CLUSTAL format seed alignment for MF_01560

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y3709_BACCZ      MASETVSNHQEKALALLQADAEKILRLIKVQMDHLTMPQCPLYEEVLDTQMFGLSREVDF
Y3692_BACHK      MASETVSNHQEKALALLQADAEKILRLIKVQMDHLTMPQCPLYEEVLDTQMFGLSREVDF
Y4159_BACAN      MASETVSNHQEKALALLQADAEKILRLIKVQMDHLTMPQCPLYEEVLDTQMFGLSREVDF
Y3996_BACC1      MASETVSNHQEKALALLQADAEKILRLIKVQMDHLTMPQCPLYEEVLDTQMFGLSREVDF
Y3949_BACCR      MASETVANHQEKALALLQADAEKILRLIKVQMDHLTMPQCPLYEEVLDTQMFGLSREVDF
Y1701_BACLD      MASEIVVDHREKALALLKRDADKILKLIQVQMDNLTMPQCPLYEEVLDTQMFGLSREIDF
YLAN_BACSU       MASEMIVDHRQKAFELLKVDAEKILKLIRVQMDNLTMPQCPLYEEVLDTQMFGLSREIDF
Y2626_ALKHC      MSAETVTGHNEKAYALLKSDAEKIRKLIEVQLENLTMPQCPLYEEVLDTQMFGLSREIDF
Y2396_ALKCK      MTTNAVTSQSEKAYALLQADAEKIQKLIEVQLENLTMPQCPLYEEVLDTRMFGLSREIDF
Y1428_OCEIH      -MPDLMIDHREKAHALLKADADKILRLIEVQIENLTMPQCPVYEDVLDTQMYGLSREIDF
Y1077_GEOKA      -MTDESMSYREKAYALLQADAEKIIQLIRVQMDHLTMPQCPVYEEVLDTQMFGLSREIDF
Y1047_STAAS      --MAKQATMKNAALKQLTKDADEILHLIKVQLDNLTLPSCPLYEEVLDTQMFGLQKEVDF
Y995_STAAW       --MAKQATMKNAALKQLTKDADEILHLIKVQLDNLTLPSCPLYEEVLDTQMFGLQKEVDF
Y961_STAAN       --MAKQATMKNAALKQLTKDADEILHLIKVQLDNLTLPSCPLYEEVLDTQMFGLQKEVDF
Y1112_STAAM      --MAKQATMKNAALKQLTKDADEILHLIKVQLDNLTLPSCPLYEEVLDTQMFGLQKEVDF
Y1121_STAAC      --MAKQATMKNAALKQLTKDADEILHLIKVQLDNLTLPSCPLYEEVLDTQMFGLQKEVDF
Y1086_STAAR      --MAKQTTMKNAALKQLTKDADEILHLIKVQLDNLTLPSCPLYEEVLDTQMFGLQKEVDF
Y701_STAEQ       --MSNQSKLNSAAYDQLNKDADRILHLIKVQMDNLTLPSCPLYEEVLDTQMFGLQKEVDF
Y811_STAES       --MSNQSKLNSAAYDQLNKDADRILHLIKVQMDNLTLPSCPLYEEVLDTQMFGLQKEVDF
Y1677_STAS1      --MEKNQKINNAAYDQLNKDADRILQLIKVQMDNLTLPQCPLYEEVLDTQMFGLQKEVDF
Y1840_STAHJ      --MPKQSKMSNVAYEQLNQDADRILHLIKVQMDNLTLPSCPLYEEVLDTQMFGLQKEVDF
Y1087_LISMF      -MANKKIDHREEAVELLKQDAKRILQLIKVQMDNLTLPQCPAYEEVLDTQMYGLSREINF
Y1070_LISMO      -MANKKIDHREEAVELLKQDAKRILQLIKVQMDNLTLPQCPAYEEVLDTQMYGLSREINF
Y1058_LISIN      -MANKKIDHREEAIELLKQDAKRILQLIKVQMDNLTLPQCPAYEEVLDTQMYGLSREINF
Y2458_ENTFA      --MDEGIS-KKFAIQLLEDDAERIKMLIRNQKNSLCISQCKAFEEVVDTQMYGFSRQVTY
Y1078_LATSS      ----MMIKQETIGYMTLKSDAAKIEALLTKQFDALCLSQCPIIEEIIDTQLFGFTKEVDF
                             .   *  ** .*  *:  * : * :..*   *:::**:::*: ::: :

Y3709_BACCZ      AVRLGLIAEEQGKAMLGELERELSALHEAFTNKQQ---------
Y3692_BACHK      AVRLGLIAEEQGKAMLGELERELSALHEAFTNKQQ---------
Y4159_BACAN      AVRLGLIAEEQGKVMLGELERELSALHEAFTNKQQ---------
Y3996_BACC1      AVRLGLISEEQGKAMLGELERELSALHEAFTNKQQ---------
Y3949_BACCR      AVRLGLIAEEQGKAMLGELERELSALHEAFTNKQQ---------
Y1701_BACLD      AVRLGLVDEEEGKELLYRLERELSALHDAFTKK-----------
YLAN_BACSU       AVRLGLVDEKDGKDLLYTLERELSALHDAFTAK-----------
Y2626_ALKHC      AIRLELIDEEQGKQLLSELERKLADLHEATVRK-----------
Y2396_ALKCK      AIRLELVEEEKGKMILSELERKLALLHEASMRK-----------
Y1428_OCEIH      AVRLELISEIEGKALLENLEKKLNILHEASQNTL----------
Y1077_GEOKA      AVRLGLVEAKDGKALLDRLERELSTLHEAVAKKRVR--------
Y1047_STAAS      AVKLGLVDREDGKQIMLRLEKELSKLHEAFTLV-----------
Y995_STAAW       AVKLGLVDREDGKQIMLRLEKELSKLHEAFTLV-----------
Y961_STAAN       AVKLGLVDREDGKQIMLRLEKELSKLHEAFTLV-----------
Y1112_STAAM      AVKLGLVDREDGKQIMLRLEKELSKLHEAFTLV-----------
Y1121_STAAC      AVKLGLVDREDGKQIMLRLEKELSKLHEAFTLV-----------
Y1086_STAAR      AVKLGLVDREDGKQIMLRLEKELSKLHEAFTLV-----------
Y701_STAEQ       AVQLGLVDKEDGKQLMLRLEKELSKLHEAFTNV-----------
Y811_STAES       AVQLGLVDKEDGKQLMLRLEKELSKLHEAFTNV-----------
Y1677_STAS1      AVQLGLVDREVGKDLMLRLEKELSKLHDAFTNV-----------
Y1840_STAHJ      AVKLGLVDKEDGKNLMLRLEKELSKLHEAFTNVK----------
Y1087_LISMF      ATRLGLIEPEEGKKLMSTLEKELSTLHELSMSKK----------
Y1070_LISMO      ATRLGLIEPEEGKKLMSTLEKELSTLHELSMSKK----------
Y1058_LISIN      ATRLGLIEPEEGKKLISTLEKELSALHELSMSKK----------
Y2458_ENTFA      ATRLGILTNDEGHRLLSDLERELNQLYTDVYEETQEKNEIGKEG
Y1078_LATSS      AKRVRLISDQEGSQLVNELETRINQLYLEIYQTQAQNEVHRN--
                 * :: ::    *  ::  ** .:  *: