CLUSTAL format seed alignment for MF_01558

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CDD_HAEIN       -------MQDLIKRTLPQDD--ALNQAIVNDLRSQNWAGFLNYSQVQQLCHNFELTTLKL
CDD_HAEI8       -------MQELIKRTLPQDD--ALNQAIVNELRSQNWAGFLNYSQVQQLCHNFELTPLKL
CDD_PASMU       -------MSEKIRKTLSLIESQQLAQDVWHILQEQHFKGMLPYFTVEHLCTKHQLTPQQL
CDD_HAEDU       MTMPTLSALQHRLAQLAEQKNEPLTLAIIEQLKQQSYQGALSAPLVQQFCQQFSLSKIEL
CDD_MANSM       ----MKNTIIKGLTDLVEQKRDNLIRQVVVQLEAQGYKAVLEQATVQQFCRQFALSPVEF
CDD_ECOL6       --------MHPRFQTAFAQLADNLQSALEPILADKYFPALLTGEQVSSLKSATGLDEDAL
CDD_ECO57       --------MHPRFQTAFAQLADNLQSALEPILADKYFPALLTGEQVSSLKSATGLDEDAL
CDD_ECOLI       --------MHPRFQTAFAQLADNLQSALEPILADKYFPALLTGEQVSSLKSATGLDEDAL
CDD_SHIBS       --------MHPRFQTAFAQLADNLQSALEPILADKYFPALLTGEQVSSLKSATGLDEDAL
CDD_SHIFL       --------MHPRFQTAFAQLADNLQSALEPILADKYFPALLTGEQVSSLKSATGLDEDAL
CDD_SHISS       --------MHPRFQTAFAQLADNLQSALEPILADKYFPALLTGEQVSSLKSATGLDEDAL
CDD_SHIDS       --------MHPRFQTAFAQLADNLQSALEPILADKYFPALLTGEQVSSLKSATGLDEDAL
CDD_SALPA       --------MHPRFQTAFAQLADNLQSALAPILADHHFPAMLTAEQVSTLKNTARLDEDAL
CDD_SALTY       --------MHPRFQTAFAQLADNLQSALAPILADHHFPAMLTAEQVSTLKNTAGLDEDAL
CDD_SALTI       --------MHPRFQTAFAQLADNLQSALAPILADHHFPAMLTAEQVSTLKNTAGLDEDAL
CDD_SALCH       --------MHPRFQTAFAQLADNLQSALAPILAGHHFPAMLTAEQVSTLKNTAGLDEDAL
CDD_YERPE       --------MQARFHTSWAELPASLQFALEPILSAENFPAMLTAEQVKTVKNISGLDDDAL
CDD_YERPS       --------MQARFHTSWAELPASLQFALEPILSAENFPAMLTAEQVKTVKNISGLDDDAL
CDD_PHOLL       --------MQARFHPIWVQLPSKLQDALLPYAGNDDFPAMLTAEQAKSIKKACGFDDNTL
CDD_PECAS       --------MHTRFENAFQQLSASLQDALGPLIDKPDFAAMLTADEVNAVCEASQLDVDAL
CDD_VIBVU       --------MKSRFENALASAPESLSRHLAPIILAADFDASLSTVQFDELLKQTGMTDNQL
CDD_VIBVY       --------MKSRFENALASAPESLSRHLAPIILAADFDASLSTVQFDELLKQTGMTDNQL
CDD_VIBPA       --------MKSRIEQALASAPEALSKQLAPIVLADDFDATLSAQQFEQLLSATSLSDKEL
CDD_VIBCH       --------MRNRIEQALQQMPASFAPYLRELVLAKDFDATFSAEQYQQLLTLSGLEDADL
CDD_ALIF1       -----MTRLQQRLEEALANLPDALRTSLTPII-NTEFKGVISKEQFQSLQADSQLSDKEL
CDD_PHOPR       --------MHAKIMDALGSLPSDLASAVKPIFEDANFDATLSPEQFTTLLSTTHMTDSEL
CDD_SHEON       --------MQDRFIRSITQLPTPLADALIPLL-HQGFAGHIDAQHLAELVKSSNMTESEV
CDD_PSEHT       -MASATFLVQANTALSNTHISLSVAQTQALRSQLKTQRGILNANNINQLCAQLNVTNDAL
                                       .              . :       .     .    .

