVGATS
GLMM_PSEHT      SL-------SLEGLKIVLDCANGATYHIAPSVMRELGANIITHACEPNGVNINHECGATH
GLMM_BLOFL      HL-------SLKKLRIVVDCANGATYHIAPNVLRELGADVIAISCNPNGININNKCGSTD
GLMM_BLOPB      HL-------SLRKLKIIVDCANGATYHIAPSVFRELGANVTTIACRPNGVNINKECGTTD
GLMM_BUCAI      DL-------NLSKFTIILDCANGATFKIAPKIFEDLGARVITVAINPNGVNINQNSGSTN
GLMM_BUCBP      NF-------RLNNFKIVLDCANGSTYELAPIIFRELGANVVLMSAAPNGLNINDKCGTTD
GLMM_WIGBR      NI-------NLKGLNIVVDCANGSTYQIAPVLLKNLGANVFKLGCNPNGKNINYKCGTTN
GLMM_ACIAD      HF-------DLRNLTIVVDCANGAAYNVGPSVFRELGAKVIALYNDPNGMNINEHCGSTH
GLMM_PSYA2      QY-------DLDHLTVVVDCANGAGYSVAPRVMRELGANVIAINHKPDGININAHCGSTH
GLMM_FRATT      FV-------NYKG-KVVVDCAHGAASHNFEALLDKFGINYVSIASNPDGLNINVGCGATC
GLMM_THEMA      LD--------LTGEMVSLDLANGATTTTAREVFEFLGAKVEVFNDSQDGLLINQGCGATH
GLMM_NOSS1      KV-------NLQGMKVVLDLAWGAAVGLAPSVFAEMGAEVISLHNAADGDRINVNCGSTH
GLMM_SYNY3      PL-------NFQGLKVVLDLAWGASVNLAPHIFRSLGAEVIALHDLADGSQINVDCGSTH
GLMM_THEEB      RQ-------PLRGLRVVLDLAWGSAVAVTPTVFHALGAEVIALHDRADGNRINVNCGSTY
GLMM_SYNP6      RA-------NLQGLKIVLDLAWGAAALLAPRLFRELGAEVIALHDLPDGNQINVNCGSTH
GLMM_PROMM      Q--------RLDGVPIVLDLCWGAATACGAEVFAALGADLTVLHGEPDGRRINVGCGSTQ
GLMM_SYNPX      R--------RLNGVPIVLDLCWGSATACAAEVFQTLGADLTVLHGQPDGERINVACGSTQ
GLMM_PROMA      E--------SLIDIPIVLDLCWGSASSCGEKLFKALGANVISINAIPDGEKINVNCGSTH
GLMM_PROMP      E--------NLDGMKIVLDTCYGSATTCAASIFQKLGANVKVINNEQDGLKINLNCGSTC
GLMM_PROM5      E--------NLEGMKIILDACYGSATTCAESVFKKLGANVKVINNDKDGLKINLNCGSTC
GLMM_PROMS      E--------NLSGLKIILDTCYGSATTCAKEIFQSLGADVRVINNSKNGSKINMNCGSTN
GLMM_PROM9      E--------NLSGMKIILDTCYGSATTCAKKIFQSLGADVRVLNNSKNGLKINVNCGSTN
                               :  *   *:                        .  **   *:  

GLMM_BACAN      PEVLAELVKEKGADIGLAFDGDGDRLIAVDEKGNIVDGDQIMFICAKYMKETGQLKHNTV
GLMM_BACCZ      PEVLAELVKEKGADIGLAFDGDGDRLIAVDEKGNIVDGDQIMFICAKYMKETGQLKHNTV
GLMM_BACHK      PEVLAELVKEKGADIGLAFDGDGDRLIAVDEKGNIVDGDQIMFICAKYMKETGQLKHNTV
GLMM_BACC1      PEVLAELVKEKGADIGLAFDGDGDRLIAVDEKGNIVDGDQIMFICAKYMKETGQLKHNTV
GLMM_BACCR      PEGLAELVKEKGADIGLAFDGDGDRLIAVDEKGNIVDGDQIMFICAKYMKETGQLKHNTV
GLMM_BACLD      PEALAEFVKEKGADVGMAFDGDGDRLIAVDEKGNIVDGDQIMYICAKYLKSEGRLTDNTV
GLMM_BACSU      PEALSAFVKEKNADLGLAFDGDGDRLIAVDEKGNIVDGDQIMYICSKHLKSEGRLKDDTV
GLMM_GEOKA      PEALAAFVKEKGADVGLAFDGDGDRLIAVDERGNIVDGDQIMYICAKYLKETGRLKQQTV
GLMM_BACHD      PEALAAFVNAKNADIGLAFDGDADRLIAVDEKGNIVDGDKILYICAKYMKEKGLLKQQTL
GLMM_BACSK      PEELAKLVVEKQADVGLAFDGDADRLIAVDEKGEIVDGDKIMYIIASYLKEQGRLNNNTI
GLMM_LISMF      PEALAAFVLDKKADVGLAFDGDGDRVIAIDEIGQIVDGDKIMFICAKYLREQGLLNNNTI
GLMM_LISMO      PEALAAFVLDKKADVGLAFDGDGDRVIAIDEIGQIVDGDKIMFICAKYLREQGLLNNNTI
GLMM_LISIN      PEALAAFVLDKKADVGLAFDGDGDRVIAIDEIGQIVDGDKIMFICAKYLREQGLLNSNTI
GLMM_OCEIH      PEKLQEFVVEKNADIGLAFDGDGDRLIAVDEKGNLVDGDKIMFICAKYMHEIGMLRKDTV
GLMM_STAAC      PEKLAEKVVETESDFGLAFDGDGDRIIAVDENGQIVDGDQIMFIIGQEMHKNQELNNDMI
GLMM_STAA8      PEKLAEKVVETESDFGLAFDGDGDRIIAVDENGQIVDGDQIMFIIGQEMHKNQELNNDMI
GLMM_STAAM      PEKLAEKVVETESDFGLAFDGDGDRIIAVDENGQIVDGDQIMFIIGQEMHKNQELNNDMI
GLMM_STAAN      PEKLAEKVVETESDFGLAFDGDGDRIIAVDENGQIVDGDQIMFIIGQEMHKNQELNNDMI
GLMM_STAAW      PEKLAEKVVETESDFGLAFDGDGDRIIAVDENGQIVDGDQIMFIIGQEMHKNQELNNDMI
GLMM_STAAR      PEKLAEKVVETESDFGLAFDGDGDRIIAVDENGQIVDGDQIMFIIGQEMHKNQELNNDMI
GLMM_STAAS      PEKLAEKVVETESDFGLAFDGDGDRIIAVDENGQIVDGDQIMFIIGQEMHKNQELNNDMI
GLMM_STAEQ      PEKLAEAVLETESDFGLAFDGDGDRIIAVDENGQIVDGDQIMFIIGQEMYKNQELNGNMI
GLMM_STAES      PEKLAEAVLETESDFGLAFDGDGDRIIAVDENGQIVDGDQIMFIIGQEMYKNQELNGNMI
GLMM_STAS1      PESLAKVVVESECDFGLAFDGDGDRLIAIDEKGNIVDGDQIMFIIGQAMSKNQELNNNMI
GLMM_STAHJ      PELLAEKVLETESDFGLAFDGDGDRLIAVDEKGNIIDGDQIMFVIGQEMHKNQELNNDMI
GLMM_LACAC      TENLQKEVVKQGAQLGLAFDGDADRCIAVDENGNEVDGDHIMYVIGSYLAEHGRLKKDTI
GLMM_LACJO      TKKLQEEVVKQGAQLGLAFDGDADRCIAVDENGNEVDGDHIMYVIGSYLADHGRLKKDTI
GLMM_LACPL      PEALSKFVVEKGAQVGLAFDGDGDRCIAVDELGNIIDGDKIMYICGKFLSERGKLKQDTV
GLMM_STRA3      PEQLQSLVRENGSDIGLAFDGDSDRLIAVDENGEIVDGDKIMFIIGKYLSDKGQLAQNTI
GLMM_STRA5      PEQLQSLVRENGSDIGLAFDGDSDRLIAVDENGEIVDGDKIMFIIGKYLSDKGQLAQNTI
GLMM_STRA1      PEQLQSLVRENGSDIGLAFDGDSDRLIAVDENGEIVDGDKIMFIIGKYLSDKGQLAQNTI
GLMM_STRT1      PEQLQALVRESGSAIGLAFDGDSDRLIAVDENGDIVDGDKVMYIIGKYLSQKGELAKNTI
GLMM_STRT2      PEQLQALVRESGSAIGLAFDGDSDRLIAVDENGDIVDGDKVMYIIGKYLSQKGELAKNTI
GLMM_STRP1      PEQLQELVKETGADLGLAFDGDSDRLIAVDETGEIVDGDRIMFIIGKYLSEKGLLAHNTI
GLMM_STRP3      PEQLQELVKETGADLGLAFDGDSDRLIAVDETGEIVDGDRIMFIIGKYLSEKGLLAHNTI
GLMM_STRP6      PEQLQELVKETGADLGLAFDGDSDRLIAVDETGEIVDGDRIMFIIGKYLSEKGLLAHNTI
GLMM_STRPM      PEQLQELVKETGADLGLAFDGDSDRLIAVDETGEIVDGDRIMFIIGKYLSEKGLLAHNTI
GLMM_STRP8      PEQLQELVKETGADLGLAFDGDSDRLIAVDETGEIVDGDRIMFIIGKYLSEKGLLAHNTI
GLMM_STRMU      PEQLQNLVKGSDFVIGLAFDGDSDRLIAVDENGEIVDGDKIMYIIGKYLSEKGRLSKNTI
GLMM_STRPN      PEALQEVVKESGSAIGLAFDGDSDRLIAVDENGDIVDGDKIMYIIGKYLSEKGQLAQNTI
GLMM_STRR6      PEALQEVVKESGSAIGLAFDGDSDRLIAVDENGDIVDGDKIMYIIGKYLSKKGQLAQNTI
GLMM_LACLA      PEAMAKKVVETGSDLGLAFDGDADRLIAVDENGEIVDGDKIMFIVGKYLLGQGKLAQDTL
GLMM_CLOAB      PEELMDYVVKKNCDLGLAFDGDADRCLAVDEKGNLIDGDFIMAICGKYLKDKGELHKDVV
GLMM_CLOTE      MESLRKYVVEKGCDFGLAFDGDADRCLAVDEKGNIVNGDFMMAICAKYMKDHKKLDKNTM
GLMM_CLOPE      PEELMEYVVKKKCHMGFAFDGDADRCLAVDEQGNLVDGDFILTICAKYLKELGRLKDDTL
GLMM_CALS4      PEKLQQLVVEHKADLGLAFDGDADRLIAVDEKGNIVDGDHIMAICAIDMKSKGKLKHNTV
GLMM_FUSNN      PDILSKVVVGYEADLGLAYDGDADRLIAVDKFGNVIDGDKIIGILALGMKNKGTLKNNKV
GLMM_COREF      MDQIQAAVLEHGADLGLAHDGDADRCLAVDSDGNIVDGDQIMAILAIAMKENSELRKNTL
GLMM_CORGL      IDQVQAAVLKHGADLGLAHDGDADRCLAVDKDGNLVDGDQIMALLAIAMKENGELRKNTL
GLMM_CORDI      IDQVQAAVLEHGADLGLAHDGDADRCLAVDAEGNVVDGDQIMAILALAMKENGELHKSTL
GLMM_CORJK      IEVLQKAVLEHQADLGLAHDGDADRCLAVDSEGNVVDGDQIMAILAVAMKENGELKQNTL
GLMM_MYCBO      LDPLRAAVLAHRADLGLAHDGDADRCLAVDANGDLVDGDAIMVVLALAMKEAGELACNTL
GLMM_MYCTU      LDPLRAAVLAHRADLGLAHDGDADRCLAVDANGDLVDGDAIMVVLALAMKEAGELACNTL
GLMM_MYCLE      LGSLRSAVLAHRADLGLAHDGDADRCLAVDANGDLVDGDAIMVVLALAMQEAGELSSNTL
GLMM_MYCPA      LDSLRAAVVAHRADLGLAHDGDADRCLAVDADGNLVDGDHIMVVLALAMREAGELASDTL
GLMM_NOCFA      LDQVRRAVVEHGADLGLAHDGDADRCLAVAADGSVVDGDAILAVLAIAMKESGELAQDTL
GLMM_STRAW      LAKLRAAVVEHGADLGIAHDGDADRCLAVDHTGAEVDGDQILAVLALAMRERSALRSDTV
GLMM_STRCO      LDLLKAAVVEHGADLGIAHDGDADRCLAVDHTGAEVDGDQILAVLALAMREREALRSDTV
GLMM_THEFY      LDALRAAVLEHGADAGIAHDGDADRCQAVAADGSVVDGDQIMAVLALELYEANALHNNTL
GLMM_LEIXX      LDRLAEAVLAAGADVGIAHDGDADRCLAIDASGRTVDGDQIMAILALGMKERGKLRDDTL
GLMM_CUTAK      PEKLQAKVVEVGADMGLAFDGDADRCLAVDHEGNIVDGDHIIAILALALQEDHRLASNTV
GLMM_BIFLO      PEQLQAMVKATDAVMGVAFDGDADRCLAVDEDGNMINGDQIMGILARAKQREGKLNHDTL
GLMM_TROW8      PERLRAEVIRNSATLGLAFDGDADRCIAVDSNGNTVDGDQIMAILARSMQQRGTLRNKTL
GLMM_TROWT      PERLRAEVIRNSATLGLAFDGDADRCIAVDSNGNTVDGDQIMAILARSMQQRGTLRNKTL
GLMM_SYMTH      PEALQEAVRAHGADAGIAHDGDADRCIAVDERGELVDGDQIMAICALDLKARGQLPNDTL
GLMM_THET2      PEALSRFVVELGLDLGLAFDGDGDRVQFIDRKGRLFHGDHVLYLAALAF------GEKGV
GLMM_THET8      PEALSRFVVELGLDLGIAFDGDGDRVQFIDRKGRLFHGDHVLYLAALAF------GEKGV
GLMM_DEIRA      MDHLRLIVREGDYDLGIAFDGDADRALFVDSRGNMIHGDHMLLLSARAR------GEKAV
GLMM_AGRFC      PEALQKKLHEVRADIGIALDGDADRVIIVDERGEIVDGDQLMAVIADSWAADNTLRGGGI
GLMM_RHIME      PAALQKKVHEVRADIGIALDGDADRVLIVDEEGAVIDGDQLMAVIADSWAADGMLKGGGI
GLMM_BRUME      PIGLMKKVHGVRADVGIALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGI
GLMM_BRUSU      PIGLMKKVHEVRADVGIALDGDADRVLLVDENGTVIDGDQLMAVIAESWAASNRLEGGGI
GLMM_RHILO      PAGLQKKVHEVRADIGIALDGDADRVVIVDENGAIVDGDQIMAMIAESWHQSGRLAGGGV
GLMM_BARHE      LASLKQKVHEVRADVGIALDGDGDRVLLVDEKAQTVDGDQLIAVIAEHWHKNGRLQSKGV
GLMM_BARQU      LASLKQKVHEVRADVGIALDGDGDRVLIVDEKAQTVDGDQLIAVIAEHWHKTGRLQGNGV
GLMM_BRADU      PEALSKKVREMRADIGIALDGDADRVILVDERGHVVDGDQLLAVIAQSWKEDGRLSRPGI
GLMM_NITWN      PEALCRKVREMRGDIGIALDGDADRVIIVDERGHVVDGDQLLAVIAESWKEDGRLTKPGI
GLMM_RHOPA      PQALCAKVREMRADIGIALDGDADRVILVDERGHVVDGDQLLAVIGQSWKEDGRLAKPGV
GLMM_CAUVC      PEAMAKMVREYRADIGIALDGDADRLVICDEKGVVVDGDQIMAIIAAASHKAGTLKGGGV
GLMM_GLUOX      PETLCAAVREHGADFGIALDGDADRVLIADENGNLVDGDQIIGLIAAFWKQHDRLRGNTV
GLMM_ZYMMO      PSALQKKVLETRADLGIALDGDADRVIIVDEKGEIVDGDQIMALIATSAQKRNLLKGNTT
GLMM_RUEPO      PRTASEAVVAHGADVGICLDGDADRVIVIDQLGNVADGDQIMALLAARWAAEGRLQGGAL
GLMM_CAMJE      PANLAAEVKRLRADVGFAFDGDADRLVVVDEKGEVANGDSLLGVLALYLKEQGKLQSS-V
GLMM_CAMJR      PVNLAAEVKRLRADVGFAFDGDADRLVVVDEKGEVANGDSLLGVLALYLKEQGKLQSS-V
GLMM_HELPJ      PNQLSQEVKKYRADLGFAFDGDADRLVVVDNLGNIVHGDKLLGVLGVYQKSKNALSSQAV
GLMM_HELPY      PNQLSQEVKKYRADLGFAFDGDADRLVVVDNLGNIVHGDKLLGVLGVYQKSKNALSSQAV
GLMM_HELHP      PEGLAQEVMTYRADVGFALDGDADRLVVVDNKGNIVNGDKLIGALALYQKQIGKLENNAI
GLMM_WOLSU      PLMLSEEVKRVRADIGFALDGDADRLVVVDERGEVVDGDKLIGALAMHLKNSHTLEKPLA
GLMM_PELUB      PNKIRLAVKRYKAHIGISLDGDADRIIMCDEKGIVIDGDQIIAAIAMRWKRK-KMLKGGV
GLMM_ANAMM      PEGMVQKVLEEGADIGIALDGDADRVVVCDEKGRLVDGDQVIASIMRHLRATKSITDA--
GLMM_DESPS      PELMAGKVKELGADIGLAFDGDGDRLIVCDEHGVVVDGDHVMAICAKELLAQRKSKKKTL
GLMM_GEOSL      PQVISEAVKEHRADLGIALDGDADRVIFVDEFGNEVDGDHIMAICATQMLKQKKLRKNTL
GLMM_DESVH      PEVVAAKVRETRADIGLALDGDADRLIVVDEKGTILDGDQIMALCAQDLMAKGKLPGNML
GLMM_BDEBA      PQKLAESVLHYRADVGISLDGDADRVIMVDEKGEIVNGDRILAICALHMKERGLLKGDTL
GLMM_CHLAB      PSVIQKAVIEHKADVGIALDGDGDRVIMVDEKGHIVDGDMILSICANDLKKKDLLRGNRV
GLMM_CHLCV      PSVIQKAVIEHKADVGIALDGDGDRIIMVNEKGHIVDGDMILSICASDLKKKALLNGNRV
GLMM_CHLPN      PQVIQKAVIEHQAHLGIALDGDGDRIIMVDEKGHIVDGDMILSICAGDLKKRSALPHNRV
GLMM_CHLMU      PSIIQKAVIEHEADVGIALDGDGDRLIMVDEKGHIVDGDMLLSICASDLKRRQALPENRV
GLMM_CHLTR      PSTIQKAVIEHKADVGIALDGDGDRLIMVDEKGHIVDGDMLLSICASDLKRRQALSDNRV
GLMM_PARUW      PETAQKAVIDNRADVGIALDGDADRVVMIDENAQIVDGDTMLAICARDMFKQKLLKNNRV
GLMM_LEGPA      PELLREKVIAVGADIGIGLDGDGDRVILVDSLGNLVDGDQIIYIIAKDR-HQRGVLHGGV
GLMM_LEGPH      PELLREKVIAVGADIGIGLDGDGDRVILVDSLGNLVDGDQIIYIIAKDR-HQRGVLHGGV
GLMM_LEGPL      PELLREKVIAVGADIGIGLDGDGDRVILVDSLGNLVDGDQIIYIIAKDR-HQRGVLHGGV
GLMM_COXBU      TAHLQEMVVKHNADVGIAFDGDGDRLIMVDHHGLRVDGDELLCIMAIDRFYLKENAPLGV
GLMM_AROAE      PQTLRSAVLANKADFGIALDGDGDRVVMVDGDGELYDGDKLLYVIAASR-QAEG-RLEGV
GLMM_DECAR      PKALCEAVLANRADLGIALDGDADRLQMVDAEGNLYDGDQLLYAIVRSR-ARSA-PVKGV
GLMM_BORBR      PESLAEEVRARGADLGIALDGDADRLQMVDGTGRIYNGDELLYAIVRER-MQRG-PVAGV
GLMM_BORPA      PESLAEEVRARGADLGIALDGDADRLQMVDGTGRIYNGDELLYAIVRER-MQRG-PVAGV
GLMM_BORPE      PESLAEEVRARGADLGIALDGDADRLQMVDGTGRIYNGDELLYAIVRER-MQRG-PVAGV
GLMM_BURMA      PDALMRAVRANHADLGIALDGDADRLLVVDHTGRLYNGDELLYVLVKDR-IATNGQVEGA
GLMM_BURPS      PDALMRAVRANHADLGIALDGDADRLLVVDHTGRLYNGDELLYVLVKDR-IATNGQVEGA
GLMM_CUPPJ      PGKLIEAVREHGADLGLAFDGDADRLQVVDSEGRLYNGDELLYLIVRDR-MAAGFAVEGA
GLMM_RALSO      PAKLIEATRQHGADLGLAFDGDADRLQVVDRNGRLYNGDELLYVMVQAR-RAAGQAVPGA
GLMM_NEIG1      TKTLQAAVLQNEADYGIALDGDGDRLMMVDKNRQVYDGDSLIYVIAKAR-AREGINIGGV
GLMM_NEIMB      TKTLQAAVLQHEADYGIALDGDGDRLMMVDKNGQVYDGDSLIYVIAKAR-AREGINIGGV
GLMM_NEIMA      TKTLQAAVLQHEADYGIALDGDGDRLMMVDKNGKVYDGDSLIYVIAKAR-AREGINIGGV
GLMM_NEISU      PKALQAAVLQNEADYGIALDGDGDRLMMVDRNGKVYDGDSLIYVIAKAR-AREGINIGGV
GLMM_CHRVO      PKTLQMAVLEHQADFGIALDGDGDRLIMVDAAGRVYDGDQLIYVIAKAR-AARGELKGGV
GLMM_NITEU      IETLQGSILQHKADIGIAVDGDGDRVLMVSREGVLYDGDSLAYIIAKHR-QQLGELQGGV
GLMM_METCA      PENLRQTVLEENADLGIALDGDGDRLIMVDHRGEVVDGDELLFVIANAR-HAEGELKGSV
GLMM_NITOC      LESLQHKVLECKADVGIALDGDGDRVIMIDQRGEIVDGDDILYIIARAR-QRTSKLTGAV
GLMM_PSE14      MEALQAAVVAEHADMGIGFDGDGDRVLMVDHTGTIVDGDELLYIIARDL-HERGRLQGGV
GLMM_PSESM      MEALQAAVVAEHADMGIGFDGDGDRVLMVDHTGTIVDGDELLYIIARDL-HERGRLQGGV
GLMM_PSEU2      MEALQAAVLAEHADMGIGFDGDGDRVLMVDHTGTIVDGDELLYIIARDL-HERGRLQGGV
GLMM_PSEF5      MSQLQAAVLAEHADLGIAFDGDGDRVLMVDQTGAIVDGDELLFIIARDL-HERDKLQGGV
GLMM_PSEPK      IESLQAAVLVGHADLGIAFDGDGDRVLMVDHTGAIVDGDELLFIIARDL-QEHGKLQGGV
GLMM_PSEAE      LDGLQAAVVEHHADLGIAFDGDGDRVMMVDHTGAVVDGDELLFLIARDL-QESGRLQGGV
GLMM_XANAC      IDNLAAKVRECGAHLGIAFDGDGDRVLMADDQGNPVDGDDLLYVLARSW-QASGRLTGTV
GLMM_XANC5      IDNLAAKVRECGAHLGIAFDGDGDRVLMADDQGNPVDGDDLLYVLARSW-QASGRLTGTV
GLMM_XANOR      IDNLAAKVREYGAHLGIAFDGDGDRVLMADDQGNPVDGDDLLYVLARSW-QASGRLTGTV
GLMM_XANC8      IDNLAAKVRETGAQLGIAFDGDGDRVLMADDQGNPVDGDDLLYVLARSW-QASGRLTGTV
GLMM_XANCP      IDNLAAKVRETGAQLGIAFDGDGDRVLMADDQGNPVDGDDLLYVLARSW-QASGRLTGTV
GLMM_XYLFA      LETLAATVRESGADLGIAFDGDGDRVLMTDAQGRTVDGDDLLYVLARAW-RASGRLKGTV
GLMM_XYLFT      LETLAATVRESGADLGIAFDGDGDRVLMTDAQGRTVDGDDLLYVLARAW-RASGRLKGTV
GLMM_ECOL6      VRALQARVLAEKADLGIAFDGDGDRVIMVDHEGNKVDGDQIMYIIAREG-LRQGQLRGGA
GLMM_SHISS      VRALQARVLAEKADLGIAFDGDGDRVIMVDHEGNKVDGDQIMYIIAREG-LRQGQLRGGA
GLMM_ECO57      VRALQARVLAEKADLGIAFDGDGDRVIMVDHEGNKVDGDQIMYIIAREG-LRQGQLRGGA
GLMM_ECOLI      VRALQARVLAEKADLGIAFDGDGDRVIMVDHEGNKVDGDQIMYIIAREG-LRQGQLRGGA
GLMM_SHIFL      VRALQARVLAEKADLGIAFDGDGDRVIMVDHEGNKVYGDQIMYIIAREG-LRQGHLRGGA
GLMM_SALTI      VRALQARVLAEKADLGIALDGDGDRVIMVDHEGNKVDGDQIMYIIAREG-LRQGQLRGGA
GLMM_SALTY      VRALQARVLAEKADLGIALDGDGDRVIMVDHEGNKVDGDQIMYIIAREG-LRQGQLRGGA
GLMM_SALCH      VRALQARVLAEKADLGIALDGDGDRVIMVDHEGNKVDGDQIMYIIAREG-LRQGQLRGGA
GLMM_SALPA      VRALQARVLVEKADLGIALDGDGDRVIMVDHEGNKVDGDQIMYIIAREG-LRQGQLRGGA
GLMM_YERPE      VRLLQERVLAEGAHVGLAFDGDGDRLMMVDHLGNKVDGDQILYIIAREG-LRQGQLKGGA
GLMM_YERPS      VRLLQERVLAEGAHVGLAFDGDGDRLMMVDHLGNKVDGDQILYIIAREG-LRQGQLKGGA
GLMM_PECAS      VRQLQARVLAEKADVGLAFDGDGDRLIMVDHLGNKVDGDQILYIIAREG-LRQGQLRGGA
GLMM_PHOLL      VRLLQQRVVEEKADVGLAFDGDGDRVIMVDHLGQKVDGDQILYIIAREA-LRQGQLRGGV
GLMM_PHOPR      VRALQAKVLEEKADFGIALDGDGDRVIMVDNEGNKVDGDQIAYIVARDA-LRRGELKGGV
GLMM_ALIF1      VRALQAKVVEEKADFGVAFDGDGDRIIMVDEFGEKVDGDQIAYIIARDALRRGE-LKGGV
GLMM_VIBVU      VRALQQRVVEEQADLGLAFDGDGDRIIMVDHLGNKVDGDQIAYIIARDA-LRRGELKGGV
GLMM_VIBVY      VRALQQRVVEEQADLGLAFDGDGDRIIMVDHLGNKVDGDQIAYIIARDA-LRRGELKGGV
GLMM_VIBPA      VRALQKRVVEEQAHLGLAFDGDGDRIIMVDHLGNKVDGDQIAYIIARDA-LRRGELKGGV
GLMM_VIBCH      VRALQKRVVEEHAHLGLAFDGDGDRIIMVDHLGNKVDGDQIAYIIARDA-LRRGELKGGV
GLMM_HAEI8      VTALQAKVVETKADVGLAYDGDGDRIMMVDHLGNKVDGDQILFIIAREA-LRSGQLKGGV
GLMM_HAEIN      VTALQAKVVETKADVGLAYDGDGDRIMMVDHLGNKVDGDQILFIIAREA-LRSGQLKGGV
GLMM_MANSM      IKALKAKVLETKADVGLAYDGDGDRIMMVDHLGNVVDGDQILFIIARED-LRAGKLKGGV
GLMM_PASMU      IKALQEKVLEVKADVGLAYDGDGDRLIMVDHLGNKVDGDQVLFIIAREA-LRAGHLKGGV
GLMM_HAEDU      ISALQQAVLTSKADLGVAYDGDGDRIIMVDHLGNKVDGDQILFIIAREA-LRSGKLKGGV
GLMM_IDILO      LTALQNKVLETKADLGIALDGDGDRIMMVTENGRPIDGDEILYMLAVTA-QNQGQLQGGV
GLMM_COLP3      MAAISKAVVEHKADLGIALDGDGDRIMMVDHTGYVIDGDEIIYIIACND-LKTGRKEGGV
GLMM_SHEON      MAKICETVLAETADLGIALDGDGDRIMMVNSKGEVIDGDQILYILACDA-KARGVLRGGV
GLMM_PSEHT      VDTLKRKVLEHNADVGIAYDGDGDRVMMVDHNGRVFDGDDLVYIIACQA-AQDDNLGGGV
GLMM_BLOFL      IRRLRTQVLLKKADLGIAYDGDGDRVIMVDHIGNKVDGDQMLYILAKEY-LYQRKLHGGI
GLMM_BLOPB      IRQLRAHVLAKKADLGIAYDGDGDRVIMVDHFGNKVDGDQMLYIIAREK-LHCKQLTGGI
GLMM_BUCAI      ILMLKKIVLSESADLGLAFDGDGDRVIMVDHLGNQVDGDQIIYIIAKEY-LKENKLKGGV
GLMM_BUCBP      LQEIQRLVLSEKADLGISFDGDGDRVIMIDHFGNSVNGDQILYILAKNY-KKNKKLRGGV
GLMM_WIGBR      ISLLRKKVLQNKAHLGIAYDGDGDRIIMIDHLGNIVNGDQILYIIACDK-LKNKKLNGGV
GLMM_ACIAD      PENLQKAVVHYKADLGIAFDGDADRVILVDKFGELVDGDHILYILATQA----KKKPAGI
GLMM_PSYA2      PEGLQAAVLKYEADVGIALDGDGDRIVMVDEAGHLVDGDGILYVLATQG----QTKVAGV
GLMM_FRATT      VSNIKKAVKEQKADLGISLDGDADRIIIVDENGQEIDGDGILNILAQYS--DICGGTNGI
GLMM_THEMA      PRFLAEEMK--NGKVGFTFDGDGDRVIAVDEERNVVNGDRIIGILAVGLKEEGRLNSDTV
GLMM_NOSS1      LEMLQAAVQEHNADLGFAFDGDADRVLAVDPTGRPVNGDYILYLWGLYLKQQNQLPDNLI
