CLUSTAL format seed alignment for MF_01561

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

YCDX_ECO57       -------MYPVDLHMHTVASTHAYSTLSDYIAQAKQKGIKLFAITDHGPDMEDAPHHWHF
YCDX_ECOL6       -------MYPVDLHMHTVASTHAYSTLSDYIAQAKQKGIKLFAITDHGPDMEDAPHHWHF
YCDX_SHIBS       -------MYPVDLHMHTVASTHAYSTLSDYIAQAKQKGIKLFAITDHGPDMEDAPHHWHF
YCDX_SHISS       -------MYPVDLHMHTVASTHAYSTLSDYIAQAKQKGIKLFAITDHGPDMEDAPHHWHF
YCDX_ECOLI       -------MYPVDLHMHTVASTHAYSTLSDYIAQAKQKGIKLFAITDHGPDMEDAPHHWHF
YCDX_SHIDS       -------MYPVDLHMHTVASTHAYSTLSDYIAQAKQKGIKLFAITDHGPDMEDAPHHWHF
YCDX_SHIFL       -------MYPVDLHMHTVASTHAYSTLSDYIAQAKQKGIKLFAITDHGPDMEDAPHHWHF
YCDX_SALCH       -------MYPVDLHMHTVASTHAYSTLSDYIAEAKRKGIKLFAITDHGPDMEDAPHHWHF
YCDX_SALPA       -------MYPVDLHMHTVASTHAYSTLSDYIAEAKRKGIKLFAITDHGPDMEDAPHHWHF
YCDX_SALTI       -------MYPVDLHMHTVASTHAYSTLSDYIAEAKRKGIKLFAITDHGPDMEDAPHHWHF
YCDX_SALTY       -------MYPVDLHMHTVASTHAYSTLSDYIAEAKRKGIKLFAITDHGPDMEDAPHHWHF
Y2037_YERPE      -------MYPVDLHMHTVASTHAYSTLHDYIAEAKLKNIKLFAITDHGPDMADAPHYWHF
Y2019_YERPS      -------MYPVDLHMHTVASTHAYSTLHDYIAEAKLKNIKLFAITDHGPDMADAPHYWHF
Y2529_PECAS      -------MYPVDLHMHTVASTHAYSTLHDYIVEAQQKNIRLFAITDHGPDMADAPHYWHF
Y1652_SHEON      ------MQYPVDTHTHTVASSHAYSTIHDYLAVAKQKGVRLFATTDHGPAMADAPHFWHF
Y2586_PELCD      --MTSTLKAEVDLHVHSLASGHAYSTINEIAAEAARRGLRGVAMTDHGPNMPAAPHPYHF
Y5469_VIBVU      ------MELKIDTHSHTYASGHAYSTLIENARSAKENGLAMFCTTDHAESMPGAPHYWFF
Y4289_VIBVY      ------MELKIDTHSHTYASGHAYSTLIENARSAKENGLAMFCTTDHAESMPGAPHYWFF
Y5527_VIBPA      ------MEFKVDTHTHTYASGHAYSTLIENAKSAKENGLTMFCSTDHAESMPGAPHYWFF
Y3694_VIBCH      ------MKLAVDTHTHTYASGHAYSTLIENARAAKQNGLTLFCTTDHAESMPGAPHYWFF
Y3774_ALIF1      ------MRIQVDTHTHTYASGHAYSTIIENAFAASQLGLPMFCTTDHASSMPGAPHYWFF
Y3065_ALIF1      ------MNVVVDTHTHTLASGHAYSTIIENARSAQNKGLKLLCTTDHAPEMPGAPHYWYF
Y4505_VIBPA      ------MDIVVDSHTHTIASGHAYSTILENALAAKNKGLKLLCTTDHAPEMPGAPHYWHF
Y6022_PHOPR      ------MQFLVDTHTHTISSGHAYSTVLENAAAASQRGLEMFCVTDHAPTMPGAPHFWHF
Y620_CALBD       ------MFLEVETHCHTIASGHAYNNLEEMVLEAQKKGLKGICITDHGPEMPGSCSSLYF
Y1963_CALS4      MKGRMKLRLVLDTHTHTIASGHAFSTIIENAREAFRKGLQLICITDHGPEMPGGPHIYYF
Y509_CLOAB       ------MKYLIDLHTHTIVSGHAYTTLLENIKQASQIGIKILGTSEHGPKMPGAPHIWYF
                           :: * *:  * **:..: :    *   .:  .  ::*.  *  .    .*

YCDX_ECO57       INMRIWPRVVDGVGILRGIEANIKNVDGEIDCSGKMFDSLDLIIAGFHEPV-FAPHDKAT
YCDX_ECOL6       INMRIWPRVVDGVGILRGIEANIKNVDGEIDCSGKMFDSLDLIIAGFHEPV-FAPHDKAT
YCDX_SHIBS       INMRIWPRVVDGVGILRGIEANIKNVDGEIDCSGKMFDSLDLIIAGFHEPV-FAPHDKAT
YCDX_SHISS       INMRIWPRVVDGVGILRGIEANIKNVDGEIDCSGKMFDSLDLIIAGFHEPV-FAPHDKAT
YCDX_ECOLI       INMRIWPRVVDGVGILRGIEANIKNVDGEIDCSGKMFDSLDLIIAGFHEPV-FAPHDKAT
YCDX_SHIDS       INMRIWPRVVDGVGILRGIEANIKNVDGEIDCSGKMFDSLDLIIAGFHEPV-FAPHDKAT
YCDX_SHIFL       INMRIWPRVVDGVGILRGIEANIKNVDGEIDCSGKMFDSLDLIIAGFHEPV-FAPHDKAT
YCDX_SALCH       INMRIWPRLVDGVGILRGIEANIKNINGEIDCSGKMFDSLDLIIAGFHEPV-FAPHDKET
YCDX_SALPA       INMRIWPRLVDGVGILRGIEANIKNINGEIDCSGKMFDSLDLIIAGFHEPV-FAPHDKET
YCDX_SALTI       INMRIWPRLVDGVGILRGIEANIKNINGEIDCSGKMFDSLDLIIAGFHEPV-FAPHDKET
YCDX_SALTY       INMRIWPRLVDGVGILRGIEANIKNINGEIDCSGKMFDSLDLIIAGFHEPV-FAPHDKET
Y2037_YERPE      MNMRVWPRLVDGVGILRGIEANIKNLDGDIDCTGPMLDAVDLLIAGFHEPV-FPPQDKAA
Y2019_YERPS      MNMRVWPRLVDGVGILRGIEANIKNLDGDIDCTGPMLDAVDLLIAGFHEPV-FPPQDKAA
Y2529_PECAS      MNMRVWPRLVDGVGILRGIEANIKNIEGDIDCTGPMLDQVDVIIAGFHEPV-FPPQDKDT
Y1652_SHEON      VNLRVLPRMVDGVGILRGIEANIKNRDGEIDYFGDYLSQLDIVLAGFHEPV-FAPSDKVT
Y2586_PELCD      ECLYMIPDHLCGVRIFKGAETNIIG-PGQVDLEDRLLEKMDLVLAGFHRHCGYGPSELQA
Y5469_VIBVU      ANQRVLPRFLEGVAILRGVEANILNTEGEIDLPLSVDPNLDWAIASFHEPV-FAPSNKEA
Y4289_VIBVY      ANQRVLPRFLEGVAILRGVEANILNTEGEIDLPLSVDPNLDWAIASFHEPV-FAPSNKEA
Y5527_VIBPA      SNQKILPRFLEGVAIVRGVESNILNIEGEIDIPPSVDRNLDWVIASFHEPV-FPPANKEA
Y3694_VIBCH      SNQRILPRFLEGVGVIRGVEANILNTQGEIDLHPSVDHNLDWVIGSFHEPV-FHPADKAA
Y3774_ALIF1      NNQRVLPRFIHNVAIVRGCEANICN-DGEIDIPPSVDSHLDWVIASFHEPV-FPSKDSLV