CDD_HAEIN       AMHLLPLAASYSHTAISHFNVGAIAIGEQG----DFYFGANQEFANSAIQQTIHAEQSAI
CDD_HAEI8       AMHLLPLAASYSHTAISHFNVGAIAIGEQG----DFYFGANQEFANSAIQQTIHAEQSAI
CDD_PASMU       ALKLLPIAAAYSLAPISQFHVGAIAIGQRG----AYYFGANLEFASTHIQQTVHAEQSAI
CDD_HAEDU       GLGCVPIAACYALTPVSHFCVGAVAIGLSG----SFYFGANQEFAGIAMQQTVHAEQSAI
CDD_MANSM       ALRCLPVAACYALTPISQFNVGAIAIGQSG----SFYFGANQEFVAASMQQTVHAEQSAI
CDD_ECOL6       AFALLPLAAACARTPLSNFNVGAIARGVSG----TWYFGANMEFIGATMQQTVHAEQSAI
CDD_ECO57       AFALLPLAAACARTPLSNFNVGAIARGVSG----TWYFGANMEFIGATMQQTVHAEQSAI
CDD_ECOLI       AFALLPLAAACARTPLSNFNVGAIARGVSG----TWYFGANMEFIGATMQQTVHAEQSAI
CDD_SHIBS       AFALLPLAAACARTPLSNFNVGAIARGVSG----TWYFGANMEFIGATMQQTVHAEQSAI
CDD_SHIFL       AFALLPLAAACARTPLSNFNVGAIARGVSG----TWYFGANMEFIGATMQQTVHAEQSAI
CDD_SHISS       AFALLPLAAACARTPLSNFNVGAIARGVSG----TWYFGANMEFIGATMQQTVHAEQSAI
CDD_SHIDS       AFALLPLAAACALTPLSNFNVGAIARGVSG----TWYFGANMEFIGATMQQTVHAEQSAI
CDD_SALPA       AFALLPLAAACARTDLSHFNVGAIARGVSG----NWYFGANMEFLGATMQQTVHAEQSAI
CDD_SALTY       AFALLPLAAACARTDLSHFNVGAIARGVSG----NWYFGANMEFLGATMQQTVHAEQSAI
CDD_SALTI       AFALLPLAAACARTDLSHFNVGAIARGVSG----NWYFGANMEFLGATMQQTVHAEQSAI
CDD_SALCH       AFALLPLAAACARTDLSHFNVGAIARGVSG----NWYFGANMEFLGATMQQTVHAEQSAI
CDD_YERPE       AFALLPLATACALTPISHFNVGAIARGKSG----NFYFGANMEFRGVPLQQTIHAEQCAV
CDD_YERPS       AFALLPLATACALTPISHFNVGAIARGKSG----NFYFGANMEFRGVPLQQTIHAEQCAV
CDD_PHOLL       AVALLPLAAASSLTPISHFNVGAIARGESG----NLYFGANMEFAGVPLQQTIHAEQCAI
CDD_PECAS       AFALLPLAAACAQASISNFQVGAIAQGLSG----NFYFGANMEFTAVQLQQTVHAEQSAV
CDD_VIBVU       RVALLPFAAAYSYAPISEFYVGAIVRGLSG----ALYFGANMEFDGVQLGQTVHAEQSAI
CDD_VIBVY       RVALLPFAAAYSYAPISEFYVGAIVRGLSG----TLYFGANMEFDGVQLGQTVHAEQSAI
CDD_VIBPA       RVALLPFAAAYSYAPISEFYVGAIVRGLSG----RLYFGANMEFFGVQLGQTVHAEQSAI
CDD_VIBCH       RVALLPIAAAYSYAPISEFYVGAIVRGISG----RLYLGANMEFTGAQLGQTVHAEQCAI
CDD_ALIF1       RLALLPLAAAFSVAPISNFYVGAIARGLTG----NLYFGANMEYNDVQLGQTIHAEQSAI