GLMM_SYNY3      LHRLQRAVRETGADLGFAFDGDADRVMAVDAQGRPVDGDYILFLWGKTLQESNHLPDNLI
GLMM_THEEB      LEPLQQAVREARAAMGFAFDGDADRVLAVDSQGRVVDGDHILYFWGQQLQSQAQLPKDLI
GLMM_SYNP6      LARLQAAVLEQGADMGFAFDGDADRVLAVDGRGRSVDGDHILFLWGRELEQQQQLPGQAI
GLMM_PROMM      LEPLRRAVIERGAIMGFAFDGDADRMLALDGHGRVVDGDHVLYLWGSDLQDRQALPQQRL
GLMM_SYNPX      LDPLRQAVVAQGAVMGFAFDGDADRMLAVDARGRVVDGDHVLYLWGSVLQDQKALPGDRL
GLMM_PROMA      LEHIKKVVLESNAQMGFAFDGDADRMIAIDGKGRVIDGDHSLYLWGSSLQDKNMLPEQRL
GLMM_PROMP      LDPIIKAIKENNADMGFSFDGDADRVIGVDSEGNIIDGDHILFLWGRELLEEKLLTNNTI
GLMM_PROM5      LDPLNKAIKENDADMGFSFDGDADRVIGVDSKGNILDGDHILFLWGRELLEEKVLTNNTI
GLMM_PROMS      LAPLKKALKESPADMGFSFDEDADRVIGIDSKGNVLDGDHILFLWGRELMEQKILTNNLL
GLMM_PROM9      LEPLKKALRQSPADMGFSFDGDSDRVIGLDSKGNVLDGDHILFLWGRELMEQKILTNNLL
                               *.  * *.**            **                     

GLMM_BACAN      VSTVMSNLGFYKALEANGITSDKTAVGDRYVMEEMKRGGYNLGGEQSGHIILLDYITTGD
GLMM_BACCZ      VSTVMSNLGFYKALEANGITSDKTAVGDRYVMEEMKRGGYNLGGEQSGHIILLDYITTGD
GLMM_BACHK      VSTVMSNLGFYKALEANGITSDKTAVGDRYVMEEMKRGGYNLGGEQSGHIILLDYITTGD
GLMM_BACC1      VSTVMSNLGFYKALEANGITSDKTAVGDRYVMEEMKRGGYNLGGEQSGHIILLDYITTGD
GLMM_BACCR      VSTVMSNLGFYKALEANNITSDKTAVGDRYVMEEMKRGGYNLGGEQSGHIILLDYITTGD
GLMM_BACLD      VSTVMSNLGFYKALEAEGIKSVQTAVGDRYVVEAMKKGGFTLGGEQSGHLIFLDYNTTGD
GLMM_BACSU      VSTVMSNLGFYKALEKEGIKSVQTAVGDRYVVEAMKKDGYNVGGEQSGHLIFLDYNTTGD
GLMM_GEOKA      VSTVMSNLGFYKALEAQGIKSVQTAVGDRYVVEEMKKNGYNLGGEQSGHIIFLDYNTTGD
GLMM_BACHD      VTTVMSNLGLYKALEALQIDTKQTAVGDRYVMEEMRKGGYNLGGEQSGHIIFLDHITTGD
GLMM_BACSK      VTTVMSNLGFYKALEEKQIETKQTAVGDRYVMEEMRKGNYNLGGEQSGHIIFLDYNTTGD
GLMM_LISMF      VSTVMSNLGFYKGLKELEIEDVQTAVGDRYVVEAMREGNYNLGGEQSGHIIFLDHNTTGD
GLMM_LISMO      VSTVMSNLGFYKGLKELEIEDVQTAVGDRYVVEAMREGNYNLGGEQSGHIIFLDHNTTGD
GLMM_LISIN      VSTVMSNLGFYKGLRELEIEDVQTAVGDRYVVEAMREGNYNLGGEQSGHIIFLDHNTTGD
GLMM_OCEIH      VSTVMSNLGFYKALENIGLNSNKTSVGDRYVMEEMRQNGYNLGGEQSGHIIFLDYITTGD
GLMM_STAAC      VSTVMSNLGFYKALEQEGIKSNKTKVGDRYVVEEMRRGNYNLGGEQSGHIVMMDYNTTGD
GLMM_STAA8      VSTVMSNLGFYKALEQEGIKSNKTKVGDRYVVEEMRRGNYNLGGEQSGHIVMMDYNTTGD
GLMM_STAAM      VSTVMSNLGFYKALEQEGIKSNKTKVGDRYVVEEMRRGNYNLGGEQSGHIVMMDYNTTGD
GLMM_STAAN      VSTVMSNLGFYKALEQEGIKSNKTKVGDRYVVEEMRRGNYNLGGEQSGHIVMMDYNTTGD
GLMM_STAAW      VSTVMSNLGFYKALEQEGIKSNKTKVGDRYVVEEMRRGNYNLGGEQSGHIVMMDYNTTGD
GLMM_STAAR      VSTVMSNLGFYKALEQEGIKSNKTKVGDRYVVEEMRRGNYNLGGEQSGHIVMMDYNTTGD
GLMM_STAAS      VSTVMSNLGFYKALEQEGIKSNKTKVGDRYVVEEMRRGNYNLGGEQSGHIVMMDYNTTGD
GLMM_STAEQ      VSTVMSNLGFYKALEKEGIQSNKTKVGDRYVVEEMRRGNYNLGGEQSGHIVLMDYNTTGD
GLMM_STAES      VSTVMSNLGFYKALEKEGIQSNKTKVGDRYVVEEMRRGNYNLGGEQSGHIVLMDYNTTGD
GLMM_STAS1      VSTVMSNLGFYKALENEGIQSNKTKVGDRYVVEEMRRGNYNLGGEQSGHIVLMDYNTTGD
GLMM_STAHJ      VSTVMSNLGFYKALENEGIKSNKTKVGDRYVVEEMRKGNYNLGGEQSGHIVMMDYNTTGD
GLMM_LACAC      VTTVMSNLGFTKALEKEDLKNVRTQVGDRYVSEEMRAHGYNLGGEQSGHVIMSDYHNTGD
GLMM_LACJO      VTTVMSNLGFTKALERRGLKNIRTQVGDRYVSEEMRANGYNLGGEQSGHVIISDYHNTGD
GLMM_LACPL      VTTVMSNLGLYKALEAAGLHSKQTQVGDRYVVEEMLKDGYNLGGEQSGHVVFLDFNTTGD
GLMM_STRA3      VTTVMSNLGFHKALDREGIHKAITAVGDRYVVEEMRKSGYNLGGEQSGHVIIMDYNTTGD
GLMM_STRA5      VTTVMSNLGFHKALDREGIHKAITAVGDRYVVEEMRKSGYNLGGEQSGHVIIMDYNTTGD
GLMM_STRA1      VTTVMSNLGFHKALDREGIHKAITAVGDRYVVEEMRKSGYNLGGEQSGHVIIMDYNTTGD
GLMM_STRT1      VTTVMSNLGFHKALDREGINKAVTAVGDRYVVEEMRKNGYNLGGEQSGHVIIMDYNTTGD
GLMM_STRT2      VTTVMSNLGFHKALDREGINKAVTAVGDRYVVEEMRKNGYNLGGEQSGHVIIMDYNTTGD
GLMM_STRP1      VTTVMSNLGFHKALDKQGINKAITAVGDRYVVEEMRSSGYNLGGEQSGHVIIMDYNTTGD
GLMM_STRP3      VTTVMSNLGFHKALDKQGINKAITAVGDRYVVEEMRSSGYNLGGEQSGHVIIMDYNTTGD
GLMM_STRP6      VTTVMSNLGFHKALDKQGINKAITAVGDRYVVEEMRSSGYNLGGEQSGHVIIMDYNTTGD
GLMM_STRPM      VTTVMSNLGFHKALDKQGINKAITAVGDRYVVEEMRSSGYNLGGEQSGHVIIMDYNTTGD
GLMM_STRP8      VTTVMSNLGFHKALDKQGINKAIAAVGDRYVVEEMRSSGYNLGGEQSGHVIIMDYNTTGD
GLMM_STRMU      VTTVMSNLGFHKALDRENINKKITAVGDRYVVEEMRRSGYNLGGEQSGHVIIMDYNTTGD
GLMM_STRPN      VTTVMSNLGFHKALNREGINKAVTAVGDRYVVEEMRKSGYNLGGEQSGHVILMDYNTTGD
GLMM_STRR6      VTTVMSNLGFHKALNREGINKAVTAVGDRYVVEEMRKSGYNLGGEQSGHVILMDYNTTGD
GLMM_LACLA      VTTVMSNLGFHLALEEAGINSVITAVGDRYVVEEMKKNNYNFGGEQSGHMIFLDYNTTGD
GLMM_CLOAB      VVTVMSNMGLFLALDKANIKTVKTKVGDRYVLEEMLKEGYKLGGEQSGHIIFLDYNTTGD
GLMM_CLOTE      VVTVMSNIGLFIAMEREKIDLIKTKVGDRYVLEEMLKEGYKIGGEQSGHIIFLDYNTTGD
GLMM_CLOPE      VVTVMSNLGLMIACKNEKINTAVTKVGDRYVLEEMLAKGYSLGGEQSGHIIFLDHNSTGD
GLMM_CALS4      VATVMSNIGFEIALKEHGIKLIRTKVGDRYVLEEMIKGGYSIGGEQSGHIIFIDDNTTGD
GLMM_FUSNN      VTTVMSNIGFEKYLKENSIELLRANVGDRYVLEKMLAEDVVIGGEQSGHIILKDYATTGD
GLMM_COREF      VATVMSNLGLKLAMEKADIQLRTTKVGDRYVLEELNAGGFALGGEQSGHIVLPDHGTTGD
GLMM_CORGL      VGTVMSNLGLKIAMDEAGITLRTTKVGDRYVLEDLNAGGFSLGGEQSGHIVLPDHGTTGD
GLMM_CORDI      VATVMSNLGLRLAMKEAGIELRTTKVGDRYVLEELNAGGFSLGGEQSGHIVLPDHGTTGD
GLMM_CORJK      VATVMSNLGMKLAMRANGIKVLETQVGDRYVLAELLASDLSLGGEQSGHVIISEHATTGD
GLMM_MYCBO      VATVMSNLGLHLAMRSAGVTVRTTAVGDRYVLEELRAGDYSLGGEQSGHIVMPALGSTGD
GLMM_MYCTU      VATVMSNLGLHLAMRSAGVTVRTTAVGDRYVLEELRAGDYSLGGEQSGHIVMPALGSTGD
GLMM_MYCLE      VTTVMSNLGLHLAMRSVGVIVRTTDVGDRYVLEELRAGDFSLGGEQSGHIVMPALGSTGD
GLMM_MYCPA      VTTVMSNLGLHLAMRSAGITVRTTGVGDRYVVEELRAGDFSLGGEQSGHIVMPALGSTGD
GLMM_NOCFA      VATVMSNLGLHLAMRAAGIAVRTTAVGDRYVLEELRAGGYTLGGEQSGHVVFPKYGTTGD
GLMM_STRAW      VATVMSNLGFKLAMEREGLSFVQTAVGDRYVLEEMKEHGYALGGEQSGHVIILDHATTGD
GLMM_STRCO      VATVMSNLGFKLAMEREGIRFVQTGVGDRYVLEEMKEHGYALGGEQSGHVIILDHATTGD
GLMM_THEFY      VVTVMSNLGLKLAMKEAGITLVETQVGDRYVLEAMRAGSYSLGGEQSGHIILLDHATTGD
GLMM_LEIXX      VATVMSNLGLKLAMREAGVRVVETAVGDRYVLEEMNGHGYSLGGEQSGHVIMSDFATTGD
GLMM_CUTAK      VATIMSNLGLIIAMRAHDIHVDQTKVGDRYVLESMNANGFSLGGEQSGHVIMSEFATTGD
GLMM_BIFLO      VVTVMSNLGLKLALKDMGIKTVETAVGDRYVLEEMLKGDYSLGGEQSGHVINREFATTGD
GLMM_TROW8      VTTIMSNIGLDRAMKKLGINLKRTQVGDRYVIEAMTQGGFNIGGEQSGHIILSDYSTAGD
GLMM_TROWT      VTTIMSNIGLDRAMKKLGINLKRTQVGDRYVIEAMTQGGFNIGGEQSGHIILSDYSTAGD
GLMM_SYMTH      VTTVMSNMGLEMLMRRHGIRLVRTKVGDRYVLEEMLKGGHGLGGEQSGHVIFGALSTTGD
GLMM_THET2      VGTVMSNMALEVALKERGLAFHRAAVGDRYVLEKLKETGLALGGEPSGHVIFLRHHTTGD
GLMM_THET8      VGTVMSNMALEVALKERGLAFHRAAVGDRYVLEKLKETGLALGGEPSGHVIFLRHHTTGD
GLMM_DEIRA      VATIMTNMALEVKLQEAGLTLERTAVGDRYVHERLHAKGLNLGGEQSGHVLFLDVSPTGD
GLMM_AGRFC      VATVMSNLGLERFLGDKGLTLARTKVGDRYVVEHMRNHNFNVGGEQSGHIVLSDYGTTGD
GLMM_RHIME      AATVMSNLGLERYLQARRLKLHRTKVGDRYVVEQMRQDGLNVGGEQSGHIVLSDFGTTGD
GLMM_BRUME      VATVMSNLGLERFLADRNLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGD
GLMM_BRUSU      VATVMSNLGLERFLADRNLTLARTKVGDRYVVEHMREHGFNVGGEQSGHIVLSDFATTGD
GLMM_RHILO      VSTVMSNLGLERFLGDMKLQLHRTKVGDRYVVEHMRAHGLNVGGEQSGHIVLSDFSTTGD
GLMM_BARHE      VTTIMSNLGLERFLNSKGLDLVRTKVGDRYVVDAMRKKGYNVGGEASGHIVLSDFGTTGD
GLMM_BARQU      VTTIMSNLGLERFLNRKGLELVRTNVGDRYVVDAMRQKGYNIGGEASGHIVLSDFGTTGD
GLMM_BRADU      VATVMSNLGLERFLKGQGLDLVRTPVGDRYVLEQMLSGGYNLGGEQSGHIILSDYATTGD
GLMM_NITWN      VATVMSNLGLERFLKDRDLSLVRTPVGDRYVLEQMLKQGYNLGGEQSGHIILSDYATTGD
GLMM_RHOPA      VATVMSNLGLERFLAGEGIALLRTPVGDRYVLEQMLKDGYNVGGESSGHIILSDFNTTGD
GLMM_CAUVC      VATVMSNLGLERQLNTMGLSLERTAVGDRYVMQRMREGGFNVGGEQSGHLILSDFSTTGD
GLMM_GLUOX      VTTVMSNMGLEKALAENGLELQRTAVGDRYVVERMREIGANLGGEQSGHMVLSDYATTGD
GLMM_ZYMMO      VATVMSNLGLERYLSKLGIQLLRTQVGDRHVVEAMRAGGYTVGGEQSGHIILSYHTTTGD
GLMM_RUEPO      VATVMSNLGLERFLGDRGIGLERTAVGDRYVVERMREGGFNLGGEQSGHIVMSDFATTGD
GLMM_CAMJE      VATIMSNGALKEFLNKHGIELDTCNVGDKYVLEKLKANGGNFGGEQSGHIIFSDYAKTGD
GLMM_CAMJR      VATIMSNGALKEFLNKHGIELDTCNVGDKYVLEKLKANGGNFGGEQSGHIIFSDYAKTGD
GLMM_HELPJ      VATSMSNLALKEYLKSQDLELKHCAIGDKFVSECMRLNKANFGGEQSGHIIFSDYAKTGD
GLMM_HELPY      VATNMSNLALKEYLKSQDLELKHCAIGDKFVSECMQLNKANFGGEQSGHIIFSDYAKTGD
GLMM_HELHP      VATLMSNLALEEFLKSHQIGLHRCNVGDKYVWDKMREHKLNFGGESSGHIIFSDYAKTGD
GLMM_WOLSU      VATVMSNLALEEFLAKAKIKLLRAGVGDKYVLEMMQKEGANFGGEQSGHLIFSDFAKTGD
GLMM_PELUB      VGTLMSNYGLEKFFKLHNIKFLRSNVGDRFVKEKMQKNNFNLGGEQSGHIILGKFATTGD
GLMM_ANAMM      AVTTMSSKSIDSYARELGVRLHRSEVGDRHLVDTMRRHSCSVGGEKSGHIILWEHSTTSD
GLMM_DESPS      VATVMSNMGLEVAMKKMGGHLVRADVGDRYVVECMRKNGYSFGGEQSGHLVFLEHMTTGD
GLMM_GEOSL      VATVMSNMGLDIAVKRAGGKVVKTAVGDRYVVEEMIKGGYNLGGEQSGHMIFLDPNTTGD
GLMM_DESVH      VATVMSNMALEVFMKEHGGTLLRTAVGDRYVVEAMRQHGALLGGEQSGHLIFREYSTTGD
GLMM_BDEBA      VATQMSNFGLEKRMNEAGIKLVKTGVGDKYVVEEMRKHGYNLGGEQSGHIIFLDHTTTGD
GLMM_CHLAB      IATVMTNFGVLKYLESVGIEALISPVGDRHVLQNMLEYEVNLGGEQSGHMIFLDYNTTGD
GLMM_CHLCV      VATVMTNFGVLKYLESLGIETLISSVGDRHVLQNMLEHEANLGGEQSGHMIFLDYNTTGD
GLMM_CHLPN      VATIMTNFGVLKYLEGLGLQVFTSPVGDRHVLHAMLEHEVTLGGEQSGHMIFLDYNTTGD
GLMM_CHLMU      VATVMTNFGVLRYLESLGIQVTISPVGDRHVLQHMLETKAILGGEQSGHMIFLDYNTTGD
GLMM_CHLTR      VATVMTNFGVLRYLESLGIQVTISPVGDRHVLQHMLENQAVLGGEQSGHMIFLDYNTTGD
GLMM_PARUW      VGTVMSNLGFIKAMECLGVEVIKSQVGDRYVIQDMLKYDANLGGEQSGHVIFLDHNTTGD
GLMM_LEGPA      VGTLMSNYGLELAITSLGVPFQRSKVGDRYVLETLREKDWKIGGETSGHIVCLDKTTTGD
GLMM_LEGPH      VGTLMSNYGLELAITSLGVPFQRSKVGDRYVLETLREKDWKIGGETSGHIVCLDKTTTGD
GLMM_LEGPL      VGTLMSNYGLELAITSLGVPFQRSKVGDRYVLEMLREKDWKIGGETSGHIVCLDKTTTGD
GLMM_COXBU      VGTIMSNLGLEHTLKRHHIAFERSPVGDRYVLDLMQQKGWFLGGESSGHIVDLGFTTTGD
GLMM_AROAE      VGTLMSNLGLERAIGRLGLAFARAKVGDRYVLETMHERGWRLGGENSGHIICLDRHTTGD
GLMM_DECAR      AGTLMSNLALEHALAKLNIPFARAAVGDRYVVEMLSEKGWLFGGENSGHILALDRHTTGD
GLMM_BORBR      VGTLMTNYGLERQLQQIGVGFERANVGDRYVLEQMQARGWLYGGESSGHLLCLDCHTTGD
GLMM_BORPA      VGTLMTNYGLERQLQQIGVGFERANVGDRYVLEQMQARGWLYGGESSGHLLCLDCHTTGD
GLMM_BORPE      VGTLMTNYGLERQLQQIGVGFERANVGDRYVLEQMQARGWLYGGESSGHLLCLDCHTTGD
GLMM_BURMA      VGTLMTNFAVEVALKEAGVQFVRAAVGDRYVLEQLRERGWQLGAEGSGHILSLDRHSTGD
GLMM_BURPS      VGTLMTNFAVEVALKEAGVQFVRAAVGDRYVLEQLREHGWQLGAEGSGHILSLDRHSTGD
GLMM_CUPPJ      VGTLMTNMAVELALKRIGVEFVRAKVGDRYVLEELNKRHWTLGGEGSGHLLCLDRHSTGD
GLMM_RALSO      VGTLMTNLAVELALKAQGVEFVRAKVGDRYVLEELKKHGWLLGGEGSGHLLCLDKHSTGD
GLMM_NEIG1      VGTVMTNMAMEIALKEQGVDFCRAKVGDRYVLEQLNQRGWLIGGEASGHILCMDKHNTGD
GLMM_NEIMB      VGTVMTNMAMEIALKEQGVDFCRAKVGDRYVLEQLNQRGWLIGGEASGHILCMDKHNTGD
GLMM_NEIMA      VGTVMTNMAMEIALKEQGVDFCRAKVGDRYVLEQLNQRSWLIGGEASGHILCMDKHNTGD
GLMM_NEISU      VGTVMTNMAMEIALKEQGVDFCRAKVGDRYVLEQLNQRGWLIGGEASGHILCMDKHNTGD
GLMM_CHRVO      VGTVMTNMAMELALQKQGVPFGRAKVGDRYVLEMLHADGWQVGGEASGHILCLDKHSTGD
GLMM_NITEU      AGTLMTNLAVEQAFERLGIPFARANVGDRYVSELLQQNDWYLGAENSGHIICRDKHTTGD
GLMM_METCA      VGTLMSNLGLEQAIRRLGLEFRRAAVGDRYVMEMMLEHGSMLGGEGSGHIICRDRTTTGD
GLMM_NITOC      VGTLMSNLGLEKALATLGIPLMRSQVGDRYVLEMLQCNGYSLGGESSGHIICLDRTTTGD
GLMM_PSE14      VGTLMSNLGLELALAEQSIPFVRANVGDRYVIAELLERNWQIGGENSGHIVCFQHATTGD
GLMM_PSESM      VGTLMSNLGLELALAEQNIPFVRANVGDRYVIAELLERNWQIGGENSGHIVCFQHATTGD
GLMM_PSEU2      VGTLMSNLGLELALAEQGIPFVRANVGDRYVIAELLERNWQIGGENSGHIVCFQHATTGD
GLMM_PSEF5      VGTLMSNLGLELALADLGIPFVRANVGDRYVIAELLERNWLVGGENSGHIVCFRHATTGD
GLMM_PSEPK      VGTLMSNLGLELALKDLDIPFVRAKVGDRYVMAELLEREWLVGGENSGHVVCCNHTTTGD
GLMM_PSEAE      VGTLMSNLGLELALQELHIPFVRAKVGDRYVMAELLARNWMLGGENSGHIVCCQNTTTGD
GLMM_XANAC      VGTLMTNYGLEQALAALHIPFQRAKVGDRYVHQALVEGGGTLGGETSGHLLCLDRASTGD
GLMM_XANC5      VGTLMTNYGLEQALAALHIPFQRAKVGDRYVHQALVEGGGTLGGETSGHLLCLDRASTGD
GLMM_XANOR      VGTLMTNYGLEQALAALNIPFQRAKVGDRYVHQALVEGGGTLGGETSGHLLCLDRATTGD
GLMM_XANC8      VGTLMTNYGLEKALAALQIPFQRAKVGDRYVHQALVEGGGTLGGETSGHLLCLDRATTGD
GLMM_XANCP      VGTLMTNYGLEKALAALQIPFQRAKVGDRYVHQALVEGGGTLGGETSGHLLCLDRATTGD
GLMM_XYLFA      VGTLMSNYGLEQALGTLGIPFIRAKVGDRYVHQALVESGGVLGGEASGHLLCLDRATTGD
GLMM_XYLFT      VGTLMSNYGLEQALGTLGIPFIRARVGDRYVHQALVESGGVLGGEASGHLLCLDRATTGD
GLMM_ECOL6      VGTLMSNMGLELALKQLGIPFARAKVGDRYVLEKMQEKGWRIGAENSGHVILLDKTTTGD
GLMM_SHISS      VGTLMSNMGLELALKQLGIPFARAKVGDRYVLEKMQEKGWRIGAENSGHVILLDKTTTGD
GLMM_ECO57      VGTLMSNMGLELALKQLGIPFARAKVGDRYVLEKMQEKGWRIGAENSGHVILLDKTTTGD
GLMM_ECOLI      VGTLMSNMGLELALKQLGIPFARAKVGDRYVLEKMQEKGWRIGAENSGHVILLDKTTTGD
GLMM_SHIFL      VGTLMSNMGLELALKQLGIPFARAKVGDRYVLEKMQEKGWRIGAENSGHVILLDKTTTGA
GLMM_SALTI      VGTLMSNMGLELALKQLGIPFARAKVGDRYVLEKLQEKGWRIGAENSGHVILLDKTTTGD
GLMM_SALTY      VGTLMSNMGLELALKQLGIPFARAKVGDRYVLEKLQEKGWRIGAENSGHVILLDKTTTGD
GLMM_SALCH      VGTLMSNMGLELALKQLGIPFSRAKVGDRYVLEKLQEKGWRIGAENSGHVILLDKTTTGD
GLMM_SALPA      VGTLMSNMGLELALKQLGIPFARAKVGDRYVLEKLQEKGWRIGAENSGHVILLDKTTTGD
GLMM_YERPE      VGTLMSNMGLQLALKDLGIPFVRAKVGDRYVLEAMQEKGWRIGAENSGHVILLDKTTTGD
GLMM_YERPS      VGTLMSNMGLQLALKDLGIPFVRAKVGDRYVLEAMQEKGWRIGAENSGHVILLDKTTTGD
GLMM_PECAS      VGTLMSNMGLEVALKQLGIPFARAKVGDRYVLEMMQTKGWRIGAENSGHVILLDKTTTGD
GLMM_PHOLL      VGTLMSNMGLELALKQLGIPFLRAKVGDRYVLEKLQEEGWRLGAENSGHVILLDKTTTGD
GLMM_PHOPR      VGTLMTNLGMEVALKNLGIPFVRSKVGDRYVMEELQKHNWLIGAENSGHVILLDKITTGD
GLMM_ALIF1      VGTLMTNMGMEVALRNLGIPFVRSDVGDRYVMEKLLENNWLIGAENSGHVILLDKVTTGD
GLMM_VIBVU      VGTLMTNLGMENGLKQLGIPFVRAAVGDRYVMEKLLEKGWKIGAENSGHVILLDKVTTGD
GLMM_VIBVY      VGTLMTNLGMENGLKQLGIPFVRAAVGDRYVMEKLLEKGWKIGAENSGHVILLDKVTTGD
GLMM_VIBPA      VGTLMTNLGMENGLKQLGIPFVRAAVGDRYVMEQLLAKGWKIGAENSGHVILLDKVTTGD
GLMM_VIBCH      VGTLMTNLGMENGLKQLGIPFVRAAVGDRYVMEKLLEKGWKIGAENSGHVILLDKVTTGD
GLMM_HAEI8      VGTLMSNMSLEIALKMLGVPFLRANVGDRYVLEKMLENDWTLGGENSGHIIIADKNTTGD
GLMM_HAEIN      VGTLMSNMSLEIALKMLGVPFLRANVGDRYVLEKMVENDWTLGGENSGHIIIADKNTTGD
GLMM_MANSM      VGTLMSNMSLEISLKTLGIPFIRANVGDRYVLEKMVENDWKLGGENSGHIIIADKNTTGD
GLMM_PASMU      VGTLMSNMSLELALKQLGIPFVRANVGDRYVLEKMQEKGWLLGGENSGHIIILDKNTTGD
GLMM_HAEDU      VGTLMSNMGLEIALKHLAIPFTRANVGDRYVLEQLKEKNWKLGGENSGHIIVLDKNTTGD
GLMM_IDILO      VGTLMTNFALEKELDKRRIPFVRAKVGDRYVIEELVKRDWYLGGENSGHVINRQHHTTGD
GLMM_COLP3      VGTLMSNMGLELALKELDIEFARSNVGDRHVMELLREKGWQLGAENSGHVINLNHTSTGD
GLMM_SHEON      VGTLMSNLGLDLALQALDIPFARSKVGDRYVMELLKELDWRIGGENSGHILNLDHGTTGD
GLMM_PSEHT      VGTVMSNMGLENALKAKGIEFARSKVGDRYVMELLQQKGWTIGGESSGHVLNLDLISTGD
GLMM_BLOFL      VGTWMSNMGLALALRELNIPFVRANVGDRSVLLMLREKGWYIGGENSGHIVLLDKTTTGD
GLMM_BLOPB      VGTLMSNMGLVLALKQLNIPFIRSNVGDRCVLAMLKKQGWNIGGENSGHIVLLDKTTTGD
GLMM_BUCAI      VGTSMTNMGVILGLKKLGIPFCPAQIGDRNVYEKIKEKKWILGAEKSGHIVLLDKHSTGD
GLMM_BUCBP      VGTKMSNGGLSLALSKIGIPFITVNIGDRYIFKKLKEKQWRLGAESSGHVILLDYAPVGD
GLMM_WIGBR      VGTLMSNMGLEIALKKLEVPFIRSRIGDRYVLNELEKQGWKIGAENSGHVILLDHTSTGD
GLMM_ACIAD      VGTVMSNMALELALAKADVPFIRAKVGDRYVLQALEENDWVTGGEPSGHILTLDKSTTGD
GLMM_PSYA2      VGTLMSNMGLELALKAADIEFTRAKVGDRYVMQELEANGWILGGEPSGHILCLDKSRTGD
GLMM_FRATT      VGTQMTNMSYENHYRANKIPFIRSKVGDRYVLEDLVKYGYKIGGESSGHVINLNFGTTGD
GLMM_THEMA      VGTVMTNGGLEDFLKEKGIRLLRTKVGDKYVLEKMLESGANLGGERSGHIIILDRSTTGD
GLMM_NOSS1      VSTVMANLGFEKAWQQQGGKLIRTAVGDQYVQAEMIKTGAMLGGEQSGHILCSHYGMTGD
GLMM_SYNY3      VGTVMANLAFERAWEKLGGKLIRTAVGDQNVQAQMWETGAMLGGEQSGHIICHHHSYSGD
GLMM_THEEB      VATVMSNLGFERAWQARGGQLVRAAVGDQYVHAEMLRHGAMLGGEQSGHILCRHYGVGGD
GLMM_SYNP6      VTTVMANLGFERAWQAVGGEFVRTAVGDQYVQAEMQARGAMLGGEQSGHILCRHYALTGD
GLMM_PROMM      VATVMSNLGFERAWQQRGGVLERTPVGDQHVYAAMVESNAALGGEQSGHILSAAHGLCGD
GLMM_SYNPX      VATVMSNLGFERAWERRGGELERTPVGDQHVHAAMVANGAALGGEQSGHILAASHGLCGD
GLMM_PROMA      VTTVMSNLGLEKAWLNRGGKLTRTPVGDQHVHKAMLTNKASLGGEQSGHILSTLNDLCGD
GLMM_PROMP      ISTKMANLGFENTWKKIGGILHRTEVGDKFIFEAIKKKKALLGGEQSGHILSKINDFCGD
GLMM_PROM5      ISTRMANLGFERNWNNIGGILYRTEVGDKFIFAALKEKKALLGGEQSGHILSKINNFCGD
GLMM_PROMS      ISTQMANLGFEKAWKKIGGVLYRTDVGDKYVHEAIKEKRAVLGGEQSGHILSKINNFSGD
GLMM_PROM9      ISTQMANLGFEEAWNKIGGLLYRTDVGDKYVHDAIKEKRAVLGGEQSGHILSKINNFSGD
                  * *:. .                :**: :   :       *.* ***::       . 