Y3065_ALIF1      NNQRILPRFLHQVGILRGVEANILNVKGEIDLPSSSDQHLDWVIASFHEPV-FAPASEAE
Y4505_VIBPA      NNQRILPRFLHEVGILRGVEANTLNVKGEIDLPLSSDQHLDWVIASFHEPV-FRPATEAE
Y6022_PHOPR      ANQRVIPRLLHGVAVLRGVEANILNIEGEIDLDERIINQLDWVMASFHEPV-FRYTNKSD
Y620_CALBD       YNLIVVPRKINGIMVFRGCEANIVDYEGRIDIPEDALKRLDFVIASLHDVCI-PSGTVSD
Y1963_CALS4      GNLKVIPEKIEGVEILKGVEANIMDEEGRIDLPERILKKLDIVIASLHDECFEPSEDVER
Y509_CLOAB       GNMNKVPRKIYDVTVLRGCEADILNSNGDLDIPERIQNELDYIIASLHDVCI-EPGTIED
                       *  :  : :.:* *::  .  * :*        :*  :..:*            

YCDX_ECO57       NTQAMIATIASGNVHIISHPGNPKYEIDVKAVAEAAAKHQVALEINNSSFLH-SRKGSED
YCDX_ECOL6       NTQAMIATIASGNVHIISHPGNPKYEIDVKAVAEAAAKHQVALEINNSSFLH-SRKGSED
YCDX_SHIBS       NTQAMIATIASGNVHIISHPGNPKYEIDVKAVAEAAAKHQVALEINNSSFLH-SRKGSED
YCDX_SHISS       NTQAMIATIASGNVHIISHPGNPKYEIDVKAVAEAAAKHQVALEINNSSFLH-SRKGSED
YCDX_ECOLI       NTQAMIATIASGNVHIISHPGNPKYEIDVKAVAEAAAKHQVALEINNSSFLH-SRKGSED
YCDX_SHIDS       NTQAMIATIASGNVHIISHPGNPKYEIDVKAVAEAAAKHQVALEINNSSFLH-SRKGSED
YCDX_SHIFL       NTQAMISTIASGNVHIISHPGNPKYEIDVKAVAEAAAKHQVALEINNSSFLH-SRKGSED
YCDX_SALCH       NTQAMIATIASGKVHIISHPGNPKYPVEVKAIAQAAAKHHVALEINNSSFLH-SRKGSED
YCDX_SALPA       NTQAMIATIASGKVHIISHPGNPKYPVEVKAIAQAAAKHHVALEINNSSFLH-SRKGSED
YCDX_SALTI       NTQAMIATIASGKVHIISHPGNPKYPVEVKAIAQAAAKHHVALEINNSSFLH-SRKGSED
YCDX_SALTY       NTQAMIATIASGKVHIISHPGNPKYPVEVKAIAQAAAKHHVALEINNSSFLH-SRKGSED
Y2037_YERPE      NTQAMIATMAQGNVHIISHPGNPKYPVDIPAIAQAAAKYNVALELNNSSFAH-SRKGSEA
Y2019_YERPS      NTQAMIATMAQGNVHIISHPGNPKYPVDIPAIAQAAAKYNVALELNNSSFAH-SRKGSEA
Y2529_PECAS      HTAAMIATMARGDAHIISHPGNPKFPVDIRAIAEAAAKYNVALELNNSSFIH-SRQGSEP
Y1652_SHEON      HTEAMINTIRSGKVDIITHPGNPAYPIDIEAVVTAAAQYGVALEINNSSFEV-SRKGSEA
Y2586_PELCD      NTRAVLELMENPRIHIICHPGNPEYPLDYEAVARQAAATGTALELNNSSFVT-SRVGSAD
Y5469_VIBVU      HTQALLNVIQGGRIDALGHLGNPHFDFDFHAVLHCAKDHNVAIEINNSTLKGHSRVGSVE
Y4289_VIBVY      HTQALLNVIQGGRIDALGHLGNPHFDFDFHAVLHCAKEHNVAIEINNSTLKGHSRVGSVE
Y5527_VIBPA      HTEALINVIKSGRVDALGHLGNPNFDFDFEQVLKCAKEHNVAIEINNTTLKGNSRVGSVD