CDD_PHOPR       RVALLPIAAAYSVAPISKFFVGAIVRGESG----RLYFGANMEFVGASLSQTIHAEQSAI
CDD_SHEON       LLALLPIAAALAKPPISEFYVGAIAKGKSG----DIYMGANLELPGEALFHSVHAEQSAI
CDD_PSEHT       LQGLVPLASEFAVAPVSNFHVGAIVKALDESGEVNFYFGANAEFNRQALSLVVHAEQSAI
                    :*.*:  : . :*.* ***:. .         *:*** *     :   :****.*:

CDD_HAEIN       SHAWLRNERRISDMVVNYTPCGHCRQFMNELHGAEKISIHLPHSQNNPLHSYLPDAFGPK
CDD_HAEI8       SHAWLRNERRISDMVVNYTPCGHCRQFMNELHGAEKISIHLPHSQNNPLHSYLPDAFGPK
CDD_PASMU       SHAWMNHESAITDVVVNYTPCGHCRQFMNELKTAPQLKIHLPHSQNNLLHSYLPDAFGPA
CDD_HAEDU       SHAWLAGEGAISDMVVNCTPCGHCRQFMNELNTATTLQIHLPHRQHNTLQQYLIDAFGPK
CDD_MANSM       SHAWLAGEKAIAHMVVNYTPCGHCRQFMNELNSAERLKIHLPHSQNNLLHNYLPDAFGPK
CDD_ECOL6       SHAWLSGEKALAAITVNYTPCGHCRQFMNELNSGLDLRIHLPGREAHALRDYLPDAFGPK
CDD_ECO57       SHAWLSGEKALAAITVNYTPCGHCRQFMNELNSGLDLRIHLPGREAHALRDYLADAFGPK
CDD_ECOLI       SHAWLSGEKALAAITVNYTPCGHCRQFMNELNSGLDLRIHLPGREAHALRDYLPDAFGPK
CDD_SHIBS       SHAWLSGEKALAAITVNYTPCGHCRQFMNELNSGLDLRIHLPGREAHALRDYLPDAFGPK
CDD_SHIFL       SHAWLSGEKALAAITVNYTPCGHCRQFMNELNSGLDLRIHLPGREAHALRDYLPDAFGPK
CDD_SHISS       SHAWLSGEKALAAITVNYTPCGHCRQFMNELNSGLDLRIHLPGREAHALRDYLPDAFGPK
CDD_SHIDS       SHAWLSGEKALAAITVNYTPCGHCRQFMNELNSGLDLRIHLPGREAHALRDYLPDAFGPK
CDD_SALPA       SHAWLRGEKGLAAVTVNYTPCGHCRQFMNELNSGLDLRIHLPGRAPHTLRDYLPDAFGPK
CDD_SALTY       SHAWLRGEKGLAAVTVNYTPCGHCRQFMNELNSGLDLRIHLPGRAPHTLRDYLPDAFGPK
CDD_SALTI       SHAWLRGEKGLAAVTVNYTPCGHCRQFMNELNSGLDLRIHLPGRAPHTLRDYLPDAFGPK
CDD_SALCH       SHAWLRGEKGLAAVTVNYTPCGHCRQFMNELNSGLDLRIHLPGRAPHTLRDYLPDAFGPK
CDD_YERPE       THAWLRGETNLVAITVNYTPCGHCRQFMNELNSGSELHIHLPGRPPSTLGQYLPDSFGPT
CDD_YERPS       THAWLRGETNLVAITVNYTPCGHCRQFMNELNCGSELHIHLPGRPPSTLGQYLPDSFGPT
CDD_PHOLL       THAWLLGEKRLASVTVNYSPCGHCRQFMNELNSGTQLEIHLPKQASSTLDHYLPDSFGPN
CDD_PECAS       SHAWLRNERGLRAVTVNYTPCGHCRQFMNELRNAASLRIQLPGRQPAVLSHYLPDAFGPV
CDD_VIBVU       SHAWMKGEQGLSDITINFSPCGHCRQFMNELSSAKELKIQLPEREEKKLHDYLPDSFGPS
CDD_VIBVY       SHAWMKGEQGLSDITINFSPCGHCRQFMNELSSAKELKIQLPEREEKKLHDYLPDSFGPS