GLMM_BACAN      GMLSALQLVNIMKMTKKPLSELAG-EMTKFPQLLVNVRV---T-DKKLALENEKIKEIIR
GLMM_BACCZ      GMLSALQLVNIMKMTKKPLSELAG-EMTKFPQLLVNVRV---T-DKKLALENEKIKEIIR
GLMM_BACHK      GMLSALQLVNIMKMTKKPLSELAG-EMTKFPQLLVNVRV---T-DKKLALENEKIKEIIR
GLMM_BACC1      GMLSALQLVNIMKMTKKPLSELAG-EMTKFPQLLVNVRV---T-DKKLALENEKIKEIIR
GLMM_BACCR      GMLSALQLVNIMKMTKKPLSELAG-EMTKFPQLLVNVRV---T-DKKLALENEKIKEIIR
GLMM_BACLD      GLLSAIMLMNTIKMTGKPLSELAA-EMQKFPQLLLNVKV---T-DKHKVTENEKVKAVIE
GLMM_BACSU      GLLSAIMLMNTLKATGKPLSELAA-EMQKFPQLLVNVRV---T-DKYKVEENEKVKAVIS
GLMM_GEOKA      GMLTALQLVNIMKIKGKPLSELAG-EMKKYPQLLVNVRV---A-DKEKAMENEQVKKVIQ
GLMM_BACHD      GMLSALQLVNIMKQTGKKLSELAE-EWETFPQTLVNIRV---T-DKHAVTDNEKVPAVIK
GLMM_BACSK      GLLTGVQLLNIMKQTGKPLSELAA-GMKTFPQCLINVRV---T-DKDAVKNNALVQQEIK
GLMM_LISMF      GLLSGIQLINVMKATGKKLSELAA-EMKTFPQKLENIRV---S-DKNHVTDNPKVSKVIG
GLMM_LISMO      GLLSGIQLINVMKATGKKLSELAA-EMKTFPQKLENIRV---S-DKNHVTDNPKVSKVID
GLMM_LISIN      GLLSGIQLINVMKATGKKLSELAS-EMKTFPQKLENIRV---S-DKNHVTDNPKVSKVIS
GLMM_OCEIH      GMLSAIQLVNVMRETGKPLSELAD-EMVVFPQVLKNVRV---M-DKNQALSSSVLLDEVD
GLMM_STAAC      GLLTGIQLASVIKMTGKSLSELAG-QMKKYPQSLINVRV---T-DKYRVEENVDVKEVMT
GLMM_STAA8      GLLTGIQLASVIKMTGKSLSELAG-QMKKYPQSLINVRV---T-DKYRVEENVDVKEVMT
GLMM_STAAM      GLLTGIQLASVIKMTGKSLSELAG-QMKKYPQSLINVRV---T-DKYRVEENVDVKEVMT
GLMM_STAAN      GLLTGIQLASVIKMTGKSLSELAG-QMKKYPQSLINVRV---T-DKYRVEENVDVKEVMT
GLMM_STAAW      GLLTGIQLASVIKMTGKSLSELAG-QMKKYPQSLINVRV---T-DKYRVEENVDVKEVMT
GLMM_STAAR      GLLTGIQLASVIKMTGKSLSELAG-QMKKYPQSLINVRV---T-DKYRVEENVDVKEVMT
GLMM_STAAS      GLLTGIQLASVIKMTGKSLSELAG-QMKKYPQSLINVRV---T-DKYRVEENVDVKEVMT
GLMM_STAEQ      GLLTGVQLASVIKMSGKTLSELAS-QMKKYPQSLINVRV---T-DKYRVEENIHVQEIMT
GLMM_STAES      GLLTGVQLASVIKMSGKTLSELAS-QMKKYPQSLINVRV---T-DKYRVEENIHVQEIMT
GLMM_STAS1      GLLTGVQLASIIKMTGKSLSQLTS-QMKKYPQSLVNVRV---T-DKYRVEENIDVQEIMT
GLMM_STAHJ      GLLTGVQLAAVIKMSGKPLSELAA-QMKKYPQSLINVKV---T-DKHHVEDNEDVKKVMD
GLMM_LACAC      GMLTGLHLMLVMKKTGKSLSELLK-DFKDYPQCLVNVPV---T-DKKSWKEHQPILDVIA
GLMM_LACJO      GMLTGLHLLYVMKDTGKSLSELLS-DFKEYPQRLINVPV---E-NKKDWKEHKRITEAIE
GLMM_LACPL      GMLTGIQLLHVMKETGKKLSELAA-EVTTYPQKLVNVKV---Q-DKKAALNNDKIKAVIK
GLMM_STRA3      GQLTAIQLTKVMKETGKKLSELAS-EVTIYPQKLVNIRV-ENN-MKDKAMEVPAIAEIIA
GLMM_STRA5      GQLTAIQLTKVMKETGKKLSELAS-EVTIYPQKLVNIRV-ENN-MKDKAMEVPAIAEIIA
GLMM_STRA1      GQLTAIQLTKVMKETGKKLSELAS-EVTIYPQKLVNIRV-ENN-MKDKAMEVPAIAEIIA
GLMM_STRT1      GQLTAIQLTKVMVETGKSLSELAA-EVTIYPQKLVNIRV-ENS-MKDKAMDVPAIAAIIE
GLMM_STRT2      GQLTAIQLTKVMVETGKSLSELAA-EVTIYPQKLVNIRV-ENS-MKDKAMDVPAIAAIIE
GLMM_STRP1      GQLTAIQLAKVMKETGKSLSELAA-EVTIYPQKLVNIRV-ENS-MKERAMEVPAIANIIA
GLMM_STRP3      GQLTAIQLAKVMKETGKSLSELAA-EVTIYPQKLVNIRV-ENS-MKERAMEVPAIANIIA
GLMM_STRP6      GQLTAIQLAKVMKETGKSLSELAA-EVTIYPQKLVNIRV-ENS-MKDRAMEVPAIANIIA
GLMM_STRPM      GQLTAIQLAKVMKETGKSLSELAA-EVTIYPQKLVNIRV-ENS-MKDRAMEVPAIANIIA
GLMM_STRP8      GQLTAIQLAKVMKETGKSLSELAA-EVTIYPQKLVNIRV-ENS-MKDRAMEVPAIANIIA
GLMM_STRMU      GQLTAIQLTKVMKETGKTLSELAN-EVTIYPQKLVNIYV-KND-MKNKAMEVPMIAQIIE
GLMM_STRPN      GQLSAVQLTKIMKETGKSLSELAA-EVTIYPQKLVNIRV-ENV-MKEKAMEVPAIKAIIE
GLMM_STRR6      GQLSAVQLTKIMKETGKSLSELAA-EVTIYPQKLVNIRV-ENV-MKEKAMEVPAIKAIIE
GLMM_LACLA      GQLSAIQLLKVMRETGKSLSELAS-EVTIYPQKLVNVRVKDNA-AKKSAMDVPAIQKVIS
GLMM_CLOAB      GLVTALKICSIVKESRKTLSKLAS-IMHKLPQVLANAKVP-NN-KKDIYLEDKEISDEIK
GLMM_CLOTE      GLVTALQLSSIIKDSNKKLSELAS-IMKELPQVLLNAKVT-NN-MKNIYIEDEEIAGEIK
GLMM_CLOPE      GLVTALQVASIVKRTGKSLFELKN-VMKVLPQVLVNAKVP-NN-MKNIHEEDEEIIAEIK
GLMM_CALS4      GEITALKLCSIMKHTGKKLSELAS-CMTTYPQVLVNAKVK-NE-LKEKYLEDEDIKREIE
GLMM_FUSNN      GVLSSLKLVEVIRDTGKDLHELVS-SIKDAPQTLINVKV-DNI-KKNTWDKNEIIMSFIN
GLMM_COREF      GTLTGLSLMARMAATGKPLSELAA-AMTVLPQVLINVPV---A-DKSSIMKSANVQAAVA
GLMM_CORGL      GTLTGLSIMARMAETGKSLGELAQ-AMTVLPQVLINVPV---S-DKSTIVSHPSVVAAIA
GLMM_CORDI      GTLTGLSLMSRMAETGLSLKVLAS-AMTVLPQVLINVPV---S-DKTIIQTHPDVVAAME
GLMM_CORJK      GTLTGLTLMARMAQTGKPLSELAS-VMTVLPQTLINVPV---A-DKSVIADDERVVEAIA
GLMM_MYCBO      GIVTGLRLMTRMVQTGSSLSDLAS-AMRTLPQVLINVEV---V-DKATAAAAPSVRTAVE
GLMM_MYCTU      GIVTGLRLMTRMVQTGSSLSDLAS-AMRTLPQVLINVEV---V-DKATAAAAPSVRTAVE
GLMM_MYCLE      GIITGLRLMTRMVQTSSSLAALAS-AMRALPQVLINVEV---A-DKTTAAAAPLVQTAVE
GLMM_MYCPA      GIVTGLRLMTRMAQTGSPLSDLAS-AMQTLPQVLINVTV---A-DKATAATAPSVQTAVG
GLMM_NOCFA      GVLTGLKLMARMAQTGRSLADLAG-VLTTVPQVLVNVPV---S-DKAAVAAAPDVREAVA
GLMM_STRAW      GTLTGLLLAARVAQTGRTLQDLAS-VMERLPQVLVNVPD---V-DRARVKTSAELATAVA
GLMM_STRCO      GTLTGLMLAARVAQTGRTLRDLAS-VMERLPQVLVNVPD---V-DKSRVTSSAELATAVA
GLMM_THEFY      GLLTGMHLLAAVNRRGVALAELAK-VMNRLPQVLVNVSG---V-DKTRVATSERIAAEVA
GLMM_LEIXX      GILTGLHLLSEMARQRKTLAELAQ-AMTVYPQVMVNVRG---V-DHHSVHSDELLRSAVE
GLMM_CUTAK      GVLTGLHLAARVARTGKTLKELAS-VMTRLPQALINVRG---V-DKLRAGIDPDVNKAVA
GLMM_BIFLO      GTLTALTLCNEVVKSGKSLKELAA-DFPQLPQTLINVPN---V-DKKAASTNKRIQDAVA
GLMM_TROW8      GILAGLHLCAEIIRTGKSLTDLAS-IMEIVPQVTANIET---D-DPTTLLNNKKIRHEIS
GLMM_TROWT      GILAGLHLCAEIIRTGKSLTDLAS-IMEIVPQVTANIET---D-DPTTLLNNKKIRHEIS
GLMM_SYMTH      GILTAVQLLSIVAREKQPLSTLAG-RMQRLPQWLENVRV---G-RKEGWEQNQAIQAAIA
GLMM_THET2      GLLTALLTLKALKALGGDLADWYE-ALPLYPQVLLNVRVSD----KAKVMADPRLGEAVR
GLMM_THET8      GLLTALLTLKALKALGGDLADWYE-ALPLYPQVLLNVRVSD----KAKVMADPRLGEAVR
GLMM_DEIRA      GVLTALLTLSSMKKLGTTLDALYD-ELVMFPQTLVNVRVKD----KKAIASDPAVQHAVA
GLMM_AGRFC      GLVAALQVLAKVKRSGLTVSEVCR-KFEPVPQLLKNVRISG----GK-PLENPIVLQAIA
GLMM_RHIME      GLVAALQILAVVKRQGKTVSEICR-RFEPVPQVLKNVRVSA----GK-PLEDAAVQQAIA
GLMM_BRUME      GLISALQILAVAQEQNKPISDVCR-KFQPVPQLLKNVRTTG----GK-PLENKRVKSAID
GLMM_BRUSU      GLISALQILAVAQEQNKPISDVCR-KFQPVPQLLKNVRTTG----GK-PLENKRVKSAID
GLMM_RHILO      GLVSALQVLACIKRQGRPVSELSK-KFEPVPQLLKNVRIAG----GK-PLEEAPVKAAIE
GLMM_BARHE      GLVAALQILACMQEIQIPMSHLCQ-RFEPVPQIFKNVMIKN----KN-VLKKNPVKTAIE
GLMM_BARQU      GLVAALQILACMQESQSSMSHLCK-RFEPVPQILKNVTIKN----KN-VLKKNQVKTAID
GLMM_BRADU      GFVAALQVLAVVQKSRRPVSEVCH-RFDPLPQILKNVRHKG----GK-PLDDSDVKSAIS
GLMM_NITWN      GFVSALQVLAVVQKLGRPVSQVCH-KFEPLPQILKNFRYRN----GK-PLDRAEVKSAIT
GLMM_RHOPA      GFVAALQVLAMVQKLGRPVSEVCH-RFDPLPQILKNVRYRS----GR-PLDDSGVISAIQ
GLMM_CAUVC      GLIAALQVLAVMVETDKPMSALGR-QFEPVPQLLENVRFVG----GK-PLEAAAVKEAIA
GLMM_GLUOX      GLIAALQVLAVSVETKRPASEICR-FFTPYPQLLKNVRYSG----TS-PMSSPDLAAAKA
GLMM_ZYMMO      GLVAALQVLADLVQSDKKASELLH-VFDPFPQLLKNVRYSS----GQ-PLEDESVCEAIS
GLMM_RUEPO      GLMAGLHFLGEMMRSGQPSSELVR-QFVPVPQLLKNVRFAK----GQTPLDAASVQSAIA
GLMM_CAMJE      GLIAALQFSALMLSKKKSASSILG-QVKPYPQLLTNLKIAE----K----KDLDKIKGLK
GLMM_CAMJR      GLIAALQFSALMLSKKKSASSILG-QVKPYPQLLINLKIAE----K----KDLDKIKGLK
GLMM_HELPJ      GLVCALQVSALVLESKLVSSIALN-PFELYPQSLVNLNIQK----K----PPLESLKGYS
GLMM_HELPY      GLVCALQVSALVLESKQVSSVALN-PFELYPQSLVNLNVQK----K----PPLESLKGYS
GLMM_HELHP      GLVSALQVLALLIQSGKSSQDALN-PFEIYPSELVNLKVSQ----K----KPLEKINGLQ
GLMM_WOLSU      GLVSALQTMAFVLRSGERASRALN-IFDLYPQKLVNLPIKQ----K----KELKEIEGFE
GLMM_PELUB      GLLVALEVL-FSLRKGKKASSFFN-TFNKTPQILENIDVKD----KN-IIKNIDIKNSIK
GLMM_ANAMM      SLVAALQILSIMLLENKSASSIFG-DFVPMPRVHRDIPYSM----EF-DHIARLIGPTLS
GLMM_DESPS      GILAALQILAIMKKRKKTLSELAQ-VMQSFPQVLKNVRTAK----KISVDSIVGFADAVK