Y3694_VIBCH      HTQALIETIKGGRVDALGHLGNPHFDFDFEQVIACAKAHNVAIEINNSTLKGHSRVGSID
Y3774_ALIF1      HTQALIKVIRSNRVDALGHLGNPNFDFDFEAVIACAAEYNVAIELNNTSLKGETRIGSID
Y3065_ALIF1      HTAALLNVIKSGRIDVLGHSGNPNYPFDIERVLQCAKEHNVAIEVNNTSLTGKSRKGSDV
Y4505_VIBPA      HTAALINVIKSGRVDVLGHLGNPNYPFDMEQVLRCAKSHNVAIEVNNTSLTGKSRKGSDA
Y6022_PHOPR      HTQALLNVIRSGRVDAIGHPGNPNYDFDFESVFKEAAKHNVVMEINNSSLSG-SRVGSEI
Y620_CALBD       HTRALIGAIKNPYIHCIGHPGNPLYEIDKEEVVLAAKEYKKAIEINNSSFYV-REK-SKE
Y1963_CALS4      NTKALINAIKNPYVDIIGHPGNPIYPIDIERVLEAAKEYGKFIEINNSSFVT-SRRGSEK
Y509_CLOAB       NTKALLNAMNNPNIDILGHTGNPMYPIDIDAVVSKAKEKNVLIEINNGSLSG-SREGSYD
                 :* *::  :     . : * *** : .:   :   *      :*:** ::    .  *  

YCDX_ECO57       NCRAVAAAVRDAGGWVALGSDSHTAFTMGEFEECLKILDAVDFPPERILNVSPRRLLNFL
YCDX_ECOL6       NCRAVAAAVRDAGGWVALGSDSHTAFTMGEFEECLKILDAVDFPPERILNVSPRRLLNFL
YCDX_SHIBS       NCRAVAAAVRDAGGWVALGSDSHTAFTMGEFEECLKILDAVDFPPERILNVSPRRLLNFL
YCDX_SHISS       NCRAVAAAVRDAGGWVALGSDSHTAFTMGEFEECLKILDAVDFPPERILNVSPRRLLNFL
YCDX_ECOLI       NCREVAAAVRDAGGWVALGSDSHTAFTMGEFEECLKILDAVDFPPERILNVSPRRLLNFL
YCDX_SHIDS       NCRAVAAAVRDAGGWVALGSDSHTAFSMGEFEECLKILDAVDFPPERILNVSPRRLLNFL
YCDX_SHIFL       NCRAVAAAVRDAGGWVALGSDSHTAFTMGEFEECLKILDAVDFPLERILNVSPRRLLNFL
YCDX_SALCH       NCRAVAAAVRDAGGWVALGSDSHTAFTLGDFTECRKILDAVNFPEDRILNVSPQRLLAFL
YCDX_SALPA       NCRAVAAAVRDAGGWVALGSDSHTAFTLGDFTECRKILDAVNFPEDRILNVSPQRLLAFL
YCDX_SALTI       NCRAVAAAVRDAGGWVALGSDSHTAFTLGDFTECRKILDAVNFPEDRILNVSPQRLLAFL
YCDX_SALTY       NCRAVAAAVRDAGGWVALGSDSHTAFTLGDFTECRKILDAVNFPEDRILNVSPQRLLAFL
Y2037_YERPE      NCRAIAAAVRDAGGWLALGSDSHIAYALGIFEHCERIIAEVNFPQERILNVSPRRLLDYL
Y2019_YERPS      NCRAIAAAVRDAGGWLALGSDSHIAYALGIFEHCERIIAEVNFPQERILNVSPRRLLDYL
Y2529_PECAS      NCRAIAEAVRDAGGLLSLGSDSHIAFSLGDFTHCERILQEVNFPQDRILNVSPRRVLDFL
Y1652_SHEON      NCTAIAKAAKALGATLVMGSDSHVAFSLGGFDRALSIIDAVDYPKDKLLNRSPMALLDFL
Y2586_PELCD      NCRLIAKLCARFHSPVSLGSDAHIAQSVASFGHALDALNAAGIAPEQIVNRTLETTLDFL