CDD_VIBPA       SHAWMKGEHGVKDITINFSPCGHCRQFMNELSTAKELKVQLPERDEKSLHEYLPEAFGPA
CDD_VIBCH       SHAWMKGEKGVADITINFSPCGHCRQFMNELTTASSLKIQLPKRAAKTLQEYLPESFGPA
CDD_ALIF1       SHAWIQGETGISNITINFSPCGHCRQFMNELTTADSLMVQLPERNEKSLQEYLPESFGPK
CDD_PHOPR       SHAWIKGETGITDITINYSPCGHCRQFMNELTTAKTLIVQLPEREEQTLQQYLPESFGPA
CDD_SHEON       SHAWLSGESQIVDMIVNASPCGHCRQFMNELVDGGQIKIHLPSQDSHLLSYYLPYAFGPK
CDD_PSEHT       NNAWLNGAKKILKIAISDAPCGYCRQFMNELADAREFDILLPEQQ-FKLADLLPHSFGPT
                .:**:     :  : :. :***:********  .  : : **      *   *  :*** 

CDD_HAEIN       DLDIAAHLLAEENHDLVADHQDDLVNQAILAANQSHCPYSNSPHGIAILFKNSDVVTGRY
CDD_HAEI8       DLDIAAHLLAEENHDLVADHQDDLVNQAILAANQSHCPYSNSPHGIAILFKNGDVVTGRY
CDD_PASMU       DLDIQHFLLDAQNNQLTYETQDPVMLTALECANAAHAPYSKSYHGIAIETKDKQIYRGSY
CDD_HAEDU       DLNIANVLFDQQHIVLPLQG-DALVQATIKEAQQAYAPYSQAVSAVALQV-GEQIICGRY
CDD_MANSM       DLNIQNVFFDGQSHPFNYQGHDPLIRAAVEAASQSYAPYSQAFSGVALQL-GELIICGRY
CDD_ECOL6       DLEIKTLLMDEQDHGYAL-TGDALSQAAIAAANRSHMPYSKSPSGVALECKDGRIFSGSY
CDD_ECO57       DLEIKTLLMDEQDHGYAL-TGDALSQAAIAAANRSHMPYSKSPSGVALECKDGRIFSGSY
CDD_ECOLI       DLEIKTLLMDEQDHGYAL-TGDALSQAAIAAANRSHMPYSKSPSGVALECKDGRIFSGSY
CDD_SHIBS       DLEIKTLLMDEQDHGYAL-TGDALSQAAIAAANRSHMPYSKSPSGVALECKDGRIFSGSY
CDD_SHIFL       DLEIKTLLMDEQDHGYAL-TGDALSQAAIAAANRSHMPYSKSPSGVALECKDGRIFSGSY
CDD_SHISS       DLEIKTLLMDEQDHGYAL-TGDALSQAAIAAANRSHMPYSKSPSGVALECKDGRIFSGSY
CDD_SHIDS       DLEIKTLLMDEQDHGYAL-TGDALSQAAIAAANRSHMPYSKSPSGVALECKDGRIFSGSY
CDD_SALPA       DLEIKTLLMDEQDHGFTL-TGDTLTQAAITAANKSHMPYSHSPSGVALECKDGRIFTGSY
CDD_SALTY       DLEIKTLLMDEQDHGFTL-TGDTLTQAAITAANKSHMPYSHSPSGVALECKDGRIFTGSY
CDD_SALTI       DLEIKTLLMDEQDHGFTL-TGNTLTQAAITAANKSHMPYSHSPSGVALECKDGRIFTGSY
CDD_SALCH       DLEIKTLLMDEQDHGFTL-TGDTLTQAAITAANKSHMPYSHSPSGVALECKDGRIFTGSY
CDD_YERPE       DLAITTLLMDPVNHGYTLAETDPLTQAALNAANHSHAPYSQSHSGVALETTNGKIYAGRY
CDD_YERPS       DLAITTLLMDPVNHGYTLAETDPLTQAALNAANHSHAPYSQSHSGVALETTNGKIYAGRY