GLMM_GEOSL      GVLSALQVLATMRRADKSLSELAE-VMIPLPQVLVNVRVKE----KKDITTIPEVALLIG
GLMM_DESVH      GLLAALQILRIMRERGKPLSELAG-QLQLFPQQLINVHVER----KIPFAECQPVADAVA
GLMM_BDEBA      GCIAALSVLAVMKQTGKKMSDLNH-VFEDVPQILINCRVKR----RAELSELAGYNDMIR
GLMM_CHLAB      GIVSALQVLRIMIESESTLSDLTS-LIVKSPQALINVAVKE----KIPLDTLPLVQEALR
GLMM_CHLCV      GIVSALQVLRIMIESESTLSDLTS-LIVKSPQALINVSVKE----KIPLDTLPIVQEALR
GLMM_CHLPN      GIVSALQVLRIMIESESMLSDLTA-PIVKSPQTLINVAVRE----KIPLETIPLIERTLR
GLMM_CHLMU      GIVSALQVLRIMIESESTLSDLTA-CIVKSPQSLINVPVAK----KVPLDSLSNVQVVLQ
GLMM_CHLTR      GIVSALQVLRIMIESESTLSDLTA-CIAKSPQALINVPVTK----KVPLESLANVQGVLK
GLMM_PARUW      GLVCALQVLRIMIETDSKLSDLAS-FVQRYPQTCLNIKVSS----KPSLDSIERLKEVIA
GLMM_LEGPA      GIVAALQVLSIMVKQNKALHELTA-GIQLLPQTLVNLKTNN----AALLASNPDVIQAVK
GLMM_LEGPH      GIVAALQVLSIMVKQNKALHELTA-GIQLLPQTLVNLKTNN----AALLASNPDVIQAVK
GLMM_LEGPL      GIVAALQVLSIMVKQNKALHELTA-GIQLLPQTLVNLKTNN----AALLASNPDVIQAVK
GLMM_COXBU      GVITALQILRIMQQAEKPLADLKK-VMVKHPQVLINVPIKG----ILDIAQNPNIKKAIT
GLMM_AROAE      GIVSALQVIAALIKGQCTLATACA-DLVFYPQKLINVPLAA----GFDWRSDERIDQARS
GLMM_DECAR      GIVAALQVLAALRELGGSLKELLG-GLVLYPQKLINVPVMR----GFPWKEHPAITSALA
GLMM_BORBR      GTIAALQVLTALRRADATLAEWVA-DLRMYPQKMINVPLAP----GLDWKTHDGLARARG
GLMM_BORPA      GTIAALQVLTALRRADATLAEWVA-DLRMYPQKMINVPLAP----GLDWKTHDGLARARG
GLMM_BORPE      GTIAALQVLTALRRADATLAEWVA-DLRMYPQRMINVPLAP----GLDWKTHDGLARARG
GLMM_BURMA      GIVSALLVLAALKRSGKTLAQMLE-GVTLFPQKLINVRMKP----GADWKGSEAIRRAID
GLMM_BURPS      GIVSALLVLAALKRSGKTLAQMLE-GVTLFPQKLINVRMKP----GADWKGSDAIRRAID
GLMM_CUPPJ      GIVSALQVLAALRRSGKTLAGLLD-GVSLFPQKLINVRVEK----GFDWQSHAGLKAARA
GLMM_RALSO      GIISALQVLAALRRSGQTLEQVLD-GVHLFPQKLINVRVEK----GFDWKAHAALQAALK
GLMM_NEIG1      GIISALQVLAALQILNQDLATVCA-DWQPYPQTMINVRIQK----GQKWQ--EASKDVLA
GLMM_NEIMB      GIISALQVLAALQTLNQDLATVCA-DWQPYPQTMINVRIQK----GQQWQ--EASKDVLA
GLMM_NEIMA      GIISALQVLAALQTLNQDLATVCA-DWQPYPQTMINVRIQK----GQKWQ--EASKDVLA
GLMM_NEISU      GIISALQVLAALQMLNQDLATICA-DWQPYPQTMINVRIQK----GQKWQ--EASKDVLA
GLMM_CHRVO      GIISSLQVLASLKQLGLSLAEICA-DWRPFPQTLINVRH-N----GCDWK--AASAAPLA
GLMM_NITEU      GIISALQVLYALRDTGLTLADFMR-DVPFFPQRLINVKVSG----NFDFRSNPAVAACKN
GLMM_METCA      GIVSALQVLAEIVRSGKTLHELKQ-GMRKYPQRLVNVRLAE----RVSLASVPLVQKVKA
GLMM_NITOC      GIVSALQVLVEMVATGHSLYELKS-GVVKYPQCLINVQVAR----SINLHDNNAIINAMQ
GLMM_PSE14      AIIASLQVILALRRSGISLAEARL-KLRKCPQILINVRFAG---SGVDPVSHPSVQQACA
GLMM_PSESM      AIIASLQVILALRRSGISLAEARL-KLRKCPQILINVRFEG---SSVDPVTHPSVQEACA
GLMM_PSEU2      AIIASLQVILALRRSGVSLAEARL-KLRKCPQILINVRFAG---SGVDPVSHPSVKEACA
GLMM_PSEF5      AIIAALQVLMALKARGESLAQSRQ-GLRKCPQVLVNVRFGG---GE-NPVEHPAVKEACE
GLMM_PSEPK      AIIAALQVLMALKRRGETLAQARQ-ALRKCPQVLINVRFGA---SKVDPLEHPAVKEASA
GLMM_PSEAE      AIIAALQVLMALKHRGQTLAEARQ-GIRKCPQVLINVRFKG---EN-DPLEHPSVKEASV
GLMM_XANAC      GIVSALQVLEALGRDRQSLRDALT-SLSKVPQKTVNVRLDG--GAAKAIVEAANVQQALQ
GLMM_XANC5      GIVSALQVLEALGRDGQSLREALA-SLSKVPQKTVNVRLDG--GTAKAIVEAVNVQQALQ
GLMM_XANOR      GIVSALQVLEALGRDGHSLRKALS-SLSKVPQKTVNVRLDG--GAAKAIVEAANVQQALQ
GLMM_XANC8      GIVSALQVLEALGRDGHSLREALS-SLSKVPQQTVNVRLGG--GAAKAIVEAASVQQALQ
GLMM_XANCP      GIVSALQVLEALGRDGHSLREALS-SLSKVPQQTVNVRLGG--GAAKAIVEAASVQQALQ
GLMM_XYLFA      GIVSALQVLEVLRHEGLTLSQALL-GLHKVPQKTVNVCWSG---PARAAVEMPEVRQALV
GLMM_XYLFT      GIVSALQVLEVLRHEGLTLSQALL-GLHKVPQKTVNVCWSG---PARAAVEMPEVRQALV
GLMM_ECOL6      GIVAGLQVLAAMARNHMSLHDLCS-GMKMFPQILVNVRYTA--G-SGDPLEHESVKAVTA
GLMM_SHISS      GIVAGLQVLAAMARNHMSLHDLCS-GMKMFPQILVNVRYTA--G-SGDPLEHESVKAVTA
GLMM_ECO57      GIVAGLQVLAAMARNHMSLHDLCS-GMKMFPQILVNVRYTA--G-SGDPLEHESVKAVTA
GLMM_ECOLI      GIVAGLQVLAAMARNHMSLHDLCS-GMKMFPQILVNVRYTA--G-SGDPLEHESVKAVTA
GLMM_SHIFL      GIVAGLQVLTAMARNHMSLHDLCS-GMKMFPQILVNVRYTA--G-SGDPLEHESVKAVTA
GLMM_SALTI      GIVAGLQVLAAMVRNHMSLHDLCS-GMKMFPQILVNVRYTA--G-SGDPLENEAVKAVTA
GLMM_SALTY      GIVAGLQVLAAMVRNHMSLHDLCS-GMKMFPQILVNVRYTA--G-SGDPLENEAVKAVTA
GLMM_SALCH      GIVAGLQVLAAMVRNHMSLHDLCS-GMKMFPQILVNVRYTA--G-SGDPLENEAVKAVTA
GLMM_SALPA      GIVAGLQVLAAMVRNHMSLHDLCS-GMKMFPQILVNVRYTA--G-SGDPLENDAVKAVTA
GLMM_YERPE      GIVAGLQVLTAMVRNHMSLHDLCS-GMKLLPQILVNVRFSG----EHNPLKSDEVEEVTR
GLMM_YERPS      GIVAGLQVLTAMVRNHMSLHDLCS-GMKLLPQILVNVRFSG----EHNPLKSDEVEEVTR
GLMM_PECAS      GVIAGLQVLTAIVKNHMSLHDLCS-GMKLFPQILVNVRFTG----ENDPLEDKSVQQITQ
GLMM_PHOLL      GIVAGLQILSAMVRNHMSLHDLCS-GMKLLPQVLVNVRFSG----SHDPLKSENVINITK
GLMM_PHOPR      GIVAGLQVMASIVGSKMTLKELSD-GMTLFPQVLENIRFKG----EGNPLESDAVIAAQK
GLMM_ALIF1      AIVAALQVIASIVGSKMSLKELCD-GMTMFPQILVNVRFAG----ENDPLESDAVKAAQA
GLMM_VIBVU      AIVAALQVLASVVGSELSLNELSK-GMTLYPQVLENVRFAG----QGNPLEAEAVKKTVE
GLMM_VIBVY      AIVAALQVLASVVGSELSLNELSK-GMTLYPQVLENVRFAG----QGNPLEAEAVKKAVE
GLMM_VIBPA      AIVAALQVLASVVGSDMSLHDLSQ-GMTLYPQVLENVRFAG----ENNPLEAQAVLAAVE
GLMM_VIBCH      AIVAGLQVLASVVGSEMTLHELAK-GMTLYPQVLENVRFAG----DNNPLEADAVKAAVS
GLMM_HAEI8      GIVASLAVLAAMAQHKLSLNELAS-AVKLFPQVLINVRFAG----GENPLESDAVKSVAA
GLMM_HAEIN      GIVASLAVLAAMAQHKLSLNELAS-AVKLFPQVLINVRFAG----GENPLESDAVKSVAA
GLMM_MANSM      GIIASLAVLTAMAQHKLSLNELAS-AVKLFPQVLINVRFSG----GTNPLESDAVKAVAA
GLMM_PASMU      GIIASLAVLSAMVQHNLSLNELAS-AVPLFPQVLINVRFAG----GDNPLESAAVKAVAA
GLMM_HAEDU      GIIASLEVLAAMEAHKMSLNDLTH-AVPLFPQVLLNVRFDG----GNNPLENAAVKALAK
GLMM_IDILO      GIIAGLQVLAAMYQEQKSLEKLSC-DFHKLPQVLINVRFES----DKQPLESENVKSVVR
GLMM_COLP3      GIIAALNVLTAVTKQEKSLFELRQ-GLTMLPQLLVNVRFSG----QNNPLNDADVLAAVD
GLMM_SHEON      GIVAGILVLAAMRRQNATLEQLTA-PMEMLPQVLVNVRFEG----EHDPLSSDKVKAAQA
GLMM_PSEHT      GIISSLQVLAAMVAQNKTLQDLGT-GFTKYPMKMINVRYTP----GTDPTKAPAVLAAVA
GLMM_BLOFL      GIIVALQILSTMVSNSVSLYELCN-NVYLLPQILINVYCSG----FINPLESSVVKKEIQ
GLMM_BLOPB      GIIVALQVLSAMVNNCVSLHELCN-DVSLLPQILVNVYCSS----IKSPLESDLVRKETK
GLMM_BUCAI      GIIASLQVLLTMINNHMTLYDLSN-QIKLFPQVFLNIFLKQ----DKDFEKDIKIQNILT
GLMM_BUCBP      GIITSLQILKIIFDENSTLKSLCS-DIHMLPQIIINIKNNI----DISFLKNFKIQSVLS
GLMM_WIGBR      GIIAGLQILSIIAKNNTTLKNLCN-GINLFPQILINVQIDK----ENNPLESNIVKKIIE
GLMM_ACIAD      AIIAALQVLTVMVEQNKALHELVT-GFELFPQVLVNVRLDQ----MMDPYSVPALVSEFE
GLMM_PSYA2      AIIASLQILAVMQARGKALSDLTE-GFEVLPQKLVNVRLSQ----MQDPFEHEELVAAFD
GLMM_FRATT      GLFTAIQLLAIFSQADKPVSEFKL-QGELMQQTLINVPLTK----KVAREDLQKVASDVN
GLMM_THEMA      GLITALELMRVLKRSGRKLSDFAK-EIPDYPQITKNVRRTE---------RMSLENENLR
GLMM_NOSS1      GLLTALHLASLVKQSGVSLAELIDQSFQTYPQLLRNVRVVDRD-RRLSWQNCTPVQQAIA
GLMM_SYNY3      GLQAALHLATLVQKSGLSLSELLSESFQPYPQILRNVRVLDRE-RRLHWQECAPLQQAIA
GLMM_THEEB      GLLTAVHLATLVQDSGLSLAQLRDQSFTPYPQILRNVRVEDRQ-RRLRWQECEPLQRMIA
GLMM_SYNP6      GTLTAAHVAALVQASGVSLADLVDQSFRPYPQLLRNVRVEDRD-RRCNWQNCAALTQAIA
GLMM_PROMM      GVLTALQLATLCHGRGLSLGEWLDQSFQAFPQKLVNVRVPDLE-RRMGWQHCEPLQEAVL
GLMM_SYNPX      GVLTALQLATLCHGQDIALSDWLDRSFKAYPQKLVNVTVPDRA-RRKGWSSCMPLQEAVL
GLMM_PROMA      GLLAAIQLSSICNRKGILLSEWRDQSFKPYPQKLISVPIAKHI-TQNYLNKSEKFRLSIA
GLMM_PROMP      GILTAIQISKYCKKKNISLRSWLNSSFSPYPQKLTNVLLNFKF-KNIDKSYKEFINETIE
GLMM_PROM5      GILTALQISKYCKKKNINLESWLNSSFLPYPQKLTNILLSFDF-KNINNSNKDLINESIE
GLMM_PROMS      GILTALQISKYCKKKNINLNDWLKSSFEPFPQKLTNIKLNFNI-NKLSLKAKILIDKTIE
GLMM_PROM9      GILTALQISKYCKKKNITLNNWLKTSFEPFPQKLTNINLNFNI-NKVNQKTRILINQTTE
                .   .                              .                        

GLMM_BACAN      VVEEEMNGDG-RILVRPSGTEPLIRVMAEAPTQEVCDAY-VHRIVEVVKAEVGAE-----
GLMM_BACCZ      VVEEEMNGDG-RILVRPSGTEPLIRVMAEAPTQEVCDAY-VHRIVEVVKAEVGAE-----
GLMM_BACHK      VVEEEMNGDG-RILVRPSGTEPLIRVMAEAPTQEVCDAY-VHRIVEVVKAEVGAE-----
GLMM_BACC1      VVEEEMNGDG-RILVRPSGTEPLIRVMAEAPTQEVCDAY-VHRIVEVVKAEVGAE-----
GLMM_BACCR      VVEEEMNGDG-RILVRPSGTEPLIRVMAEAPTQEVCDAY-VHRIVEVVKAEVGAE-----
GLMM_BACLD      EVEKEMNGDG-RILVRPSGTEPLVRVMAEAKTKELCEKY-VGRIADVVKAEMGAE-----
GLMM_BACSU      EVEKEMNGDG-RILVRPSGTEPLVRVMAEAKTKELCDEY-VNRIVEVVRSEMGLE-----
GLMM_GEOKA      EVEAEMNGNG-RVLVRPSGTEPLVRIMAEAQTEEACRAY-VERIADVVRREMGVE-----
GLMM_BACHD      EVEQEMNGEG-RVLVRPSGTEPLVRIMVEAKTEELCDAF-VNKIADVVKAELGQE-----
GLMM_BACSK      RVEEAMAGEG-RILVRPSGTEPLVRVMVEAKTDELCQQY-ANQIVDVVKEQLGA------
GLMM_LISMF      EVEAEMAGNG-RVLVRPSGTEPLVRVMVEAATKEETDEY-CERISAVVRSEMALND----
GLMM_LISMO      EVEAEMAGNG-RVLVRPSGTEPLVRVMVEAATKEETDEY-CERISAVVRSEMALND----
GLMM_LISIN      EVEAEMAGNG-RVLVRPSGTEPLVRVMVEAATKEATDEY-CERISAVVRSEMALND----
GLMM_OCEIH      AVEKELGEDG-RVLVRPSGTEPLVRVMVEAKTKEECEQY-ADRIVSVIEQHLGA------
GLMM_STAAC      KVEVEMNGEG-RILVRPSGTEPLVRVMVEAATDEDAERF-AQQIADVVQDKMGLDK----
GLMM_STAA8      KVEVEMNGEG-RILVRPSGTEPLVRVMVEAATDEDAERF-AQQIADVVQDKMGLDK----
GLMM_STAAM      KVEVEMNGEG-RILVRPSGTEPLVRVMVEAATDEDAERF-AQQIADVVQDKMGLDK----
GLMM_STAAN      KVEVEMNGEG-RILVRPSGTEPLVRVMVEAATDEDAERF-AQQIADVVQDKMGLDK----
GLMM_STAAW      KVEVEMNGEG-RILVRPSGTEPLVRVMVEAATDEDAERF-AQQIADVVQDKMGLDK----
GLMM_STAAR      KVEVEMNGEG-RILVRPSGTEPLVRVMVEAATDEDAERF-AQQIADVVQDKMGLDK----
GLMM_STAAS      KVEVEMNGEG-RILVRPSGTEPLVRVMVEAATDEDAERF-AQQIADVVQDKMGLDK----
GLMM_STAEQ      KVETEMNGEG-RILVRPSGTEPLVRVMVEAATDADAERY-AQSIADVVEDKMGLDK----
GLMM_STAES      KVETEMNGEG-RILVRPSGTEPLVRVMVEAATDADAERY-AQSIADVVEDKMGLDK----
GLMM_STAS1      KVEVEMNGEG-RILVRPSGTEPLVRVMVEAATDEDAQRY-ANTIAEVVQDKMGLDN----
GLMM_STAHJ      EVETEMNGEG-RILVRPSGTEPLVRVMVEASTDEDAQRF-AQRIADEVQSKMGLE-----
GLMM_LACAC      EVEKDMAGNG-RVLVRPSGTQDLLRVMAEGPTQEETDAY-VDRIVKVVEKEMGTNK----
GLMM_LACJO      KVEKELSDEG-RIFVRPSGTQSLLRVMTEAPTQELADKY-CEEVAKVVEEEMGSN-----
GLMM_LACPL      DVEDEMAGDG-RVLVRPSGTQDLLRVMAEAKTDELVSAY-VDRIVDVVKAEVGIE-----
GLMM_STRA3      KMEEEMDGNG-RILVRPSGTEPLLRVMAEAPTNEAVDYY-VDTIADVVRTEIGLD-----
GLMM_STRA5      KMEEEMDGNG-RILVRPSGTEPLLRVMAEAPTNEAVDYY-VDTIADVVRTEIGLD-----
GLMM_STRA1      KMEEEMDGNG-RILVRPSGTEPLLRVMAEAPTNEAVDYY-VDTIADVVRTEIGLD-----
GLMM_STRT1      KMEAEMAGNG-RILVRPSGTEPLLRVMAEAPTDDEVNYY-VDTIADVVRAEIGLD-----
GLMM_STRT2      KMEAEMAGNG-RILVRPSGTEPLLRVMAEAPTDDEVNYY-VDTIADVVRAEIGLD-----
GLMM_STRP1      KMEDEMAGNG-RILVRPSGTEPLLRVMAEAPTDAEVDYY-VDTIADVVRTEIGCDN----
GLMM_STRP3      KMEDEMAGNG-RILVRPSGTEPLLRVMAEAPTDAEVDYY-VDTIADVVRTEIGCDN----
GLMM_STRP6      KMEDEMAGNG-RILVRPSGTEPLLRVMAEAPTDAEVDYY-VDTIADVVRTEIGCDN----
GLMM_STRPM      KMEDEMAGNG-RILVRPSGTEPLLRVMAEAPTDAEVDYY-VDTIADVVRTEIGCDN----
GLMM_STRP8      KMEDEMAGNG-RILVRPSGTEPLLRVMAEAPTDAKVDYY-VDTIADVVRTEIGCDN----
GLMM_STRMU      KMEAEMAGNG-RILVRPSGTEPLLRVMAEAPSTEEVNYY-VDTIAKVVKTEIGI------
GLMM_STRPN      KMEEEMAGNG-RILVRPSGTEPLLRVMAEAPTTEEVNYY-VDTITDVVRAEIGID-----
GLMM_STRR6      KMEEEMAGNG-RILVRPSGTEPLLRVMAEAPTTEEVDYY-VDTITDVVRAEIGID-----
GLMM_LACLA      EMETSMNGKG-RILVRPSGTEPLLRVMAEAPTHEEVNHV-VDTIVEVVEAEIGVK-----
GLMM_CLOAB      KIEEELHGKG-RVLIRPSGTEPLVRVMLEGEDQDRLNTL-AHGLAELIEKKAN-------
GLMM_CLOTE      KIEEQMEGKG-RVLIRPSGTEPLVRVMLEGENQEEIDKI-AHDLVKLIEKKTK-------
GLMM_CLOPE      KMEAALDGCG-RVLIRPSGTEPLVRVMLEGENQAEIDEM-AHNLAKMIEAKCN-------
GLMM_CALS4      KLEKEMEGKG-RVLIRPSGTEPLIRVMVEGEDYAKISQM-AKELADLIERKLN-------
GLMM_FUSNN      EANKKYKDEV-RILVRKSGTEPLIRVMTEGDDKQLVHKL-AEDIAHLIEKELN-------
GLMM_COREF      AAEEELGGTG-RVLLRPSGTEELFRVMVEAAEQEQARRV-AGRLAAVVAEA---------
GLMM_CORGL      EAEAELGATG-RVLLRASGTEELFRVMVEAGDKEQARRI-AGRLAAVVAEV---------
GLMM_CORDI      RASDELGEDG-RVLLRPSGTEELFRVMVEAPSKETARRI-AADLASVVAKI---------
GLMM_CORJK      KAEEDLGDAG-RVLLRPSGTEELFRVMVEAADPGTARRI-AGKLAAVVAEV---------
GLMM_MYCBO      QAAAELGDTG-RILLRPSGTEPMIRVMVEAADEGVAQRL-AATVADAVSTAR--------
GLMM_MYCTU      QAAAELGDTG-RILLRPSGTEPMIRVMVEAADEGVAQRL-AATVADAVSTAR--------
GLMM_MYCLE      TAEVELGNTG-RILLRPSGTEPMIRVMVEAAEEDVAHRV-ATRVAAAVSAQGSPLRCWNP
GLMM_MYCPA      QAAAELGDTG-RILLRPSGTEPMIRVMVEAPEKDIAQRL-ATRVAEAVSAAR--------
GLMM_NOCFA      DAERELGDSG-RILLRPSGTEQLVRVMVEATDPVKAEQL-AADLAKLVASL---------
GLMM_STRAW      EAERELGATG-RVLLRPSGTEPLVRVMVEAADIEQARSV-AGRLADAVKSALG-------
GLMM_STRCO      EAERELGSTG-RVLLRPSGTEPLVRVMVEAADIEQARSV-AGRLADSVKSALG-------
GLMM_THEFY      AAEAELGDSG-RVLLRPSGTEPIVRVMVEATSQDRAQAI-ADRLADVVRDELSINA----
GLMM_LEIXX      AVEAALGDSG-RVLLRPSGTEPLVRVMVEAADQETAVRM-ANELADVVRERLAG------
GLMM_CUTAK      DANQKLGDAG-RVVLRPSGTEPVVRVMVEAGTQEEADQI-CSELAETVKMSLAL------
GLMM_BIFLO      REEELLGDTG-RVLLRPSGTEPLVRVMAEAATQAYADEV-CTRLAKIVAEELAL------
GLMM_TROW8      RIEKSL--KG-RVVIRPSGTEPLIRIMVEDLNPEKAERA-CSHLADFFKQEIQKS-----
GLMM_TROWT      RIEKSL--KG-RVVIRPSGTEPLIRIMVEDLNPEKAERA-CSHLADFFKQEIQKS-----
GLMM_SYMTH      RAEAEMAGQG-RVLVRASGTEPLIRVMLEGTDMAHIQRL-AASIAEVIRTELQ-------
GLMM_THET2      EAEARLGGRG-RVNVRPSGTEPVIRVMVEAEEWAEEVARELAERVRALSQEAQAV-----
GLMM_THET8      EAEARLGGRG-RVNVRPSGTEPVVRVMVEAEEGAEEVARELAERVRALSQEAQAV-----
GLMM_DEIRA      DAEKQLAGKG-RINLRPSGTENLIRVMVEGQDEGE--IHDIAAAVAKVVEERGAAGA---
GLMM_AGRFC      DAESALANNG-RLVIRPSGTEPLIRVMAEGDDSAKVEKI-VNDLVGVISSARSAA-----
GLMM_RHIME      EAEAQLAKNG-RLLIRPSGTEPLIRVMAEGDDRGQVERI-VDELVNVIGGVRNAA-----
GLMM_BRUME      EAKERLGGQG-RLVIRPSGTEPLIRVMAEGDDRGLVEKV-VNDIIDVISSESSAAA----
GLMM_BRUSU      EAKERLGGQG-RLVIRPSGTEPLIRVMAEGDDRGLVEKV-VNDIIDVISSESSAAA----
GLMM_RHILO      DARNRLGKAG-RLVIRPSGTEPLIRVMAEGDDPQLVEAV-VNDIVEVISETRSAA-----
GLMM_BARHE      QATQRLGKKA-RLVIRASGTEPVIRIMGEGDEREMLDAV-VTEMVDIITHHDTLSKACAS
GLMM_BARQU      QATQRLGNEA-RLVIRASGTEPVIRIMGEGDEREVLDAV-VAEMVDVIAHHDALSKVGAS
GLMM_BRADU      DGEKRLNGHG-RLLIRSSGTEPVIRVMGEGEDRILVEDV-VDTIVSALGQAAA-------
GLMM_NITWN      AGEKRLNGHG-RLLVRSSGTEPVIRVMGEGDDRILVEEV-VDTIVSALGNPAVA------
GLMM_RHOPA      DGEKRLNGHG-RLLIRPSGTEPVIRVMGEGDDHDVVEEV-VDSIVDALGNAAAAAA----
GLMM_CAUVC      DGEAQLNGAG-RIVVRASGTEPLIRIMAEGDDPALVKKV-VKSIASAVKAA---------
GLMM_GLUOX      WADERLAGSG-RLVLRASGTEPLIRVMAEAQDEALVHEV-VDHVCDVIRAIAHA------
GLMM_ZYMMO      EAEESLKGKG-RLLIRKSGTEPLIRVMAEAEDPDLVHQI-VDHICETVRRAA--------
GLMM_RUEPO      EAEGVLNGSG-RLLIRKSGTEPLIRVMAECEDEALLTRA-VDSVVEAVADAVQA------
GLMM_CAMJE      ELKKDLENKNINTLFRYSGTENLIRLLLEARDIKLLEKE-MKNVVEFFKKALNG------
GLMM_CAMJR      ELKKDLENKNINTLFRYSGTENLIRLLLEARDIKLLEKE-MKNVVEFFKKALNG------
GLMM_HELPJ      ALLKELDQLEIRHLIRYSGTENKLRILLEAKDEKLLESK-MQELKEFFEGQLC-------
GLMM_HELPY      ALLKELDKLEIRHLIRYSGTENKLRILLEAKDEKLLESK-MQELKEFFEGHLC-------
GLMM_HELHP      EKLDSISASGNRYLVRYSGTENKLRILVEGKDYKLVSEQ-VKMLVDLCQKQLNV------
GLMM_WOLSU      ALMSEIESQGFRQLIRYSGTENKLRILLEGKDGRALEKW-MERCVEFFKATLGG------
GLMM_PELUB      LAEKLIKGQG-RILVRSSGTESKIRVMGESDNIKLLQKC-LKIVLRKIK-----------
GLMM_ANAMM      DVEQALGRVNGRVIFRRSGTERLIRCVIEGEDPKLVALV-ADELSIKLRELGVENGVEPE
GLMM_DESPS      KYEMQLGDTG-RILVRPSGTEPVIRVMVEGLDSAEINDI-ADELCELIRRVSNS------
GLMM_GEOSL      DIEKKLGDEG-RILIRYSGTEPLLRIMLEGQDKYQITGW-AKEIADLVEKKIGGK-----
GLMM_DESVH      AIETELGDRG-RVLLRYSGTESVCRVMVEGEHPEQVARL-AEMLAETVQKHLR-------
GLMM_BDEBA      NIEKKLAGNG-RVFVRFSGTEPVIRVLVEGTEKAQITQF-AEEIASFLEKELS-------
GLMM_CHLAB      DVRSSLGDSG-RVLLRYSGTENICRVMVEGLKKHQVDSL-AKTIADIVDSELGVGMVE--
GLMM_CHLCV      DVRSSLGDSG-RVLLRYSGTENICRVMVEGLKKHQVDSL-AKTIADIVDSELGAGIIE--
GLMM_CHLPN      DVQDALGPSG-RILLRYSGTENICRVMVEGHKKHQVDCL-AKALADVIDAELGTGSRE--
GLMM_CHLMU      EVKEILGDSG-RILLRYSGTENICRVMVEGTKKHQVDSL-AKTIVDVVEAEIGGAEISE-
GLMM_CHLTR      EVKEVLGDSG-RILLRYSGTENICRVMVEGTKKHQVDSL-AKTIVDVVEAEIG-AEISE-
GLMM_PARUW      QVEEILGNSG-RVLVRYSGTENTCRVMVEGPKYKQVIQL-ANQIADIVQEEIGLSVS---
GLMM_LEGPA      NLEKHLNGEG-RVLLRPSGTEPLLRVMVEGANASIVKQQ-AQMLCDDISQIDKKMTESLP
GLMM_LEGPH      NLEKHLNGEG-RVLLRPSGTEPLLRVMVEGANASIVKQQ-AQMLCDDISQIDKKMTESLP
GLMM_LEGPL      NLEKHLNGEG-RVLLRPSGTEPLLRVMVEGANASIVKQQ-AQMLCDDISQIDKKMTESLP
GLMM_COXBU      EAEKQLNGAG-RILLRPSGTEPVIRVMVEGSDEGIVRQT-AEMLAAAVQQSTL-------
GLMM_AROAE      DAELELGEQG-RVLLRPSGTEPLLRVMVEGKDGSQVERL-ARHIADCVRHASV-------
GLMM_DECAR      DTEVSLQGRG-RVLLRASGTEPLLRVMVEGEDAVEVTYA-AEKLAAVVRESAQ-------
GLMM_BORBR      AVEAELAGRG-RVLIRASGTEPKLRLMVEAEDEALAQAS-AQKLADSLGA----------
GLMM_BORPA      AVEAELAGRG-RVLIRASGTEPKLRLMVEAEDEALAQAS-AQKLADSLGA----------
GLMM_BORPE      AVEAELAGRG-RVLIRASGTEPKLRLMVEAEDEALAQAS-AQKLADSLGA----------
GLMM_BURMA      SAEQALSGSG-RVLIRASGTEPVLRVMVEARQATDANRH-AEAIADAVKQATA-------
GLMM_BURPS      SAEQALSGSG-RVLIRASGTEPVLRVMVEARQATDANRH-AEAIADAVKQATA-------
GLMM_CUPPJ      VVEPELAGRG-RVLIRASGTEPVVRVMVEAEHAETAERA-AQTLAEALRA----------
GLMM_RALSO      VSEAELNGKG-RVLIRPSGTEPVVRVMVEAQDAALATKY-AEQLAATLQ-----------
GLMM_NEIG1      EVEKELEGKG-RVVLRASGTEPVVRVMVEARQADWARDG-AERIAAAIGGI---------
GLMM_NEIMB      EVEKELEGKG-RVVLRASGTEPVVRVMVEARQADWAREG-AERIAAAIGGI---------
GLMM_NEIMA      EVEKELEGKG-RVVLRASGTEPVVRVMVEARQADWARDG-AERIASAIGSL---------
GLMM_NEISU      EVEKELEGKG-RVVLRASGTEPVVRVMVEARQADWAKKG-AERIAAAITGKQ--------
GLMM_CHRVO      EAEAALQGRG-RVVLRPSGTEPVVRVMVEADDKALADTW-AKAIAAAIEKVSA-------
GLMM_NITEU      EAEQALGNDG-RILLRASGTEPLIRVMVEGKVLQQTDYW-AEKIAETIRQQAASSMTGS-
GLMM_METCA      EVEAELGDSG-RVLLRPSGTEPLIRVMVEGADEGQVREL-ADRLAGAVARAFSA------
GLMM_NITOC      EAENQLGDEG-RVLLRPSGTEPVVRVMVEGRDISQVNSL-AQQLAQEVAFHLGNPQICP-
GLMM_PSE14      RVTEQMAGRG-RVLLRKSGTEPLVRVMVEGEDETQVRSY-AEELAKLVAEVCA-------
GLMM_PSESM      RVTEQMAGRG-RVLLRKSGTEPLVRVMVEGEDEAQVRAY-AEELAKLVAEVCA-------