Y5469_VIBVU      RCYEIARVGKALGVYFTTGSDAHFCQDVGKLDLASELLDSVGIDSHRVITHSPSQFLDFL
Y4289_VIBVY      RCYEIARVGKALGVYFTTGSDAHFCQDVGKLDLASELLDSVGIDSHRVITHSPSQFLDFL
Y5527_VIBPA      RCHEIAQIGKALDVYFTTGSDAHFCHDVGNLELVSELMDNLDIDSNKVITHSAKQFLSFL
Y3694_VIBCH      RCYEIARVAKSLDAYITTGSDAHFCLDIGGLSLASQLIDEVGINPQRVITHTARQFLDFL
Y3774_ALIF1      RCYEIAKVAKKLGAYVTTGSDAHFCEDIGKFSKVEQLIDDIDFPLDKVITHTPKQFLDFL
Y3065_ALIF1      RCDKIVEIGKEVGVYFTTGSDAHFCEEIARLELAIALLEKYEISEDKIITTSTSRFLNFL
Y4505_VIBPA      RCDQIVALGKEIGVYFSTGSDAHFCEEISKLDLAIELLEKHGVEKDKILTTSTRRFLKFL
Y6022_PHOPR      RCEDIAMYIKEIGGRITTGSDAHFAADVGNFESVEPLLKKVNFPIESIITRHSRSFLDFL
Y620_CALBD       NCIEILKLCKKYGVYIAMGSDAHYKADIGRCEITQKLVCEYEFPPELIVNKSLESFISFL
Y1963_CALS4      ICPIIAGKAKEMGVRVAVGSDAHICFDVGRFDEAIRLLEDINMPEELVLNTSVDKVKQYL
Y509_CLOAB       NCKKIAQACKKKGVKVILGTDSHISFTIGNFDKVQKLLDSVDMPKELIMNTDEKKIVEYL
                  *  :          .  *:*:*    :.        :       . ::.        :*

YCDX_ECO57       ESRGMAPIAEFADL------
YCDX_ECOL6       ESRGMAPIAEFADL------
YCDX_SHIBS       ESRGMAPIAEFADL------
YCDX_SHISS       ESRGMAPIAEFADL------
YCDX_ECOLI       ESRGMAPIAEFADL------
YCDX_SHIDS       ESRGMAPIAEFADL------
YCDX_SHIFL       ESRGMAPIAEFADL------
YCDX_SALCH       ESRGMAPVPEFAEL------
YCDX_SALPA       ESRGMAPVPEFAEL------
YCDX_SALTI       ESRGMAPVPEFAEL------
YCDX_SALTY       ESRGMAPVPEFAEL------
Y2037_YERPE      EQRGRPAIPELAEL------
Y2019_YERPS      EQRGRPAIPELAEL------
Y2529_PECAS      EQRGMPAIAELADL------
Y1652_SHEON      TLRGHQTVADFIPHFRDEAI
Y2586_PELCD      ---GMNT-------------
Y5469_VIBVU      ELRGRGPIDELASLRQ----
Y4289_VIBVY      ELRGRGPIDELASLRQ----
Y5527_VIBPA      ELRGRLPIAEYDEIRNA---
Y3694_VIBCH      ELRGRQPIEEFAGLL-----
Y3774_ALIF1      ALRGRAPIEEFKKLMV----
Y3065_ALIF1      LLRGKPIIPEFDSLY-----
Y4505_VIBPA      LLRGKPRIPEFDAFY-----
Y6022_PHOPR      EERGKKAISELAHL------
Y620_CALBD       KLHGKDIDI-----------
Y1963_CALS4      QEKRKRIGGGQNSWN-----
Y509_CLOAB       KAKGKLKNFNLE--------