CDD_PHOLL       DLGITTLLMDPVNHGYKLETTDKLVLTALDAANQSYAPYSNSYSGTALLGKDGIIYPGRY
CDD_PECAS       DLQIDTLLMDDINHGATLQNVNALTRQALDAANRSHAPYSKAISGIALETASGNIYTGRY
CDD_VIBVU       DLGIESALMSQVHHGFATEDDDALMQRAVEAMNRSHAPYTHNLSGVALQTESGRVYLGAY
CDD_VIBVY       DLGIESALMSQVHHGFATEDDDALMQRAVEAMNRSHAPYTHNLSGVALQTESGRVYLGAY
CDD_VIBPA       DLGIESGLMAEVKHQFVCDDKDALIQQAVEAMNMSHAPYTNNLSGLALELANGRVFKGAY
CDD_VIBCH       DLGIDSGLMSPVNHGKTSDDDEELIQQALRAMNISHSPYTQNFSGVALKMRSGAIYLGAY
CDD_ALIF1       DLGIEGGLLAPLSHNLALETESPLLRKALEAANRSHAPYSHNLSGIALEMESGEVYYGMY
CDD_PHOPR       DLNITDALLGKIDHGMTIKETDEFVAIACKAANGSHAPYTKNYSGVALKATDGKVFTGKY
CDD_SHEON       DLNVQSPLLVKQETEFALDSSDPMVIEALDHAGLSYAPYTQSYAAVVLETADGATYCGRY
CDD_PSEHT       DLGNQYSLFNPAPQARSF-NNTEVEQQLAAYALAAYVPYSQNYSAVKITTFNNGDFYGSY
                **     ::              .          :: **::   .  :   .     * *

CDD_HAEIN       AENAAFNPSLPALQTALNFAYLNDKKLSDIERIVMAEKALKLSHKTMAETLLSTLTSVEL
CDD_HAEI8       AENAAFNPSLPALQTALNFAYLNDKKLSDIERIVMAEKALKLSHKTMAETLLSTLTSVEL
CDD_PASMU       AENAAFNPSLPALQVALNHLLLSGDTLQNIQRIVMIEKANHLCYRHMAEDLVANLVDIPL
CDD_HAEDU       AENAAFNPSLLPLQSALNYRRFLGLSDVAVSRVVMVEKRAVLSHYHMSKALAETALGLTL
CDD_MANSM       AENAAFNPTFLPLQSALNYQRLQGLIDVKVSRVVMAEAKADLTSLPMTQSLAGAHLGLDI
CDD_ECOL6       AENAAFNPTLPPLQGALILLNLKGYDYPDIQRAVLAEKADAPLIQWDATSATLKALGCHN
CDD_ECO57       AENAAFNPTLPPLQGALILLNLKGYDYPDIQRAVLAEKADAPLIQWDATSATLKALGCHN
CDD_ECOLI       AENAAFNPTLPPLQGALILLNLKGYDYPDIQRAVLAEKADAPLIQWDATSATLKALGCHS
CDD_SHIBS       AENAAFNPTLPPLQGALILLNLKGYDYPDIQRAVLAEKADAPLIQWDATSATLKALGCHS
CDD_SHIFL       AENAAFNPTLPPLQGALILLNLKGYDYPDIQRAVLAEKADAPLIQWDATSATLKALGCHS
CDD_SHISS       AENAAFNPTLPPLQGALILLNLKGYDYPDIQRAVLAEKADAPLIQWDATSATLKALGCHS
CDD_SHIDS       AENAAFNPTLPPLQGALILLNLKGYDYPDIQRAVLAEKADAPLIQWDATSATLKALGCHS
CDD_SALPA       AENAAFNPTLPPLQGALNLLSLNGYDYADIQRAILAEKGDAALIQWDATAATLKALGCHN
CDD_SALTY       AENAAFNPTLPPLQGALNLLSLNGYDYADIQRAILAEKGDAALIQWDATAATLKALGCHN
CDD_SALTI       AENAAFNPTLPPLQGALNLLSLNGYDYADIQRAILAEKGDAALIQWDATAATLKALGCHN
CDD_SALCH       AENAAFNPTLPPLQGALNLLSLNGYDYADIQRAILAEKGDAALIQWDATAATLKALGCHN
CDD_YERPE       AENAAFNPSLPPLQAALILANITGENCASIRRAVLVEGHNAVTSQWDTTLATLNALGCSA
CDD_YERPS       AENAAFNPSLPPLQAALILANITGENCASIRRAVLVEGHNAVTSQWDTTLATLNALGCSA
CDD_PHOLL       AENAAFNPSLPPLQAALILMNISGGDCLAIERAVLVEGKHSDLSQRSATQSILAALGCSK
CDD_PECAS       AENAAFNPSLPPLQAALNLMNLAGEDPSTIKYAAVVERRNAVVSHWAISQIMLAELGCTD
CDD_VIBVU       AENAAFNPSLPPLQVALIQLLLAGERFENIQSAALVESHKGKISHLACTQSTLEALNPDI
CDD_VIBVY       AENAAFNPSLPPLQVALIQLLLAGERFENIQSAALVESHKGKISHLACTQSTLEALNPDI
CDD_VIBPA       AENAAFNPSLPPLQVALIQVLLAGETFDSIKAAALVENSEGKISHLADTQSTLEALNPDI
CDD_VIBCH       AENAAFNPSLPPLQVALAQAMMMGESFEDIEAAALVESATGKISHLADTQATLEVINPDI
CDD_ALIF1       AENAAFNPSLPPLQVALVHANMSREDILTVKSAALVEDHKGAISHLAITQSTLEALNPDV
CDD_PHOPR       AENAAFNPSLPPLQVALVNMNMAGYALTEIAEAALVEKADSTISHLSDTQTTLEALNPDI
CDD_SHEON       AENAAFNPSMLPMQMALSNLTRHNRDFAEIRRAVLVESSQGKISLVGAAMDALHAVAAIE
CDD_PSEHT       AENAAYSPSLSPLQSALSQLFLAGLSFDQHTVKGITLLETAGHENQAGVAQAVLASFVNL
                *****:.*:: .:* **                 :                         

CDD_HAEIN       EYYSL-------
CDD_HAEI8       EYYSL-------
CDD_PASMU       DYIAL-------
CDD_HAEDU       EYIAV-------
CDD_MANSM       EYISL-------
CDD_ECOL6       IDRVLLA-----
CDD_ECO57       IDRVLLA-----
CDD_ECOLI       IDRVLLA-----
CDD_SHIBS       IDRVLLA-----
CDD_SHIFL       IDRVLLA-----
CDD_SHISS       IDRVLLA-----
CDD_SHIDS       IDRVLLA-----
CDD_SALPA       IDRVLLG-----
CDD_SALTY       IDRVLLG-----
CDD_SALTI       IDRVLLG-----
CDD_SALCH       IDRVLLG-----
CDD_YERPE       VKRVTF------
CDD_YERPS       VKRVTF------
CDD_PHOLL       FDYYTF------
CDD_PECAS       VEHHFIEE----
CDD_VIBVU       PVSYLSL-----
CDD_VIBVY       PVSYLSL-----
CDD_VIBPA       PVSFVNV-----
CDD_VIBCH       PLSYLSL-----
CDD_ALIF1       TLEYASL-----
CDD_PHOPR       PLTYVAA-----
CDD_SHEON       LEHIVVDPI---
CDD_PSEHT       PPLELISAPLSE