GLMM_PSEU2      RVTEQMAGRG-RVLLRKSGTEPLVRVMVEGEDETQVRAY-AEELAKLVTEVCA-------
GLMM_PSEF5      RVTAAMAGRG-RVLLRKSGTEPLVRVMVEGDDEAQVRAY-AEELAKLVAEVSA-------
GLMM_PSEPK      KVTEALAGRG-RVLLRKSGTEPLVRVMVEGEDESQVRAH-AEALAKLVGEVCV-------
GLMM_PSEAE      RVTEQMGGRG-RVLLRKSGTEPLVRVMVEGDEEASVRAH-AEQLAKIVSEVCA-------
GLMM_XANAC      QAQAAVRGRG-RAFLRPSGTEPVVRVTVEADDAGLMQDT-LDRLSGAVRDAA--------
GLMM_XANC5      QAQAAVQGRG-RAFLRPSGTEPVVRVTVEADDAGLMQDT-LDRLSGAVRDAA--------
GLMM_XANOR      QAQAAVQGRG-RAFLRPSGTEPVVRVTVEADDARLMQDT-LDRLSGAVRDAA--------
GLMM_XANC8      QAQAAVQGRG-RAFLRPSGTEPVVRVTVEADEAGLMQDT-LDRLAGAVRDAA--------
GLMM_XANCP      QAQAAVQGRG-RAFLRPSGTEPVVRVTVEADEAGLMQDT-LDRLAGAVRDAA--------
GLMM_XYLFA      EAQAAVQGRG-RVFLRPSGTEPVVRITVEADDVVLMQQT-LDRLADVVRDAA--------
GLMM_XYLFT      EAQAAVQGRG-RVFLRPSGTEPVVRITVEADDVVLMQQT-LDRLADVVRDAA--------
GLMM_ECOL6      EVEAALGSRG-RVLLRKSGTEPLIRVMVEGEDEAQVTEF-AHRIADAVKAV---------
GLMM_SHISS      EVEAALGSRG-RVLLRKSGTEPLIRVMVEGEDEAQVTEF-AHRIADAVKAV---------
GLMM_ECO57      EVETALGSRG-RVLLRKSGTEPLIRVMVEGEDEAQVTEF-AHRIADAVKAV---------
GLMM_ECOLI      EVEAALGNRG-RVLLRKSGTEPLIRVMVEGEDEAQVTEF-AHRIADAVKAV---------
GLMM_SHIFL      EVEAALGNRG-RVLLRKSGTEPLIRVMVEGEDAAQVTEF-AHRITDAVKAV---------
GLMM_SALTI      DVEATLGNRG-RVLLRKSGTEPLIRVMVEGEDEAQVTAF-AHRIADAVKAV---------
GLMM_SALTY      DVEATLGNRG-RVLLRKSGTEPLIRVMVEGEDEAQVTAF-AHRIADAVKAV---------
GLMM_SALCH      DVEATLGNRG-RVLLRKSGTEPLIRVMVEGEDEAQVTAF-AHRIADAVKAV---------
GLMM_SALPA      DVEATLGNRG-RVLLRKSGTEPLIRVMVEGEDEAQVTAF-AHRIADAVKAV---------
GLMM_YERPE      QVEKELGGRG-RVLLRKSGTEPLIRVMVEGDAEESLIAEMANRIADAVKAAG--------
GLMM_YERPS      QVEKELGGRG-RVLLRKSGTEPLIRVMVEGDAEESLIAEMANRIADAVKAAG--------
GLMM_PECAS      DVEKELAGRG-RVLLRKSGTEPLIRVMVEGEHEETVIAQ-ANRIADAVKAVS--------
GLMM_PHOLL      SVETELNGRG-RVLLRKSGTEPLIRVMVEGEDDVQVTAL-AHRIADAVKHAG--------
GLMM_PHOPR      AVEAKLGDTG-RVLLRKSGTEPLIRVMVEGENADLVQQY-ALEIAQAVKDNC--------
GLMM_ALIF1      DVEAKLGDNG-RVLLRKSGTEPLIRVMVEGEDAELVTQY-AQQIADAVKESC--------
GLMM_VIBVU      DVEADLGSKG-RVLLRKSGTEPLIRVMVEGEDGELVQNS-ALKIAQAVKDNC--------
GLMM_VIBVY      EVEADLGSKG-RVLLRKSGTEPLIRVMVEGEDGELVQNS-ALKIAQAVKDNC--------
GLMM_VIBPA      EVEAELGDKG-RVLLRKSGTEPLIRVMVEGEDAELVQSS-ALKIADAVKASC--------
GLMM_VIBCH      EVEAELGSKG-RVLLRKSGTEPLIRVMVEGEDETLVKQS-ALKIAQAVKDNC--------
GLMM_HAEI8      EVEKRLEGKG-RILLRKSGTEPLIRVMVECQDAELAQQC-AEEIAEAVKKIN--------
GLMM_HAEIN      EVEKRLEGKG-RILLRKSGTEPLIRVMVECQDAELAQQC-AEEIAEAVKKIN--------
GLMM_MANSM      EVEKRLAGKG-RILLRKSGTEPLIRVMVECSDAELARKS-AEEIVEAVKAN---------
GLMM_PASMU      EVEKRLAGKG-RILLRKSGTEPLIRVMVECEDGALAQQC-AEQIADVVRAN---------
GLMM_HAEDU      DIETRLVGKG-RILLRKSGTEPLIRVMVECEDAVLAQQY-AEEIVSAIQNH---------
GLMM_IDILO      EVESALAGTG-RVLLRKSGTEPLIRVMVEGENEAKVKAF-AQQIANEVEAATN-------
GLMM_COLP3      EVNETLTGRG-RVLLRKSGTEPLIRVMVEGPDMDEVTLL-ANKIADLVKLVK--------
GLMM_SHEON      QVESELGVRG-RVLLRKSGTEPLIRVMVEGDDHNTVLAH-ANLIADAVKSAS--------
GLMM_PSEHT      EVEQTLGEKG-RVLLRKSGTEPVVRVMVEAEQEKLVIDS-AEKIAAVVESMSKQTD----
GLMM_BLOFL      IIKQELSDQG-RILLRQSGTEPYIRVMVEGKH-YSKISYLANRIVSVIKGEMRSVN----
GLMM_BLOPB      AVEQELSEQG-RVLLRQSGTEPYIRIMVEGNCCYGKILYLANRIASVIRSEIKSIQ----
GLMM_BUCAI      QYKNILGQNS-RVLVRRSGTEPCIRIMVEGED-YLKVYELAQYIGKTIKLL---------
GLMM_BUCBP      KYKDFLGKYS-RIMLRLSGTEKCIRIMIEGCC-SKKINIFSKMLINVINSVKKSRFSIIT
GLMM_WIGBR      ISKKNLDGNG-RILLRKSGTEPLIRIMVEGKE-ENKIIKLAYNIANAVKSVI--------
GLMM_ACIAD      QAEAQLKGRG-RLLIRKSGTEPVIRVMVEGDNQKEVTDL-AHRLAESVRTHAA-------
GLMM_PSYA2      KARATLEGRG-RLLIRQSGTEPMIRVMVESDDEIECDVM-ANDLADKIKDTLG-------
GLMM_FRATT      DVEKRLGNRG-RVLLRPSGTEPVLRVMVEADDKSLATNE-AEYLVEKVKQKLV-------
GLMM_THEMA      KIVEESTSRGYRVVIRPSGTEPVIRITVEGKDREEIEKI-VEEISRVLES----------
GLMM_NOSS1      LAEKAMGDTG-RILVRASGTEPVIRVMVEAANAELANYWTNELVAQVQQHLAP-------
GLMM_SYNY3      TAEKSMGTTG-RILVRASGTEPLIRVMVEAACAETAAHWSDQLTSTVQCHLGDS------
GLMM_THEEB      KAQLDMGDRG-RVLVRASGTEPVIRVMVEAEQQNIADYWTETLVQTVSAHLAA-------
GLMM_SYNP6      AAETDMGDRG-RVLVRASGTEPLLRIMVEAEEAQQVEHWTTHLVQVAESHLL--------
GLMM_PROMM      AAEAAMGEDG-RVLVRASGTEPLLRVMIEAADSAAVEFWTAQLADLAEQHLNRGCV----
GLMM_SYNPX      QAEASMGAAG-RVLVRASGTEPVLRVMVESEDQSLVDRWTQHLAAMADEHLNAA------
GLMM_PROMA      EAELDLGKEG-RVFIRKSGTEPLVRVMVESIDKLLVESLTTKIAKIALEEFN--------
GLMM_PROMP      SFSNIKKDNC-RVYIRPSGTEPVLRILVEARNQQEVDSLSTKITAELSTKIYKISKTF--
GLMM_PROM5      SFSSIKKNDC-RVYIRPSGTEPVLRILVEAQNQKEVDFLSTKITTELRSKINKISNNL--
GLMM_PROMS      NFQALYSHNC-RVYIRPSGTEPLIRVLVEAKSHKKVNSLSSEITNKLSLEINKIIN----
GLMM_PROM9      NFQKIYSDNC-RIYIRPSGTEPLMRVLVEAKSHKKVDSLSSEIANKLILEINKIMN----
                           .  .* ***:   *   *                               

GLMM_BACAN      ----------
GLMM_BACCZ      ----------
GLMM_BACHK      ----------
GLMM_BACC1      ----------
GLMM_BACCR      ----------
GLMM_BACLD      ----------
GLMM_BACSU      ----------
GLMM_GEOKA      ----------
GLMM_BACHD      ----------
GLMM_BACSK      ----------
GLMM_LISMF      ----------
GLMM_LISMO      ----------
GLMM_LISIN      ----------
GLMM_OCEIH      ----------
GLMM_STAAC      ----------
GLMM_STAA8      ----------
GLMM_STAAM      ----------
GLMM_STAAN      ----------
GLMM_STAAW      ----------
GLMM_STAAR      ----------
GLMM_STAAS      ----------
GLMM_STAEQ      ----------
GLMM_STAES      ----------
GLMM_STAS1      ----------
GLMM_STAHJ      ----------
GLMM_LACAC      ----------
GLMM_LACJO      ----------
GLMM_LACPL      ----------
GLMM_STRA3      ----------
GLMM_STRA5      ----------
GLMM_STRA1      ----------
GLMM_STRT1      ----------
GLMM_STRT2      ----------
GLMM_STRP1      ----------
GLMM_STRP3      ----------
GLMM_STRP6      ----------
GLMM_STRPM      ----------
GLMM_STRP8      ----------
GLMM_STRMU      ----------
GLMM_STRPN      ----------
GLMM_STRR6      ----------
GLMM_LACLA      ----------
GLMM_CLOAB      ----------
GLMM_CLOTE      ----------
GLMM_CLOPE      ----------
GLMM_CALS4      ----------
GLMM_FUSNN      ----------
GLMM_COREF      ----------
GLMM_CORGL      ----------
GLMM_CORDI      ----------
GLMM_CORJK      ----------
GLMM_MYCBO      ----------
GLMM_MYCTU      ----------
GLMM_MYCLE      DAISGVELRL
GLMM_MYCPA      ----------
GLMM_NOCFA      ----------
GLMM_STRAW      ----------
GLMM_STRCO      ----------
GLMM_THEFY      ----------
GLMM_LEIXX      ----------
GLMM_CUTAK      ----------
GLMM_BIFLO      ----------
GLMM_TROW8      ----------
GLMM_TROWT      ----------
GLMM_SYMTH      ----------
GLMM_THET2      ----------
GLMM_THET8      ----------
GLMM_DEIRA      ----------
GLMM_AGRFC      ----------
GLMM_RHIME      ----------
GLMM_BRUME      ----------
GLMM_BRUSU      ----------
GLMM_RHILO      ----------
GLMM_BARHE      LERS------
GLMM_BARQU      LEGS------
GLMM_BRADU      ----------
GLMM_NITWN      ----------
GLMM_RHOPA      ----------
GLMM_CAUVC      ----------
GLMM_GLUOX      ----------
GLMM_ZYMMO      ----------
GLMM_RUEPO      ----------
GLMM_CAMJE      ----------
GLMM_CAMJR      ----------
GLMM_HELPJ      ----------
GLMM_HELPY      ----------
GLMM_HELHP      ----------
GLMM_WOLSU      ----------
GLMM_PELUB      ----------
GLMM_ANAMM      MQ--------
GLMM_DESPS      ----------
GLMM_GEOSL      ----------
GLMM_DESVH      ----------
GLMM_BDEBA      ----------
GLMM_CHLAB      ----------
GLMM_CHLCV      ----------
GLMM_CHLPN      ----------
GLMM_CHLMU      ----------
GLMM_CHLTR      ----------
GLMM_PARUW      ----------
GLMM_LEGPA      ST--------
GLMM_LEGPH      ST--------
GLMM_LEGPL      ST--------
GLMM_COXBU      ----------
GLMM_AROAE      ----------
GLMM_DECAR      ----------
GLMM_BORBR      ----------
GLMM_BORPA      ----------
GLMM_BORPE      ----------
GLMM_BURMA      ----------
GLMM_BURPS      ----------
GLMM_CUPPJ      ----------
GLMM_RALSO      ----------
GLMM_NEIG1      ----------
GLMM_NEIMB      ----------
GLMM_NEIMA      ----------
GLMM_NEISU      ----------
GLMM_CHRVO      ----------
GLMM_NITEU      ----------
GLMM_METCA      ----------
GLMM_NITOC      ----------
GLMM_PSE14      ----------
GLMM_PSESM      ----------
GLMM_PSEU2      ----------
GLMM_PSEF5      ----------
GLMM_PSEPK      ----------
GLMM_PSEAE      ----------
GLMM_XANAC      ----------
GLMM_XANC5      ----------
GLMM_XANOR      ----------
GLMM_XANC8      ----------
GLMM_XANCP      ----------
GLMM_XYLFA      ----------
GLMM_XYLFT      ----------
GLMM_ECOL6      ----------
GLMM_SHISS      ----------
GLMM_ECO57      ----------
GLMM_ECOLI      ----------
GLMM_SHIFL      ----------
GLMM_SALTI      ----------
GLMM_SALTY      ----------
GLMM_SALCH      ----------
GLMM_SALPA      ----------
GLMM_YERPE      ----------
GLMM_YERPS      ----------
GLMM_PECAS      ----------
GLMM_PHOLL      ----------
GLMM_PHOPR      ----------
GLMM_ALIF1      ----------
GLMM_VIBVU      ----------
GLMM_VIBVY      ----------
GLMM_VIBPA      ----------
GLMM_VIBCH      ----------
GLMM_HAEI8      ----------
GLMM_HAEIN      ----------
GLMM_MANSM      ----------
GLMM_PASMU      ----------
GLMM_HAEDU      ----------
GLMM_IDILO      ----------
GLMM_COLP3      ----------
GLMM_SHEON      ----------
GLMM_PSEHT      ----------
GLMM_BLOFL      ----------
GLMM_BLOPB      ----------
GLMM_BUCAI      ----------
GLMM_BUCBP      MF--------
GLMM_WIGBR      ----------
GLMM_ACIAD      ----------
GLMM_PSYA2      ----------
GLMM_FRATT      ----------
GLMM_THEMA      ----------
GLMM_NOSS1      ----------
GLMM_SYNY3      ----------
GLMM_THEEB      ----------
GLMM_SYNP6      ----------
GLMM_PROMM      ----------
GLMM_SYNPX      ----------
GLMM_PROMA      ----------
GLMM_PROMP      ----------
GLMM_PROM5      ----------
GLMM_PROMS      ----------
GLMM_PROM9      ----------